summaryrefslogtreecommitdiff
path: root/Source/ThirdParty
diff options
context:
space:
mode:
authorKonstantin Tokarev <annulen@yandex.ru>2017-10-18 16:01:48 +0300
committerKonstantin Tokarev <annulen@yandex.ru>2017-10-20 09:53:13 +0000
commitf5345badaeefac7c03c8a26dea6b89706871c3fe (patch)
treebc863fadf9ec8869690fa51f7e7e63ec2ad60294 /Source/ThirdParty
parent778e0c7c940f8a22f9a43290aef378fb707ca088 (diff)
downloadqtwebkit-f5345badaeefac7c03c8a26dea6b89706871c3fe.tar.gz
Import WebKit commit e89cea5f01479652674d3c24b2f387eb0987d0a1
Change-Id: Ifc00865ceeb5b83b7990f91af7dbbd1a05df1c30 Reviewed-by: Konstantin Tokarev <annulen@yandex.ru>
Diffstat (limited to 'Source/ThirdParty')
-rw-r--r--Source/ThirdParty/brotli/CMakeLists.txt4
-rw-r--r--Source/ThirdParty/brotli/README.webkit2
-rw-r--r--Source/ThirdParty/brotli/common/constants.h57
-rwxr-xr-xSource/ThirdParty/brotli/common/dictionary.bin432
-rw-r--r--Source/ThirdParty/brotli/common/dictionary.c5905
-rw-r--r--Source/ThirdParty/brotli/common/dictionary.h64
-rwxr-xr-xSource/ThirdParty/brotli/common/version.h19
-rw-r--r--Source/ThirdParty/brotli/dec/bit_reader.c12
-rw-r--r--Source/ThirdParty/brotli/dec/bit_reader.h73
-rw-r--r--Source/ThirdParty/brotli/dec/context.h2
-rw-r--r--Source/ThirdParty/brotli/dec/decode.c1302
-rw-r--r--Source/ThirdParty/brotli/dec/decode.h162
-rw-r--r--Source/ThirdParty/brotli/dec/dictionary.c9466
-rw-r--r--Source/ThirdParty/brotli/dec/dictionary.h38
-rw-r--r--Source/ThirdParty/brotli/dec/huffman.c54
-rw-r--r--Source/ThirdParty/brotli/dec/huffman.h8
-rw-r--r--Source/ThirdParty/brotli/dec/port.h124
-rw-r--r--Source/ThirdParty/brotli/dec/prefix.h8
-rw-r--r--Source/ThirdParty/brotli/dec/state.c70
-rw-r--r--Source/ThirdParty/brotli/dec/state.h65
-rw-r--r--Source/ThirdParty/brotli/dec/transform.h4
-rw-r--r--Source/ThirdParty/brotli/dec/types.h38
-rwxr-xr-xSource/ThirdParty/brotli/include/brotli/decode.h339
-rwxr-xr-xSource/ThirdParty/brotli/include/brotli/encode.h402
-rwxr-xr-xSource/ThirdParty/brotli/include/brotli/port.h146
-rwxr-xr-xSource/ThirdParty/brotli/include/brotli/types.h90
-rwxr-xr-xSource/ThirdParty/brotli/update.sh6
-rw-r--r--Source/ThirdParty/woff2/CMakeLists.txt3
-rw-r--r--Source/ThirdParty/woff2/README.webkit2
-rw-r--r--Source/ThirdParty/woff2/include/woff2/decode.h (renamed from Source/ThirdParty/woff2/src/woff2_dec.h)24
-rw-r--r--Source/ThirdParty/woff2/include/woff2/encode.h (renamed from Source/ThirdParty/woff2/src/woff2_enc.h)29
-rw-r--r--Source/ThirdParty/woff2/include/woff2/output.h (renamed from Source/ThirdParty/woff2/src/woff2_out.h)46
-rw-r--r--Source/ThirdParty/woff2/src/buffer.h34
-rw-r--r--Source/ThirdParty/woff2/src/convert_woff2ttf_fuzzer.cc13
-rw-r--r--Source/ThirdParty/woff2/src/convert_woff2ttf_fuzzer_new_entry.cc12
-rw-r--r--Source/ThirdParty/woff2/src/file.h22
-rw-r--r--Source/ThirdParty/woff2/src/font.cc35
-rw-r--r--Source/ThirdParty/woff2/src/font.h24
-rw-r--r--Source/ThirdParty/woff2/src/glyph.cc54
-rw-r--r--Source/ThirdParty/woff2/src/glyph.h24
-rw-r--r--Source/ThirdParty/woff2/src/normalize.cc31
-rw-r--r--Source/ThirdParty/woff2/src/normalize.h26
-rw-r--r--Source/ThirdParty/woff2/src/port.h33
-rw-r--r--Source/ThirdParty/woff2/src/round.h22
-rw-r--r--Source/ThirdParty/woff2/src/store_bytes.h34
-rw-r--r--Source/ThirdParty/woff2/src/table_tags.cc22
-rw-r--r--Source/ThirdParty/woff2/src/table_tags.h22
-rw-r--r--Source/ThirdParty/woff2/src/transform.cc22
-rw-r--r--Source/ThirdParty/woff2/src/transform.h22
-rw-r--r--Source/ThirdParty/woff2/src/variable_length.cc26
-rw-r--r--Source/ThirdParty/woff2/src/variable_length.h22
-rw-r--r--Source/ThirdParty/woff2/src/woff2_common.cc28
-rw-r--r--Source/ThirdParty/woff2/src/woff2_common.h22
-rw-r--r--Source/ThirdParty/woff2/src/woff2_compress.cc24
-rw-r--r--Source/ThirdParty/woff2/src/woff2_dec.cc102
-rw-r--r--Source/ThirdParty/woff2/src/woff2_decompress.cc27
-rw-r--r--Source/ThirdParty/woff2/src/woff2_enc.cc69
-rw-r--r--Source/ThirdParty/woff2/src/woff2_info.cc144
-rw-r--r--Source/ThirdParty/woff2/src/woff2_out.cc26
-rwxr-xr-xSource/ThirdParty/woff2/update.sh3
60 files changed, 8856 insertions, 11085 deletions
diff --git a/Source/ThirdParty/brotli/CMakeLists.txt b/Source/ThirdParty/brotli/CMakeLists.txt
index 22a052d36..3a3ade378 100644
--- a/Source/ThirdParty/brotli/CMakeLists.txt
+++ b/Source/ThirdParty/brotli/CMakeLists.txt
@@ -1,13 +1,15 @@
set(BROTLI_DIR "${THIRDPARTY_DIR}/brotli")
set(BROTLI_INCLUDE_DIRECTORIES
+ "${BROTLI_DIR}/common"
"${BROTLI_DIR}/dec"
+ "${BROTLI_DIR}/include"
)
set(BROTLI_SOURCES
+ ${BROTLI_DIR}/common/dictionary.c
${BROTLI_DIR}/dec/bit_reader.c
${BROTLI_DIR}/dec/decode.c
- ${BROTLI_DIR}/dec/dictionary.c
${BROTLI_DIR}/dec/huffman.c
${BROTLI_DIR}/dec/state.c
)
diff --git a/Source/ThirdParty/brotli/README.webkit b/Source/ThirdParty/brotli/README.webkit
index 474afa2e4..e9f8bb596 100644
--- a/Source/ThirdParty/brotli/README.webkit
+++ b/Source/ThirdParty/brotli/README.webkit
@@ -14,4 +14,4 @@ The in-tree copy is updated by running
sh update.sh
from within the modules/brotli directory.
-Current version: [commit 29d31d5921b0a2b323ac24e7f7d0cdc9a3c0dd08].
+Current version: [commit 4f8cd4c0f4443d51a9603790a445b06c073b7a4d].
diff --git a/Source/ThirdParty/brotli/common/constants.h b/Source/ThirdParty/brotli/common/constants.h
new file mode 100644
index 000000000..416ec5596
--- /dev/null
+++ b/Source/ThirdParty/brotli/common/constants.h
@@ -0,0 +1,57 @@
+/* Copyright 2016 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+#ifndef BROTLI_COMMON_CONSTANTS_H_
+#define BROTLI_COMMON_CONSTANTS_H_
+
+/* Specification: 7.3. Encoding of the context map */
+#define BROTLI_CONTEXT_MAP_MAX_RLE 16
+
+/* Specification: 2. Compressed representation overview */
+#define BROTLI_MAX_NUMBER_OF_BLOCK_TYPES 256
+
+/* Specification: 3.3. Alphabet sizes: insert-and-copy length */
+#define BROTLI_NUM_LITERAL_SYMBOLS 256
+#define BROTLI_NUM_COMMAND_SYMBOLS 704
+#define BROTLI_NUM_BLOCK_LEN_SYMBOLS 26
+#define BROTLI_MAX_CONTEXT_MAP_SYMBOLS (BROTLI_MAX_NUMBER_OF_BLOCK_TYPES + \
+ BROTLI_CONTEXT_MAP_MAX_RLE)
+#define BROTLI_MAX_BLOCK_TYPE_SYMBOLS (BROTLI_MAX_NUMBER_OF_BLOCK_TYPES + 2)
+
+/* Specification: 3.5. Complex prefix codes */
+#define BROTLI_REPEAT_PREVIOUS_CODE_LENGTH 16
+#define BROTLI_REPEAT_ZERO_CODE_LENGTH 17
+#define BROTLI_CODE_LENGTH_CODES (BROTLI_REPEAT_ZERO_CODE_LENGTH + 1)
+/* "code length of 8 is repeated" */
+#define BROTLI_INITIAL_REPEATED_CODE_LENGTH 8
+
+/* Specification: 4. Encoding of distances */
+#define BROTLI_NUM_DISTANCE_SHORT_CODES 16
+#define BROTLI_MAX_NPOSTFIX 3
+#define BROTLI_MAX_NDIRECT 120
+#define BROTLI_MAX_DISTANCE_BITS 24U
+/* BROTLI_NUM_DISTANCE_SYMBOLS == 520 */
+#define BROTLI_NUM_DISTANCE_SYMBOLS (BROTLI_NUM_DISTANCE_SHORT_CODES + \
+ BROTLI_MAX_NDIRECT + \
+ (BROTLI_MAX_DISTANCE_BITS << \
+ (BROTLI_MAX_NPOSTFIX + 1)))
+/* Distance that is guaranteed to be representable in any stream. */
+#define BROTLI_MAX_DISTANCE 0x3FFFFFC
+
+/* 7.1. Context modes and context ID lookup for literals */
+/* "context IDs for literals are in the range of 0..63" */
+#define BROTLI_LITERAL_CONTEXT_BITS 6
+
+/* 7.2. Context ID for distances */
+#define BROTLI_DISTANCE_CONTEXT_BITS 2
+
+/* 9.1. Format of the Stream Header */
+/* Number of slack bytes for window size. Don't confuse
+ with BROTLI_NUM_DISTANCE_SHORT_CODES. */
+#define BROTLI_WINDOW_GAP 16
+#define BROTLI_MAX_BACKWARD_LIMIT(W) (((size_t)1 << (W)) - BROTLI_WINDOW_GAP)
+
+#endif /* BROTLI_COMMON_CONSTANTS_H_ */
diff --git a/Source/ThirdParty/brotli/common/dictionary.bin b/Source/ThirdParty/brotli/common/dictionary.bin
new file mode 100755
index 000000000..a585c0e29
--- /dev/null
+++ b/Source/ThirdParty/brotli/common/dictionary.bin
@@ -0,0 +1,432 @@
+timedownlifeleftbackcodedatashowonlysitecityopenjustlikefreeworktextyearoverbodyloveformbookplaylivelinehelphomesidemorewordlongthemviewfindpagedaysfullheadtermeachareafromtruemarkableuponhighdatelandnewsevennextcasebothpostusedmadehandherewhatnameLinkblogsizebaseheldmakemainuser') +holdendswithNewsreadweresigntakehavegameseencallpathwellplusmenufilmpartjointhislistgoodneedwayswestjobsmindalsologorichuseslastteamarmyfoodkingwilleastwardbestfirePageknowaway.pngmovethanloadgiveselfnotemuchfeedmanyrockicononcelookhidediedHomerulehostajaxinfoclublawslesshalfsomesuchzone100%onescareTimeracebluefourweekfacehopegavehardlostwhenparkkeptpassshiproomHTMLplanTypedonesavekeepflaglinksoldfivetookratetownjumpthusdarkcardfilefearstaykillthatfallautoever.comtalkshopvotedeepmoderestturnbornbandfellroseurl(skinrolecomeactsagesmeetgold.jpgitemvaryfeltthensenddropViewcopy1.0"</a>stopelseliestourpack.gifpastcss?graymean&gt;rideshotlatesaidroadvar feeljohnrickportfast'UA-dead</b>poorbilltypeU.S.woodmust2px;Inforankwidewantwalllead[0];paulwavesure$('#waitmassarmsgoesgainlangpaid!-- lockunitrootwalkfirmwifexml"songtest20pxkindrowstoolfontmailsafestarmapscorerainflowbabyspansays4px;6px;artsfootrealwikiheatsteptriporg/lakeweaktoldFormcastfansbankveryrunsjulytask1px;goalgrewslowedgeid="sets5px;.js?40pxif (soonseatnonetubezerosentreedfactintogiftharm18pxcamehillboldzoomvoideasyringfillpeakinitcost3px;jacktagsbitsrolleditknewnear<!--growJSONdutyNamesaleyou lotspainjazzcoldeyesfishwww.risktabsprev10pxrise25pxBlueding300,ballfordearnwildbox.fairlackverspairjunetechif(!pickevil$("#warmlorddoespull,000ideadrawhugespotfundburnhrefcellkeystickhourlossfuel12pxsuitdealRSS"agedgreyGET"easeaimsgirlaids8px;navygridtips#999warsladycars); }php?helltallwhomzh:å*/
+ 100hall.
+
+A7px;pushchat0px;crew*/</hash75pxflatrare && tellcampontolaidmissskiptentfinemalegetsplot400,
+
+coolfeet.php<br>ericmostguidbelldeschairmathatom/img&#82luckcent000;tinygonehtmlselldrugFREEnodenick?id=losenullvastwindRSS wearrelybeensamedukenasacapewishgulfT23:hitsslotgatekickblurthey15px''););">msiewinsbirdsortbetaseekT18:ordstreemall60pxfarm’sboys[0].');"POSTbearkids);}}marytend(UK)quadzh:æ-siz----prop'); liftT19:viceandydebt>RSSpoolneckblowT16:doorevalT17:letsfailoralpollnovacolsgene —softrometillross<h3>pourfadepink<tr>mini)|!(minezh:èbarshear00);milk -->ironfreddiskwentsoilputs/js/holyT22:ISBNT20:adamsees<h2>json', 'contT21: RSSloopasiamoon</p>soulLINEfortcartT14:<h1>80px!--<9px;T04:mike:46ZniceinchYorkricezh:ä'));puremageparatonebond:37Z_of_']);000,zh:çtankyardbowlbush:56ZJava30px
+|}
+%C3%:34ZjeffEXPIcashvisagolfsnowzh:équer.csssickmeatmin.binddellhirepicsrent:36ZHTTP-201fotowolfEND xbox:54ZBODYdick;
+}
+exit:35Zvarsbeat'});diet999;anne}}</[i].Langkm²wiretoysaddssealalex;
+ }echonine.org005)tonyjewssandlegsroof000) 200winegeardogsbootgarycutstyletemption.xmlcockgang$('.50pxPh.Dmiscalanloandeskmileryanunixdisc);}
+dustclip).
+
+70px-200DVDs7]><tapedemoi++)wageeurophiloptsholeFAQsasin-26TlabspetsURL bulkcook;}
+HEAD[0])abbrjuan(198leshtwin</i>sonyguysfuckpipe|-
+!002)ndow[1];[];
+Log salt
+ bangtrimbath){
+00px
+});ko:ìfeesad> s:// [];tollplug(){
+{
+ .js'200pdualboat.JPG);
+}quot);
+
+');
+
+} 201420152016201720182019202020212022202320242025202620272028202920302031203220332034203520362037201320122011201020092008200720062005200420032002200120001999199819971996199519941993199219911990198919881987198619851984198319821981198019791978197719761975197419731972197119701969196819671966196519641963196219611960195919581957195619551954195319521951195010001024139400009999comomásesteestaperotodohacecadaañobiendíaasívidacasootroforosolootracualdijosidograntipotemadebealgoquéestonadatrespococasabajotodasinoaguapuesunosantediceluisellamayozonaamorpisoobraclicellodioshoracasiзанаомрарутанепоотизнодотожеонихÐаеебымыВыÑовывоÐообПолиниРФÐеМытыОнимдаЗаДаÐуОбтеИзейнуммТыужÙيأنمامعكلأوردياÙىهولملكاولهبسالإنهيأيقدهلثمبهلوليبلايبكشيامأمنتبيلنحبهممشوشfirstvideolightworldmediawhitecloseblackrightsmallbooksplacemusicfieldorderpointvalueleveltableboardhousegroupworksyearsstatetodaywaterstartstyledeathpowerphonenighterrorinputabouttermstitletoolseventlocaltimeslargewordsgamesshortspacefocusclearmodelblockguideradiosharewomenagainmoneyimagenamesyounglineslatercolorgreenfront&amp;watchforcepricerulesbeginaftervisitissueareasbelowindextotalhourslabelprintpressbuiltlinksspeedstudytradefoundsenseundershownformsrangeaddedstillmovedtakenaboveflashfixedoftenotherviewschecklegalriveritemsquickshapehumanexistgoingmoviethirdbasicpeacestagewidthloginideaswrotepagesusersdrivestorebreaksouthvoicesitesmonthwherebuildwhichearthforumthreesportpartyClicklowerlivesclasslayerentrystoryusagesoundcourtyour birthpopuptypesapplyImagebeinguppernoteseveryshowsmeansextramatchtrackknownearlybegansuperpapernorthlearngivennamedendedTermspartsGroupbrandusingwomanfalsereadyaudiotakeswhile.com/livedcasesdailychildgreatjudgethoseunitsneverbroadcoastcoverapplefilescyclesceneplansclickwritequeenpieceemailframeolderphotolimitcachecivilscaleenterthemetheretouchboundroyalaskedwholesincestock namefaithheartemptyofferscopeownedmightalbumthinkbloodarraymajortrustcanonunioncountvalidstoneStyleLoginhappyoccurleft:freshquitefilmsgradeneedsurbanfightbasishoverauto;route.htmlmixedfinalYour slidetopicbrownalonedrawnsplitreachRightdatesmarchquotegoodsLinksdoubtasyncthumballowchiefyouthnovel10px;serveuntilhandsCheckSpacequeryjamesequaltwice0,000Startpanelsongsroundeightshiftworthpostsleadsweeksavoidthesemilesplanesmartalphaplantmarksratesplaysclaimsalestextsstarswrong</h3>thing.org/multiheardPowerstandtokensolid(thisbringshipsstafftriedcallsfullyfactsagentThis //-->adminegyptEvent15px;Emailtrue"crossspentblogsbox">notedleavechinasizesguest</h4>robotheavytrue,sevengrandcrimesignsawaredancephase><!--en_US&#39;200px_namelatinenjoyajax.ationsmithU.S. holdspeterindianav">chainscorecomesdoingpriorShare1990sromanlistsjapanfallstrialowneragree</h2>abusealertopera"-//WcardshillsteamsPhototruthclean.php?saintmetallouismeantproofbriefrow">genretrucklooksValueFrame.net/-->
+<try {
+var makescostsplainadultquesttrainlaborhelpscausemagicmotortheir250pxleaststepsCountcouldglasssidesfundshotelawardmouthmovesparisgivesdutchtexasfruitnull,||[];top">
+<!--POST"ocean<br/>floorspeakdepth sizebankscatchchart20px;aligndealswould50px;url="parksmouseMost ...</amongbrainbody none;basedcarrydraftreferpage_home.meterdelaydreamprovejoint</tr>drugs<!-- aprilidealallenexactforthcodeslogicView seemsblankports (200saved_linkgoalsgrantgreekhomesringsrated30px;whoseparse();" Blocklinuxjonespixel');">);if(-leftdavidhorseFocusraiseboxesTrackement</em>bar">.src=toweralt="cablehenry24px;setupitalysharpminortastewantsthis.resetwheelgirls/css/100%;clubsstuffbiblevotes 1000korea});
+bandsqueue= {};80px;cking{
+ aheadclockirishlike ratiostatsForm"yahoo)[0];Aboutfinds</h1>debugtasksURL =cells})();12px;primetellsturns0x600.jpg"spainbeachtaxesmicroangel--></giftssteve-linkbody.});
+ mount (199FAQ</rogerfrankClass28px;feeds<h1><scotttests22px;drink) || lewisshall#039; for lovedwaste00px;ja:ã‚simon<fontreplymeetsuntercheaptightBrand) != dressclipsroomsonkeymobilmain.Name platefunnytreescom/"1.jpgwmodeparamSTARTleft idden, 201);
+}
+form.viruschairtransworstPagesitionpatch<!--
+o-cacfirmstours,000 asiani++){adobe')[0]id=10both;menu .2.mi.png"kevincoachChildbruce2.jpgURL)+.jpg|suitesliceharry120" sweettr>
+name=diegopage swiss-->
+
+#fff;">Log.com"treatsheet) && 14px;sleepntentfiledja:ãƒid="cName"worseshots-box-delta
+&lt;bears:48Z<data-rural</a> spendbakershops= "";php">ction13px;brianhellosize=o=%2F joinmaybe<img img">, fjsimg" ")[0]MTopBType"newlyDanskczechtrailknows</h5>faq">zh-cn10);
+-1");type=bluestrulydavis.js';>
+<!steel you h2>
+form jesus100% menu.
+
+walesrisksumentddingb-likteachgif" vegasdanskeestishqipsuomisobredesdeentretodospuedeañosestátienehastaotrospartedondenuevohacerformamismomejormundoaquídíassóloayudafechatodastantomenosdatosotrassitiomuchoahoralugarmayorestoshorastenerantesfotosestaspaísnuevasaludforosmedioquienmesespoderchileserávecesdecirjoséestarventagrupohechoellostengoamigocosasnivelgentemismaairesjuliotemashaciafavorjuniolibrepuntobuenoautorabrilbuenatextomarzosaberlistaluegocómoenerojuegoperúhaberestoynuncamujervalorfueralibrogustaigualvotoscasosguíapuedosomosavisousteddebennochebuscafaltaeurosseriedichocursoclavecasasleónplazolargoobrasvistaapoyojuntotratavistocrearcampohemoscincocargopisosordenhacenáreadiscopedrocercapuedapapelmenorútilclarojorgecalleponertardenadiemarcasigueellassiglocochemotosmadreclaserestoniñoquedapasarbancohijosviajepabloéstevienereinodejarfondocanalnorteletracausatomarmanoslunesautosvillavendopesartipostengamarcollevapadreunidovamoszonasambosbandamariaabusomuchasubirriojavivirgradochicaallíjovendichaestantalessalirsuelopesosfinesllamabuscoéstalleganegroplazahumorpagarjuntadobleislasbolsabañohablaluchaÃreadicenjugarnotasvalleallácargadolorabajoestégustomentemariofirmacostofichaplatahogarartesleyesaquelmuseobasespocosmitadcielochicomiedoganarsantoetapadebesplayaredessietecortecoreadudasdeseoviejodeseaaguas&quot;domaincommonstatuseventsmastersystemactionbannerremovescrollupdateglobalmediumfilternumberchangeresultpublicscreenchoosenormaltravelissuessourcetargetspringmodulemobileswitchphotosborderregionitselfsocialactivecolumnrecordfollowtitle>eitherlengthfamilyfriendlayoutauthorcreatereviewsummerserverplayedplayerexpandpolicyformatdoublepointsseriespersonlivingdesignmonthsforcesuniqueweightpeopleenergynaturesearchfigurehavingcustomoffsetletterwindowsubmitrendergroupsuploadhealthmethodvideosschoolfutureshadowdebatevaluesObjectothersrightsleaguechromesimplenoticesharedendingseasonreportonlinesquarebuttonimagesenablemovinglatestwinterFranceperiodstrongrepeatLondondetailformeddemandsecurepassedtoggleplacesdevicestaticcitiesstreamyellowattackstreetflighthiddeninfo">openedusefulvalleycausesleadersecretseconddamagesportsexceptratingsignedthingseffectfieldsstatesofficevisualeditorvolumeReportmuseummoviesparentaccessmostlymother" id="marketgroundchancesurveybeforesymbolmomentspeechmotioninsidematterCenterobjectexistsmiddleEuropegrowthlegacymannerenoughcareeransweroriginportalclientselectrandomclosedtopicscomingfatheroptionsimplyraisedescapechosenchurchdefinereasoncorneroutputmemoryiframepolicemodelsNumberduringoffersstyleskilledlistedcalledsilvermargindeletebetterbrowselimitsGlobalsinglewidgetcenterbudgetnowrapcreditclaimsenginesafetychoicespirit-stylespreadmakingneededrussiapleaseextentScriptbrokenallowschargedividefactormember-basedtheoryconfigaroundworkedhelpedChurchimpactshouldalwayslogo" bottomlist">){var prefixorangeHeader.push(couplegardenbridgelaunchReviewtakingvisionlittledatingButtonbeautythemesforgotSearchanchoralmostloadedChangereturnstringreloadMobileincomesupplySourceordersviewed&nbsp;courseAbout island<html cookiename="amazonmodernadvicein</a>: The dialoghousesBEGIN MexicostartscentreheightaddingIslandassetsEmpireSchooleffortdirectnearlymanualSelect.
+
+Onejoinedmenu">PhilipawardshandleimportOfficeregardskillsnationSportsdegreeweekly (e.g.behinddoctorloggedunited</b></beginsplantsassistartistissued300px|canadaagencyschemeremainBrazilsamplelogo">beyond-scaleacceptservedmarineFootercamera</h1>
+_form"leavesstress" />
+.gif" onloadloaderOxfordsistersurvivlistenfemaleDesignsize="appealtext">levelsthankshigherforcedanimalanyoneAfricaagreedrecentPeople<br />wonderpricesturned|| {};main">inlinesundaywrap">failedcensusminutebeaconquotes150px|estateremoteemail"linkedright;signalformal1.htmlsignupprincefloat:.png" forum.AccesspaperssoundsextendHeightsliderUTF-8"&amp; Before. WithstudioownersmanageprofitjQueryannualparamsboughtfamousgooglelongeri++) {israelsayingdecidehome">headerensurebranchpiecesblock;statedtop"><racingresize--&gt;pacitysexualbureau.jpg" 10,000obtaintitlesamount, Inc.comedymenu" lyricstoday.indeedcounty_logo.FamilylookedMarketlse ifPlayerturkey);var forestgivingerrorsDomain}else{insertBlog</footerlogin.fasteragents<body 10px 0pragmafridayjuniordollarplacedcoversplugin5,000 page">boston.test(avatartested_countforumsschemaindex,filledsharesreaderalert(appearSubmitline">body">
+* TheThoughseeingjerseyNews</verifyexpertinjurywidth=CookieSTART across_imagethreadnativepocketbox">
+System DavidcancertablesprovedApril reallydriveritem">more">boardscolorscampusfirst || [];media.guitarfinishwidth:showedOther .php" assumelayerswilsonstoresreliefswedenCustomeasily your String
+
+Whiltaylorclear:resortfrenchthough") + "<body>buyingbrandsMembername">oppingsector5px;">vspacepostermajor coffeemartinmaturehappen</nav>kansaslink">Images=falsewhile hspace0&amp;
+
+In powerPolski-colorjordanBottomStart -count2.htmlnews">01.jpgOnline-rightmillerseniorISBN 00,000 guidesvalue)ectionrepair.xml" rights.html-blockregExp:hoverwithinvirginphones</tr> using
+ var >');
+ </td>
+</tr>
+bahasabrasilgalegomagyarpolskisrpskiردو中文简体ç¹é«”ä¿¡æ¯ä¸­å›½æˆ‘们一个公å¸ç®¡ç†è®ºå›å¯ä»¥æœåŠ¡æ—¶é—´ä¸ªäººäº§å“自己ä¼ä¸šæŸ¥çœ‹å·¥ä½œè”系没有网站所有评论中心文章用户首页作者技术问题相关下载æœç´¢ä½¿ç”¨è½¯ä»¶åœ¨çº¿ä¸»é¢˜èµ„料视频回å¤æ³¨å†Œç½‘络收è—内容推è市场消æ¯ç©ºé—´å‘布什么好å‹ç”Ÿæ´»å›¾ç‰‡å‘展如果手机新闻最新方å¼åŒ—京æ供关于更多这个系统知é“游æˆå¹¿å‘Šå…¶ä»–å‘表安全第一会员进行点击版æƒç”µå­ä¸–界设计å…费教育加入活动他们商å“åšå®¢çŽ°åœ¨ä¸Šæµ·å¦‚何已ç»ç•™è¨€è¯¦ç»†ç¤¾åŒºç™»å½•æœ¬ç«™éœ€è¦ä»·æ ¼æ”¯æŒå›½é™…链接国家建设朋å‹é˜…读法律ä½ç½®ç»æµŽé€‰æ‹©è¿™æ ·å½“å‰åˆ†ç±»æŽ’行因为交易最åŽéŸ³ä¹ä¸èƒ½é€šè¿‡è¡Œä¸šç§‘技å¯èƒ½è®¾å¤‡åˆä½œå¤§å®¶ç¤¾ä¼šç ”究专业全部项目这里还是开始情况电脑文件å“牌帮助文化资æºå¤§å­¦å­¦ä¹ åœ°å€æµè§ˆæŠ•èµ„工程è¦æ±‚怎么时候功能主è¦ç›®å‰èµ„讯城市方法电影招è˜å£°æ˜Žä»»ä½•å¥åº·æ•°æ®ç¾Žå›½æ±½è½¦ä»‹ç»ä½†æ˜¯äº¤æµç”Ÿäº§æ‰€ä»¥ç”µè¯æ˜¾ç¤ºä¸€äº›å•ä½äººå‘˜åˆ†æžåœ°å›¾æ—…游工具学生系列网å‹å¸–å­å¯†ç é¢‘é“控制地区基本全国网上é‡è¦ç¬¬äºŒå–œæ¬¢è¿›å…¥å‹æƒ…这些考试å‘现培训以上政府æˆä¸ºçŽ¯å¢ƒé¦™æ¸¯åŒæ—¶å¨±ä¹å‘é€ä¸€å®šå¼€å‘作å“标准欢迎解决地方一下以åŠè´£ä»»æˆ–者客户代表积分女人数ç é”€å”®å‡ºçŽ°ç¦»çº¿åº”用列表ä¸åŒç¼–辑统计查询ä¸è¦æœ‰å…³æœºæž„很多播放组织政策直接能力æ¥æºæ™‚間看到热门关键专区éžå¸¸è‹±è¯­ç™¾åº¦å¸Œæœ›ç¾Žå¥³æ¯”较知识规定建议部门æ„è§ç²¾å½©æ—¥æœ¬æ高å‘言方é¢åŸºé‡‘处ç†æƒé™å½±ç‰‡é“¶è¡Œè¿˜æœ‰åˆ†äº«ç‰©å“ç»è¥æ·»åŠ ä¸“家这ç§è¯é¢˜èµ·æ¥ä¸šåŠ¡å…¬å‘Šè®°å½•ç®€ä»‹è´¨é‡ç”·äººå½±å“引用报告部分快速咨询时尚注æ„申请学校应该历å²åªæ˜¯è¿”回购买å称为了æˆåŠŸè¯´æ˜Žä¾›åº”å­©å­ä¸“题程åºä¸€èˆ¬æœƒå“¡åªæœ‰å…¶å®ƒä¿æŠ¤è€Œä¸”今天窗å£åŠ¨æ€çŠ¶æ€ç‰¹åˆ«è®¤ä¸ºå¿…须更新å°è¯´æˆ‘們作为媒体包括那么一样国内是å¦æ ¹æ®ç”µè§†å­¦é™¢å…·æœ‰è¿‡ç¨‹ç”±äºŽäººæ‰å‡ºæ¥ä¸è¿‡æ­£åœ¨æ˜Žæ˜Ÿæ•…事关系标题商务输入一直基础教学了解建筑结果全çƒé€šçŸ¥è®¡åˆ’对于艺术相册å‘生真的建立等级类型ç»éªŒå®žçŽ°åˆ¶ä½œæ¥è‡ªæ ‡ç­¾ä»¥ä¸‹åŽŸåˆ›æ— æ³•å…¶ä¸­å€‹äººä¸€åˆ‡æŒ‡å—关闭集团第三关注因此照片深圳商业广州日期高级最近综åˆè¡¨ç¤ºä¸“辑行为交通评价觉得精åŽå®¶åº­å®Œæˆæ„Ÿè§‰å®‰è£…得到邮件制度食å“虽然转载报价记者方案行政人民用å“东西æ出酒店然åŽä»˜æ¬¾çƒ­ç‚¹ä»¥å‰å®Œå…¨å‘帖设置领导工业医院看看ç»å…¸åŽŸå› å¹³å°å„ç§å¢žåŠ æ料新增之åŽèŒä¸šæ•ˆæžœä»Šå¹´è®ºæ–‡æˆ‘国告诉版主修改å‚与打å°å¿«ä¹æœºæ¢°è§‚点存在精神获得利用继续你们这么模å¼è¯­è¨€èƒ½å¤Ÿé›…虎æ“作风格一起科学体育短信æ¡ä»¶æ²»ç–—è¿åŠ¨äº§ä¸šä¼šè®®å¯¼èˆªå…ˆç”Ÿè”盟å¯æ˜¯å•é¡Œç»“构作用调查資料自动负责农业访问实施接å—讨论那个å馈加强女性范围æœå‹™ä¼‘闲今日客æœè§€çœ‹å‚加的è¯ä¸€ç‚¹ä¿è¯å›¾ä¹¦æœ‰æ•ˆæµ‹è¯•ç§»åŠ¨æ‰èƒ½å†³å®šè‚¡ç¥¨ä¸æ–­éœ€æ±‚ä¸å¾—办法之间采用è¥é”€æŠ•è¯‰ç›®æ ‡çˆ±æƒ…摄影有些複製文学机会数字装修购物农æ‘å…¨é¢ç²¾å“其实事情水平æ示上市谢谢普通教师上传类别歌曲拥有创新é…件åªè¦æ—¶ä»£è³‡è¨Šè¾¾åˆ°äººç”Ÿè®¢é˜…è€å¸ˆå±•ç¤ºå¿ƒç†è´´å­ç¶²ç«™ä¸»é¡Œè‡ªç„¶çº§åˆ«ç®€å•æ”¹é©é‚£äº›æ¥è¯´æ‰“开代ç åˆ é™¤è¯åˆ¸èŠ‚ç›®é‡ç‚¹æ¬¡æ•¸å¤šå°‘规划资金找到以åŽå¤§å…¨ä¸»é¡µæœ€ä½³å›žç­”天下ä¿éšœçŽ°ä»£æ£€æŸ¥æŠ•ç¥¨å°æ—¶æ²’有正常甚至代ç†ç›®å½•å…¬å¼€å¤åˆ¶é‡‘èžå¹¸ç¦ç‰ˆæœ¬å½¢æˆå‡†å¤‡è¡Œæƒ…回到æ€æƒ³æ€Žæ ·å议认è¯æœ€å¥½äº§ç”ŸæŒ‰ç…§æœè£…广东动漫采购新手组图é¢æ¿å‚考政治容易天地努力人们å‡çº§é€Ÿåº¦äººç‰©è°ƒæ•´æµè¡Œé€ æˆæ–‡å­—韩国贸易开展相關表现影视如此美容大å°æŠ¥é“æ¡æ¬¾å¿ƒæƒ…许多法规家居书店连接立å³ä¸¾æŠ¥æŠ€å·§å¥¥è¿ç™»å…¥ä»¥æ¥ç†è®ºäº‹ä»¶è‡ªç”±ä¸­åŽåŠžå…¬å¦ˆå¦ˆçœŸæ­£ä¸é”™å…¨æ–‡åˆåŒä»·å€¼åˆ«äººç›‘ç£å…·ä½“世纪团队创业承担增长有人ä¿æŒå•†å®¶ç»´ä¿®å°æ¹¾å·¦å³è‚¡ä»½ç­”案实际电信ç»ç†ç”Ÿå‘½å®£ä¼ ä»»åŠ¡æ­£å¼ç‰¹è‰²ä¸‹æ¥å会åªèƒ½å½“然é‡æ–°å…§å®¹æŒ‡å¯¼è¿è¡Œæ—¥å¿—賣家超过土地浙江支付推出站长æ­å·žæ‰§è¡Œåˆ¶é€ ä¹‹ä¸€æŽ¨å¹¿çŽ°åœºæè¿°å˜åŒ–传统歌手ä¿é™©è¯¾ç¨‹åŒ»ç–—ç»è¿‡è¿‡åŽ»ä¹‹å‰æ”¶å…¥å¹´åº¦æ‚志美丽最高登陆未æ¥åŠ å·¥å…责教程版å—身体é‡åº†å‡ºå”®æˆæœ¬å½¢å¼åœŸè±†å‡ºåƒ¹ä¸œæ–¹é‚®ç®±å—京求èŒå–å¾—èŒä½ç›¸ä¿¡é¡µé¢åˆ†é’Ÿç½‘页确定图例网å€ç§¯æžé”™è¯¯ç›®çš„å®è´æœºå…³é£Žé™©æŽˆæƒç—…毒宠物除了評論疾病åŠæ—¶æ±‚购站点儿童æ¯å¤©ä¸­å¤®è®¤è¯†æ¯ä¸ªå¤©æ´¥å­—体å°ç£ç»´æŠ¤æœ¬é¡µä¸ªæ€§å®˜æ–¹å¸¸è§ç›¸æœºæˆ˜ç•¥åº”当律师方便校园股市房屋æ ç›®å‘˜å·¥å¯¼è‡´çªç„¶é“具本网结åˆæ¡£æ¡ˆåŠ³åŠ¨å¦å¤–美元引起改å˜ç¬¬å››ä¼šè®¡èªªæ˜Žéšç§å®å®è§„范消费共åŒå¿˜è®°ä½“系带æ¥å字發表开放加盟å—到二手大é‡æˆäººæ•°é‡å…±äº«åŒºåŸŸå¥³å­©åŽŸåˆ™æ‰€åœ¨ç»“æŸé€šä¿¡è¶…级é…置当时优秀性感房产éŠæˆ²å‡ºå£æ交就业ä¿å¥ç¨‹åº¦å‚数事业整个山东情感特殊分類æœå°‹å±žäºŽé—¨æˆ·è´¢åŠ¡å£°éŸ³åŠå…¶è´¢ç»åšæŒå¹²éƒ¨æˆç«‹åˆ©ç›Šè€ƒè™‘æˆéƒ½åŒ…装用戶比赛文明招商完整真是眼ç›ä¼™ä¼´å¨æœ›é¢†åŸŸå«ç”Ÿä¼˜æƒ è«–壇公共良好充分符åˆé™„件特点ä¸å¯è‹±æ–‡èµ„产根本明显密碼公众民æ—更加享å—åŒå­¦å¯åŠ¨é€‚åˆåŽŸæ¥é—®ç­”本文美食绿色稳定终于生物供求æœç‹åŠ›é‡ä¸¥é‡æ°¸è¿œå†™çœŸæœ‰é™ç«žäº‰å¯¹è±¡è´¹ç”¨ä¸å¥½ç»å¯¹å分促进点评影音优势ä¸å°‘欣èµå¹¶ä¸”有点方å‘全新信用设施形象资格çªç ´éšç€é‡å¤§äºŽæ˜¯æ¯•ä¸šæ™ºèƒ½åŒ–工完美商城统一出版打造產å“概况用于ä¿ç•™å› ç´ ä¸­åœ‹å­˜å‚¨è´´å›¾æœ€æ„›é•¿æœŸå£ä»·ç†è´¢åŸºåœ°å®‰æŽ’武汉里é¢åˆ›å»ºå¤©ç©ºé¦–先完善驱动下é¢ä¸å†è¯šä¿¡æ„义阳光英国漂亮军事玩家群众农民å³å¯å稱家具动画想到注明å°å­¦æ€§èƒ½è€ƒç ”硬件观看清楚æžç¬‘首é é»„金适用江è‹çœŸå®žä¸»ç®¡é˜¶æ®µè¨»å†Šç¿»è¯‘æƒåˆ©åšå¥½ä¼¼ä¹Žé€šè®¯æ–½å·¥ç‹€æ…‹ä¹Ÿè®¸çŽ¯ä¿åŸ¹å…»æ¦‚念大型机票ç†è§£åŒ¿åcuandoenviarmadridbuscariniciotiempoporquecuentaestadopuedenjuegoscontraestánnombretienenperfilmaneraamigosciudadcentroaunquepuedesdentroprimerpreciosegúnbuenosvolverpuntossemanahabíaagostonuevosunidoscarlosequiponiñosmuchosalgunacorreoimagenpartirarribamaríahombreempleoverdadcambiomuchasfueronpasadolíneaparecenuevascursosestabaquierolibroscuantoaccesomiguelvarioscuatrotienesgruposseráneuropamediosfrenteacercademásofertacochesmodeloitalialetrasalgúncompracualesexistecuerposiendoprensallegarviajesdineromurciapodrápuestodiariopuebloquieremanuelpropiocrisisciertoseguromuertefuentecerrargrandeefectopartesmedidapropiaofrecetierrae-mailvariasformasfuturoobjetoseguirriesgonormasmismosúnicocaminositiosrazóndebidopruebatoledoteníajesúsesperococinaorigentiendacientocádizhablarseríalatinafuerzaestiloguerraentraréxitolópezagendavídeoevitarpaginametrosjavierpadresfácilcabezaáreassalidaenvíojapónabusosbienestextosllevarpuedanfuertecomúnclaseshumanotenidobilbaounidadestáseditarcreadoдлÑчтокакилиÑтовÑеегопритакещеужеКакбезбылониВÑеподЭтотомчемнетлетразонагдемнеДлÑПринаÑнихтемктогодвоттамСШÐмаÑЧтоваÑвамемуТакдванамÑтиÑтуВамтехпротутнадднÑВоттринейВаÑнимÑамтотрубОнимирнееОООлицÑтаОнанемдоммойдвеоноÑудकेहैकीसेकाकोऔरपरनेà¤à¤•à¤•à¤¿à¤­à¥€à¤‡à¤¸à¤•à¤°à¤¤à¥‹à¤¹à¥‹à¤†à¤ªà¤¹à¥€à¤¯à¤¹à¤¯à¤¾à¤¤à¤•à¤¥à¤¾jagranआजजोअबदोगईजागà¤à¤¹à¤®à¤‡à¤¨à¤µà¤¹à¤¯à¥‡à¤¥à¥‡à¤¥à¥€à¤˜à¤°à¤œà¤¬à¤¦à¥€à¤•à¤ˆà¤œà¥€à¤µà¥‡à¤¨à¤ˆà¤¨à¤à¤¹à¤°à¤‰à¤¸à¤®à¥‡à¤•à¤®à¤µà¥‹à¤²à¥‡à¤¸à¤¬à¤®à¤ˆà¤¦à¥‡à¤“रआमबसभरबनचलमनआगसीलीعلىإلىهذاآخرعددالىهذهصورغيركانولابينعرضذلكهنايومقالعليانالكنحتىقبلوحةاخرÙقطعبدركنإذاكمااحدإلاÙيهبعضكيÙبحثومنوهوأناجدالهاسلمعندليسعبرصلىمنذبهاأنهمثلكنتالاحيثمصرشرححولوÙياذالكلمرةانتالÙأبوخاصأنتانهاليعضووقدابنخيربنتلكمشاءوهيابوقصصومارقمأحدنحنعدمرأياحةكتبدونيجبمنهتحتجهةسنةيتمكرةغزةنÙسبيتللهلناتلكقلبلماعنهأولشيءنورأماÙيكبكلذاترتببأنهمسانكبيعÙقدحسنلهمشعرأهلشهرقطرطلبprofileservicedefaulthimselfdetailscontentsupportstartedmessagesuccessfashion<title>countryaccountcreatedstoriesresultsrunningprocesswritingobjectsvisiblewelcomearticleunknownnetworkcompanydynamicbrowserprivacyproblemServicerespectdisplayrequestreservewebsitehistoryfriendsoptionsworkingversionmillionchannelwindow.addressvisitedweathercorrectproductedirectforwardyou canremovedsubjectcontrolarchivecurrentreadinglibrarylimitedmanagerfurthersummarymachineminutesprivatecontextprogramsocietynumberswrittenenabledtriggersourcesloadingelementpartnerfinallyperfectmeaningsystemskeepingculture&quot;,journalprojectsurfaces&quot;expiresreviewsbalanceEnglishContentthroughPlease opinioncontactaverageprimaryvillageSpanishgallerydeclinemeetingmissionpopularqualitymeasuregeneralspeciessessionsectionwriterscounterinitialreportsfiguresmembersholdingdisputeearlierexpressdigitalpictureAnothermarriedtrafficleadingchangedcentralvictoryimages/reasonsstudiesfeaturelistingmust beschoolsVersionusuallyepisodeplayinggrowingobviousoverlaypresentactions</ul>
+wrapperalreadycertainrealitystorageanotherdesktopofferedpatternunusualDigitalcapitalWebsitefailureconnectreducedAndroiddecadesregular &amp; animalsreleaseAutomatgettingmethodsnothingPopularcaptionletterscapturesciencelicensechangesEngland=1&amp;History = new CentralupdatedSpecialNetworkrequirecommentwarningCollegetoolbarremainsbecauseelectedDeutschfinanceworkersquicklybetweenexactlysettingdiseaseSocietyweaponsexhibit&lt;!--Controlclassescoveredoutlineattacksdevices(windowpurposetitle="Mobile killingshowingItaliandroppedheavilyeffects-1']);
+confirmCurrentadvancesharingopeningdrawingbillionorderedGermanyrelated</form>includewhetherdefinedSciencecatalogArticlebuttonslargestuniformjourneysidebarChicagoholidayGeneralpassage,&quot;animatefeelingarrivedpassingnaturalroughly.
+
+The but notdensityBritainChineselack oftributeIreland" data-factorsreceivethat isLibraryhusbandin factaffairsCharlesradicalbroughtfindinglanding:lang="return leadersplannedpremiumpackageAmericaEdition]&quot;Messageneed tovalue="complexlookingstationbelievesmaller-mobilerecordswant tokind ofFirefoxyou aresimilarstudiedmaximumheadingrapidlyclimatekingdomemergedamountsfoundedpioneerformuladynastyhow to SupportrevenueeconomyResultsbrothersoldierlargelycalling.&quot;AccountEdward segmentRobert effortsPacificlearnedup withheight:we haveAngelesnations_searchappliedacquiremassivegranted: falsetreatedbiggestbenefitdrivingStudiesminimumperhapsmorningsellingis usedreversevariant role="missingachievepromotestudentsomeoneextremerestorebottom:evolvedall thesitemapenglishway to AugustsymbolsCompanymattersmusicalagainstserving})();
+paymenttroubleconceptcompareparentsplayersregionsmonitor ''The winningexploreadaptedGalleryproduceabilityenhancecareers). The collectSearch ancientexistedfooter handlerprintedconsoleEasternexportswindowsChannelillegalneutralsuggest_headersigning.html">settledwesterncausing-webkitclaimedJusticechaptervictimsThomas mozillapromisepartieseditionoutside:false,hundredOlympic_buttonauthorsreachedchronicdemandssecondsprotectadoptedprepareneithergreatlygreateroverallimprovecommandspecialsearch.worshipfundingthoughthighestinsteadutilityquarterCulturetestingclearlyexposedBrowserliberal} catchProjectexamplehide();FloridaanswersallowedEmperordefenseseriousfreedomSeveral-buttonFurtherout of != nulltrainedDenmarkvoid(0)/all.jspreventRequestStephen
+
+When observe</h2>
+Modern provide" alt="borders.
+
+For
+
+Many artistspoweredperformfictiontype ofmedicalticketsopposedCouncilwitnessjusticeGeorge Belgium...</a>twitternotablywaitingwarfare Other rankingphrasesmentionsurvivescholar</p>
+ Countryignoredloss ofjust asGeorgiastrange<head><stopped1']);
+islandsnotableborder:list ofcarried100,000</h3>
+ severalbecomesselect wedding00.htmlmonarchoff theteacherhighly biologylife ofor evenrise of&raquo;plusonehunting(thoughDouglasjoiningcirclesFor theAncientVietnamvehiclesuch ascrystalvalue =Windowsenjoyeda smallassumed<a id="foreign All rihow theDisplayretiredhoweverhidden;battlesseekingcabinetwas notlook atconductget theJanuaryhappensturninga:hoverOnline French lackingtypicalextractenemieseven ifgeneratdecidedare not/searchbeliefs-image:locatedstatic.login">convertviolententeredfirst">circuitFinlandchemistshe was10px;">as suchdivided</span>will beline ofa greatmystery/index.fallingdue to railwaycollegemonsterdescentit withnuclearJewish protestBritishflowerspredictreformsbutton who waslectureinstantsuicidegenericperiodsmarketsSocial fishingcombinegraphicwinners<br /><by the NaturalPrivacycookiesoutcomeresolveSwedishbrieflyPersianso muchCenturydepictscolumnshousingscriptsnext tobearingmappingrevisedjQuery(-width:title">tooltipSectiondesignsTurkishyounger.match(})();
+
+burningoperatedegreessource=Richardcloselyplasticentries</tr>
+color:#ul id="possessrollingphysicsfailingexecutecontestlink toDefault<br />
+: true,chartertourismclassicproceedexplain</h1>
+online.?xml vehelpingdiamonduse theairlineend -->).attr(readershosting#ffffffrealizeVincentsignals src="/ProductdespitediversetellingPublic held inJoseph theatreaffects<style>a largedoesn'tlater, ElementfaviconcreatorHungaryAirportsee theso thatMichaelSystemsPrograms, and width=e&quot;tradingleft">
+personsGolden Affairsgrammarformingdestroyidea ofcase ofoldest this is.src = cartoonregistrCommonsMuslimsWhat isin manymarkingrevealsIndeed,equally/show_aoutdoorescape(Austriageneticsystem,In the sittingHe alsoIslandsAcademy
+ <!--Daniel bindingblock">imposedutilizeAbraham(except{width:putting).html(|| [];
+DATA[ *kitchenmountedactual dialectmainly _blank'installexpertsif(typeIt also&copy; ">Termsborn inOptionseasterntalkingconcerngained ongoingjustifycriticsfactoryits ownassaultinvitedlastinghis ownhref="/" rel="developconcertdiagramdollarsclusterphp?id=alcohol);})();using a><span>vesselsrevivalAddressamateurandroidallegedillnesswalkingcentersqualifymatchesunifiedextinctDefensedied in
+ <!-- customslinkingLittle Book ofeveningmin.js?are thekontakttoday's.html" target=wearingAll Rig;
+})();raising Also, crucialabout">declare-->
+<scfirefoxas muchappliesindex, s, but type =
+
+<!--towardsRecordsPrivateForeignPremierchoicesVirtualreturnsCommentPoweredinline;povertychamberLiving volumesAnthonylogin" RelatedEconomyreachescuttinggravitylife inChapter-shadowNotable</td>
+ returnstadiumwidgetsvaryingtravelsheld bywho arework infacultyangularwho hadairporttown of
+
+Some 'click'chargeskeywordit willcity of(this);Andrew unique checkedor more300px; return;rsion="pluginswithin herselfStationFederalventurepublishsent totensionactresscome tofingersDuke ofpeople,exploitwhat isharmonya major":"httpin his menu">
+monthlyofficercouncilgainingeven inSummarydate ofloyaltyfitnessand wasemperorsupremeSecond hearingRussianlongestAlbertalateralset of small">.appenddo withfederalbank ofbeneathDespiteCapitalgrounds), and percentit fromclosingcontainInsteadfifteenas well.yahoo.respondfighterobscurereflectorganic= Math.editingonline paddinga wholeonerroryear ofend of barrierwhen itheader home ofresumedrenamedstrong>heatingretainscloudfrway of March 1knowingin partBetweenlessonsclosestvirtuallinks">crossedEND -->famous awardedLicenseHealth fairly wealthyminimalAfricancompetelabel">singingfarmersBrasil)discussreplaceGregoryfont copursuedappearsmake uproundedboth ofblockedsaw theofficescoloursif(docuwhen heenforcepush(fuAugust UTF-8">Fantasyin mostinjuredUsuallyfarmingclosureobject defenceuse of Medical<body>
+evidentbe usedkeyCodesixteenIslamic#000000entire widely active (typeofone cancolor =speakerextendsPhysicsterrain<tbody>funeralviewingmiddle cricketprophetshifteddoctorsRussell targetcompactalgebrasocial-bulk ofman and</td>
+ he left).val()false);logicalbankinghome tonaming Arizonacredits);
+});
+founderin turnCollinsbefore But thechargedTitle">CaptainspelledgoddessTag -->Adding:but wasRecent patientback in=false&Lincolnwe knowCounterJudaismscript altered']);
+ has theunclearEvent',both innot all
+
+<!-- placinghard to centersort ofclientsstreetsBernardassertstend tofantasydown inharbourFreedomjewelry/about..searchlegendsis mademodern only ononly toimage" linear painterand notrarely acronymdelivershorter00&amp;as manywidth="/* <![Ctitle =of the lowest picked escapeduses ofpeoples PublicMatthewtacticsdamagedway forlaws ofeasy to windowstrong simple}catch(seventhinfoboxwent topaintedcitizenI don'tretreat. Some ww.");
+bombingmailto:made in. Many carries||{};wiwork ofsynonymdefeatsfavoredopticalpageTraunless sendingleft"><comScorAll thejQuery.touristClassicfalse" Wilhelmsuburbsgenuinebishops.split(global followsbody ofnominalContactsecularleft tochiefly-hidden-banner</li>
+
+. When in bothdismissExplorealways via thespañolwelfareruling arrangecaptainhis sonrule ofhe tookitself,=0&amp;(calledsamplesto makecom/pagMartin Kennedyacceptsfull ofhandledBesides//--></able totargetsessencehim to its by common.mineralto takeways tos.org/ladvisedpenaltysimple:if theyLettersa shortHerbertstrikes groups.lengthflightsoverlapslowly lesser social </p>
+ it intoranked rate oful>
+ attemptpair ofmake itKontaktAntoniohaving ratings activestreamstrapped").css(hostilelead tolittle groups,Picture-->
+
+ rows=" objectinverse<footerCustomV><\/scrsolvingChamberslaverywoundedwhereas!= 'undfor allpartly -right:Arabianbacked centuryunit ofmobile-Europe,is homerisk ofdesiredClintoncost ofage of become none ofp&quot;Middle ead')[0Criticsstudios>&copy;group">assemblmaking pressedwidget.ps:" ? rebuiltby someFormer editorsdelayedCanonichad thepushingclass="but arepartialBabylonbottom carrierCommandits useAs withcoursesa thirddenotesalso inHouston20px;">accuseddouble goal ofFamous ).bind(priests Onlinein Julyst + "gconsultdecimalhelpfulrevivedis veryr'+'iptlosing femalesis alsostringsdays ofarrivalfuture <objectforcingString(" />
+ here isencoded. The balloondone by/commonbgcolorlaw of Indianaavoidedbut the2px 3pxjquery.after apolicy.men andfooter-= true;for usescreen.Indian image =family,http:// &nbsp;driverseternalsame asnoticedviewers})();
+ is moreseasonsformer the newis justconsent Searchwas thewhy theshippedbr><br>width: height=made ofcuisineis thata very Admiral fixed;normal MissionPress, ontariocharsettry to invaded="true"spacingis mosta more totallyfall of});
+ immensetime inset outsatisfyto finddown tolot of Playersin Junequantumnot thetime todistantFinnishsrc = (single help ofGerman law andlabeledforestscookingspace">header-well asStanleybridges/globalCroatia About [0];
+ it, andgroupedbeing a){throwhe madelighterethicalFFFFFF"bottom"like a employslive inas seenprintermost ofub-linkrejectsand useimage">succeedfeedingNuclearinformato helpWomen'sNeitherMexicanprotein<table by manyhealthylawsuitdevised.push({sellerssimply Through.cookie Image(older">us.js"> Since universlarger open to!-- endlies in']);
+ marketwho is ("DOMComanagedone fortypeof Kingdomprofitsproposeto showcenter;made itdressedwere inmixtureprecisearisingsrc = 'make a securedBaptistvoting
+ var March 2grew upClimate.removeskilledway the</head>face ofacting right">to workreduceshas haderectedshow();action=book ofan area== "htt<header
+<html>conformfacing cookie.rely onhosted .customhe wentbut forspread Family a meansout theforums.footage">MobilClements" id="as highintense--><!--female is seenimpliedset thea stateand hisfastestbesidesbutton_bounded"><img Infoboxevents,a youngand areNative cheaperTimeoutand hasengineswon the(mostlyright: find a -bottomPrince area ofmore ofsearch_nature,legallyperiod,land ofor withinducedprovingmissilelocallyAgainstthe wayk&quot;px;">
+pushed abandonnumeralCertainIn thismore inor somename isand, incrownedISBN 0-createsOctobermay notcenter late inDefenceenactedwish tobroadlycoolingonload=it. TherecoverMembersheight assumes<html>
+people.in one =windowfooter_a good reklamaothers,to this_cookiepanel">London,definescrushedbaptismcoastalstatus title" move tolost inbetter impliesrivalryservers SystemPerhapses and contendflowinglasted rise inGenesisview ofrising seem tobut in backinghe willgiven agiving cities.flow of Later all butHighwayonly bysign ofhe doesdiffersbattery&amp;lasinglesthreatsintegertake onrefusedcalled =US&ampSee thenativesby thissystem.head of:hover,lesbiansurnameand allcommon/header__paramsHarvard/pixel.removalso longrole ofjointlyskyscraUnicodebr />
+AtlantanucleusCounty,purely count">easily build aonclicka givenpointerh&quot;events else {
+ditionsnow the, with man whoorg/Webone andcavalryHe diedseattle00,000 {windowhave toif(windand itssolely m&quot;renewedDetroitamongsteither them inSenatorUs</a><King ofFrancis-produche usedart andhim andused byscoringat hometo haverelatesibilityfactionBuffalolink"><what hefree toCity ofcome insectorscountedone daynervoussquare };if(goin whatimg" alis onlysearch/tuesdaylooselySolomonsexual - <a hrmedium"DO NOT France,with a war andsecond take a >
+
+
+market.highwaydone inctivity"last">obligedrise to"undefimade to Early praisedin its for hisathleteJupiterYahoo! termed so manyreally s. The a woman?value=direct right" bicycleacing="day andstatingRather,higher Office are nowtimes, when a pay foron this-link">;borderaround annual the Newput the.com" takin toa brief(in thegroups.; widthenzymessimple in late{returntherapya pointbanninginks">
+();" rea place\u003Caabout atr>
+ ccount gives a<SCRIPTRailwaythemes/toolboxById("xhumans,watchesin some if (wicoming formats Under but hashanded made bythan infear ofdenoted/iframeleft involtagein eacha&quot;base ofIn manyundergoregimesaction </p>
+<ustomVa;&gt;</importsor thatmostly &amp;re size="</a></ha classpassiveHost = WhetherfertileVarious=[];(fucameras/></td>acts asIn some>
+
+<!organis <br />Beijingcatalàdeutscheuropeueuskaragaeilgesvenskaespañamensajeusuariotrabajoméxicopáginasiempresistemaoctubreduranteañadirempresamomentonuestroprimeratravésgraciasnuestraprocesoestadoscalidadpersonanúmeroacuerdomúsicamiembroofertasalgunospaísesejemploderechoademásprivadoagregarenlacesposiblehotelessevillaprimeroúltimoeventosarchivoculturamujeresentradaanuncioembargomercadograndesestudiomejoresfebrerodiseñoturismocódigoportadaespaciofamiliaantoniopermiteguardaralgunaspreciosalguiensentidovisitastítuloconocersegundoconsejofranciaminutossegundatenemosefectosmálagasesiónrevistagranadacompraringresogarcíaacciónecuadorquienesinclusodeberámateriahombresmuestrapodríamañanaúltimaestamosoficialtambienningúnsaludospodemosmejorarpositionbusinesshomepagesecuritylanguagestandardcampaignfeaturescategoryexternalchildrenreservedresearchexchangefavoritetemplatemilitaryindustryservicesmaterialproductsz-index:commentssoftwarecompletecalendarplatformarticlesrequiredmovementquestionbuildingpoliticspossiblereligionphysicalfeedbackregisterpicturesdisabledprotocolaudiencesettingsactivityelementslearninganythingabstractprogressoverviewmagazineeconomictrainingpressurevarious <strong>propertyshoppingtogetheradvancedbehaviordownloadfeaturedfootballselectedLanguagedistanceremembertrackingpasswordmodifiedstudentsdirectlyfightingnortherndatabasefestivalbreakinglocationinternetdropdownpracticeevidencefunctionmarriageresponseproblemsnegativeprogramsanalysisreleasedbanner">purchasepoliciesregionalcreativeargumentbookmarkreferrerchemicaldivisioncallbackseparateprojectsconflicthardwareinterestdeliverymountainobtained= false;for(var acceptedcapacitycomputeridentityaircraftemployedproposeddomesticincludesprovidedhospitalverticalcollapseapproachpartnerslogo"><adaughterauthor" culturalfamilies/images/assemblypowerfulteachingfinisheddistrictcriticalcgi-bin/purposesrequireselectionbecomingprovidesacademicexerciseactuallymedicineconstantaccidentMagazinedocumentstartingbottom">observed: &quot;extendedpreviousSoftwarecustomerdecisionstrengthdetailedslightlyplanningtextareacurrencyeveryonestraighttransferpositiveproducedheritageshippingabsolutereceivedrelevantbutton" violenceanywherebenefitslaunchedrecentlyalliancefollowedmultiplebulletinincludedoccurredinternal$(this).republic><tr><tdcongressrecordedultimatesolution<ul id="discoverHome</a>websitesnetworksalthoughentirelymemorialmessagescontinueactive">somewhatvictoriaWestern title="LocationcontractvisitorsDownloadwithout right">
+measureswidth = variableinvolvedvirginianormallyhappenedaccountsstandingnationalRegisterpreparedcontrolsaccuratebirthdaystrategyofficialgraphicscriminalpossiblyconsumerPersonalspeakingvalidateachieved.jpg" />machines</h2>
+ keywordsfriendlybrotherscombinedoriginalcomposedexpectedadequatepakistanfollow" valuable</label>relativebringingincreasegovernorplugins/List of Header">" name=" (&quot;graduate</head>
+commercemalaysiadirectormaintain;height:schedulechangingback to catholicpatternscolor: #greatestsuppliesreliable</ul>
+ <select citizensclothingwatching<li id="specificcarryingsentence<center>contrastthinkingcatch(e)southernMichael merchantcarouselpadding:interior.split("lizationOctober ){returnimproved--&gt;
+
+coveragechairman.png" />subjectsRichard whateverprobablyrecoverybaseballjudgmentconnect..css" /> websitereporteddefault"/></a>
+electricscotlandcreationquantity. ISBN 0did not instance-search-" lang="speakersComputercontainsarchivesministerreactiondiscountItalianocriteriastrongly: 'http:'script'coveringofferingappearedBritish identifyFacebooknumerousvehiclesconcernsAmericanhandlingdiv id="William provider_contentaccuracysection andersonflexibleCategorylawrence<script>layout="approved maximumheader"></table>Serviceshamiltoncurrent canadianchannels/themes//articleoptionalportugalvalue=""intervalwirelessentitledagenciesSearch" measuredthousandspending&hellip;new Date" size="pageNamemiddle" " /></a>hidden">sequencepersonaloverflowopinionsillinoislinks">
+ <title>versionssaturdayterminalitempropengineersectionsdesignerproposal="false"Españolreleasessubmit" er&quot;additionsymptomsorientedresourceright"><pleasurestationshistory.leaving border=contentscenter">.
+
+Some directedsuitablebulgaria.show();designedGeneral conceptsExampleswilliamsOriginal"><span>search">operatorrequestsa &quot;allowingDocumentrevision.
+
+The yourselfContact michiganEnglish columbiapriorityprintingdrinkingfacilityreturnedContent officersRussian generate-8859-1"indicatefamiliar qualitymargin:0 contentviewportcontacts-title">portable.length eligibleinvolvesatlanticonload="default.suppliedpaymentsglossary
+
+After guidance</td><tdencodingmiddle">came to displaysscottishjonathanmajoritywidgets.clinicalthailandteachers<head>
+ affectedsupportspointer;toString</small>oklahomawill be investor0" alt="holidaysResourcelicensed (which . After considervisitingexplorerprimary search" android"quickly meetingsestimate;return ;color:# height=approval, &quot; checked.min.js"magnetic></a></hforecast. While thursdaydvertise&eacute;hasClassevaluateorderingexistingpatients Online coloradoOptions"campbell<!-- end</span><<br />
+_popups|sciences,&quot; quality Windows assignedheight: <b classle&quot; value=" Companyexamples<iframe believespresentsmarshallpart of properly).
+
+The taxonomymuch of </span>
+" data-srtuguêsscrollTo project<head>
+attorneyemphasissponsorsfancyboxworld's wildlifechecked=sessionsprogrammpx;font- Projectjournalsbelievedvacationthompsonlightingand the special border=0checking</tbody><button Completeclearfix
+<head>
+article <sectionfindingsrole in popular Octoberwebsite exposureused to changesoperatedclickingenteringcommandsinformed numbers </div>creatingonSubmitmarylandcollegesanalyticlistingscontact.loggedInadvisorysiblingscontent"s&quot;)s. This packagescheckboxsuggestspregnanttomorrowspacing=icon.pngjapanesecodebasebutton">gamblingsuch as , while </span> missourisportingtop:1px .</span>tensionswidth="2lazyloadnovemberused in height="cript">
+&nbsp;</<tr><td height:2/productcountry include footer" &lt;!-- title"></jquery.</form>
+(简体)(ç¹é«”)hrvatskiitalianoromânătürkçeاردوtambiénnoticiasmensajespersonasderechosnacionalserviciocontactousuariosprogramagobiernoempresasanunciosvalenciacolombiadespuésdeportesproyectoproductopúbliconosotroshistoriapresentemillonesmediantepreguntaanteriorrecursosproblemasantiagonuestrosopiniónimprimirmientrasaméricavendedorsociedadrespectorealizarregistropalabrasinterésentoncesespecialmiembrosrealidadcórdobazaragozapáginassocialesbloqueargestiónalquilersistemascienciascompletoversióncompletaestudiospúblicaobjetivoalicantebuscadorcantidadentradasaccionesarchivossuperiormayoríaalemaniafunciónúltimoshaciendoaquellosediciónfernandoambientefacebooknuestrasclientesprocesosbastantepresentareportarcongresopublicarcomerciocontratojóvenesdistritotécnicaconjuntoenergíatrabajarasturiasrecienteutilizarboletínsalvadorcorrectatrabajosprimerosnegocioslibertaddetallespantallapróximoalmeríaanimalesquiénescorazónsecciónbuscandoopcionesexteriorconceptotodavíagaleríaescribirmedicinalicenciaconsultaaspectoscríticadólaresjusticiadeberánperíodonecesitamantenerpequeñorecibidatribunaltenerifecancióncanariasdescargadiversosmallorcarequieretécnicodeberíaviviendafinanzasadelantefuncionaconsejosdifícilciudadesantiguasavanzadatérminounidadessánchezcampañasoftonicrevistascontienesectoresmomentosfacultadcréditodiversassupuestofactoressegundospequeñaгодаеÑлиеÑтьбылобытьÑтомЕÑлитогоменÑвÑехÑтойдажебылигодуденьÑтотбылаÑебÑодинÑебенадоÑайтфотонегоÑвоиÑвойигрытожевÑемÑвоюлишьÑтихпокаднейдомамиралиботемухотÑдвухÑетилюдиделомиретебÑÑвоевидечегоÑтимÑчеттемыценыÑталведьтемеводытебевышенамитипатомуправлицаоднагодызнаюмогудругвÑейидеткиноодноделаделеÑрокиюнÑвеÑьЕÑтьразанашиاللهالتيجميعخاصةالذيعليهجديدالآنالردتحكمصÙحةكانتاللييكونشبكةÙيهابناتحواءأكثرخلالالحبدليلدروساضغطتكونهناكساحةناديالطبعليكشكرايمكنمنهاشركةرئيسنشيطماذاالÙنشبابتعبررحمةكاÙةيقولمركزكلمةأحمدقلبييعنيصورةطريقشاركجوالأخرىمعناابحثعروضبشكلمسجلبنانخالدكتابكليةبدونأيضايوجدÙريقكتبتأÙضلمطبخاكثرباركاÙضلاحلىنÙسهأيامردودأنهاديناالانمعرضتعلمداخلممكن
+ 
+ ÿÿÿÿ
+statementattentionBiography} else {
+solutionswhen the Analyticstemplatesdangeroussatellitedocumentspublisherimportantprototypeinfluence&raquo;</effectivegenerallytransformbeautifultransportorganizedpublishedprominentuntil thethumbnailNational .focus();over the migrationannouncedfooter">
+exceptionless thanexpensiveformationframeworkterritoryndicationcurrentlyclassNamecriticismtraditionelsewhereAlexanderappointedmaterialsbroadcastmentionedaffiliate</option>treatmentdifferent/default.Presidentonclick="biographyotherwisepermanentFrançaisHollywoodexpansionstandards</style>
+reductionDecember preferredCambridgeopponentsBusiness confusion>
+<title>presentedexplaineddoes not worldwideinterfacepositionsnewspaper</table>
+mountainslike the essentialfinancialselectionaction="/abandonedEducationparseInt(stabilityunable to</title>
+relationsNote thatefficientperformedtwo yearsSince thethereforewrapper">alternateincreasedBattle ofperceivedtrying tonecessaryportrayedelectionsElizabeth</iframe>discoveryinsurances.length;legendaryGeographycandidatecorporatesometimesservices.inherited</strong>CommunityreligiouslocationsCommitteebuildingsthe worldno longerbeginningreferencecannot befrequencytypicallyinto the relative;recordingpresidentinitiallytechniquethe otherit can beexistenceunderlinethis timetelephoneitemscopepracticesadvantage);return For otherprovidingdemocracyboth the extensivesufferingsupportedcomputers functionpracticalsaid thatit may beEnglish</from the scheduleddownloads</label>
+suspectedmargin: 0spiritual</head>
+
+microsoftgraduallydiscussedhe becameexecutivejquery.jshouseholdconfirmedpurchasedliterallydestroyedup to thevariationremainingit is notcenturiesJapanese among thecompletedalgorithminterestsrebellionundefinedencourageresizableinvolvingsensitiveuniversalprovision(althoughfeaturingconducted), which continued-header">February numerous overflow:componentfragmentsexcellentcolspan="technicalnear the Advanced source ofexpressedHong Kong Facebookmultiple mechanismelevationoffensive</form>
+ sponsoreddocument.or &quot;there arethose whomovementsprocessesdifficultsubmittedrecommendconvincedpromoting" width=".replace(classicalcoalitionhis firstdecisionsassistantindicatedevolution-wrapper"enough toalong thedelivered-->
+<!--American protectedNovember </style><furnitureInternet onblur="suspendedrecipientbased on Moreover,abolishedcollectedwere madeemotionalemergencynarrativeadvocatespx;bordercommitteddir="ltr"employeesresearch. selectedsuccessorcustomersdisplayedSeptemberaddClass(Facebook suggestedand lateroperatingelaborateSometimesInstitutecertainlyinstalledfollowersJerusalemthey havecomputinggeneratedprovincesguaranteearbitraryrecognizewanted topx;width:theory ofbehaviourWhile theestimatedbegan to it becamemagnitudemust havemore thanDirectoryextensionsecretarynaturallyoccurringvariablesgiven theplatform.</label><failed tocompoundskinds of societiesalongside --&gt;
+
+southwestthe rightradiationmay have unescape(spoken in" href="/programmeonly the come fromdirectoryburied ina similarthey were</font></Norwegianspecifiedproducingpassenger(new DatetemporaryfictionalAfter theequationsdownload.regularlydeveloperabove thelinked tophenomenaperiod oftooltip">substanceautomaticaspect ofAmong theconnectedestimatesAir Forcesystem ofobjectiveimmediatemaking itpaintingsconqueredare stillproceduregrowth ofheaded byEuropean divisionsmoleculesfranchiseintentionattractedchildhoodalso useddedicatedsingaporedegree offather ofconflicts</a></p>
+came fromwere usednote thatreceivingExecutiveeven moreaccess tocommanderPoliticalmusiciansdeliciousprisonersadvent ofUTF-8" /><![CDATA[">ContactSouthern bgcolor="series of. It was in Europepermittedvalidate.appearingofficialsseriously-languageinitiatedextendinglong-terminflationsuch thatgetCookiemarked by</button>implementbut it isincreasesdown the requiringdependent-->
+<!-- interviewWith the copies ofconsensuswas builtVenezuela(formerlythe statepersonnelstrategicfavour ofinventionWikipediacontinentvirtuallywhich wasprincipleComplete identicalshow thatprimitiveaway frommolecularpreciselydissolvedUnder theversion=">&nbsp;</It is the This is will haveorganismssome timeFriedrichwas firstthe only fact thatform id="precedingTechnicalphysicistoccurs innavigatorsection">span id="sought tobelow thesurviving}</style>his deathas in thecaused bypartiallyexisting using thewas givena list oflevels ofnotion ofOfficial dismissedscientistresemblesduplicateexplosiverecoveredall othergalleries{padding:people ofregion ofaddressesassociateimg alt="in modernshould bemethod ofreportingtimestampneeded tothe Greatregardingseemed toviewed asimpact onidea thatthe Worldheight ofexpandingThese arecurrent">carefullymaintainscharge ofClassicaladdressedpredictedownership<div id="right">
+residenceleave thecontent">are often })();
+probably Professor-button" respondedsays thathad to beplaced inHungarianstatus ofserves asUniversalexecutionaggregatefor whichinfectionagreed tohowever, popular">placed onconstructelectoralsymbol ofincludingreturn toarchitectChristianprevious living ineasier toprofessor
+&lt;!-- effect ofanalyticswas takenwhere thetook overbelief inAfrikaansas far aspreventedwork witha special<fieldsetChristmasRetrieved
+
+In the back intonortheastmagazines><strong>committeegoverninggroups ofstored inestablisha generalits firsttheir ownpopulatedan objectCaribbeanallow thedistrictswisconsinlocation.; width: inhabitedSocialistJanuary 1</footer>similarlychoice ofthe same specific business The first.length; desire todeal withsince theuserAgentconceivedindex.phpas &quot;engage inrecently,few yearswere also
+<head>
+<edited byare knowncities inaccesskeycondemnedalso haveservices,family ofSchool ofconvertednature of languageministers</object>there is a popularsequencesadvocatedThey wereany otherlocation=enter themuch morereflectedwas namedoriginal a typicalwhen theyengineerscould notresidentswednesdaythe third productsJanuary 2what theya certainreactionsprocessorafter histhe last contained"></div>
+</a></td>depend onsearch">
+pieces ofcompetingReferencetennesseewhich has version=</span> <</header>gives thehistorianvalue="">padding:0view thattogether,the most was foundsubset ofattack onchildren,points ofpersonal position:allegedlyClevelandwas laterand afterare givenwas stillscrollingdesign ofmakes themuch lessAmericans.
+
+After , but theMuseum oflouisiana(from theminnesotaparticlesa processDominicanvolume ofreturningdefensive00px|righmade frommouseover" style="states of(which iscontinuesFranciscobuilding without awith somewho woulda form ofa part ofbefore itknown as Serviceslocation and oftenmeasuringand it ispaperbackvalues of
+<title>= window.determineer&quot; played byand early</center>from thisthe threepower andof &quot;innerHTML<a href="y:inline;Church ofthe eventvery highofficial -height: content="/cgi-bin/to createafrikaansesperantofrançaislatvieÅ¡ulietuviųČeÅ¡tinaÄeÅ¡tinaไทย日本語简体字ç¹é«”字한국어为什么计算机笔记本討論å€æœåŠ¡å™¨äº’è”网房地产俱ä¹éƒ¨å‡ºç‰ˆç¤¾æŽ’行榜部è½æ ¼è¿›ä¸€æ­¥æ”¯ä»˜å®éªŒè¯ç å§”员会数æ®åº“消费者办公室讨论区深圳市播放器北京市大学生越æ¥è¶Šç®¡ç†å‘˜ä¿¡æ¯ç½‘serviciosartículoargentinabarcelonacualquierpublicadoproductospolíticarespuestawikipediasiguientebúsquedacomunidadseguridadprincipalpreguntascontenidorespondervenezuelaproblemasdiciembrerelaciónnoviembresimilaresproyectosprogramasinstitutoactividadencuentraeconomíaimágenescontactardescargarnecesarioatenciónteléfonocomisióncancionescapacidadencontraranálisisfavoritostérminosprovinciaetiquetaselementosfuncionesresultadocarácterpropiedadprincipionecesidadmunicipalcreacióndescargaspresenciacomercialopinionesejercicioeditorialsalamancagonzálezdocumentopelícularecientesgeneralestarragonaprácticanovedadespropuestapacientestécnicasobjetivoscontactosमेंलिà¤à¤¹à¥ˆà¤‚गयासाथà¤à¤µà¤‚रहेकोईकà¥à¤›à¤°à¤¹à¤¾à¤¬à¤¾à¤¦à¤•à¤¹à¤¾à¤¸à¤­à¥€à¤¹à¥à¤à¤°à¤¹à¥€à¤®à¥ˆà¤‚दिनबातdiplodocsसमयरूपनामपताफिरऔसततरहलोगहà¥à¤†à¤¬à¤¾à¤°à¤¦à¥‡à¤¶à¤¹à¥à¤ˆà¤–ेलयदिकामवेबतीनबीचमौतसाललेखजॉबमददतथानहीशहरअलगकभीनगरपासरातकिà¤à¤‰à¤¸à¥‡à¤—यीहूà¤à¤†à¤—ेटीमखोजकारअभीगयेतà¥à¤®à¤µà¥‹à¤Ÿà¤¦à¥‡à¤‚अगरà¤à¤¸à¥‡à¤®à¥‡à¤²à¤²à¤—ाहालऊपरचारà¤à¤¸à¤¾à¤¦à¥‡à¤°à¤œà¤¿à¤¸à¤¦à¤¿à¤²à¤¬à¤‚दबनाहूंलाखजीतबटनमिलइसेआनेनयाकà¥à¤²à¤²à¥‰à¤—भागरेलजगहरामलगेपेजहाथइसीसहीकलाठीकहाà¤à¤¦à¥‚रतहतसातयादआयापाककौनशामदेखयहीरायखà¥à¤¦à¤²à¤—ीcategoriesexperience</title>
+Copyright javascriptconditionseverything<p class="technologybackground<a class="management&copy; 201javaScriptcharactersbreadcrumbthemselveshorizontalgovernmentCaliforniaactivitiesdiscoveredNavigationtransitionconnectionnavigationappearance</title><mcheckbox" techniquesprotectionapparentlyas well asunt', 'UA-resolutionoperationstelevisiontranslatedWashingtonnavigator. = window.impression&lt;br&gt;literaturepopulationbgcolor="#especially content="productionnewsletterpropertiesdefinitionleadershipTechnologyParliamentcomparisonul class=".indexOf("conclusiondiscussioncomponentsbiologicalRevolution_containerunderstoodnoscript><permissioneach otheratmosphere onfocus="<form id="processingthis.valuegenerationConferencesubsequentwell-knownvariationsreputationphenomenondisciplinelogo.png" (document,boundariesexpressionsettlementBackgroundout of theenterprise("https:" unescape("password" democratic<a href="/wrapper">
+membershiplinguisticpx;paddingphilosophyassistanceuniversityfacilitiesrecognizedpreferenceif (typeofmaintainedvocabularyhypothesis.submit();&amp;nbsp;annotationbehind theFoundationpublisher"assumptionintroducedcorruptionscientistsexplicitlyinstead ofdimensions onClick="considereddepartmentoccupationsoon afterinvestmentpronouncedidentifiedexperimentManagementgeographic" height="link rel=".replace(/depressionconferencepunishmenteliminatedresistanceadaptationoppositionwell knownsupplementdeterminedh1 class="0px;marginmechanicalstatisticscelebratedGovernment
+
+During tdevelopersartificialequivalentoriginatedCommissionattachment<span id="there wereNederlandsbeyond theregisteredjournalistfrequentlyall of thelang="en" </style>
+absolute; supportingextremely mainstream</strong> popularityemployment</table>
+ colspan="</form>
+ conversionabout the </p></div>integrated" lang="enPortuguesesubstituteindividualimpossiblemultimediaalmost allpx solid #apart fromsubject toin Englishcriticizedexcept forguidelinesoriginallyremarkablethe secondh2 class="<a title="(includingparametersprohibited= "http://dictionaryperceptionrevolutionfoundationpx;height:successfulsupportersmillenniumhis fatherthe &quot;no-repeat;commercialindustrialencouragedamount of unofficialefficiencyReferencescoordinatedisclaimerexpeditiondevelopingcalculatedsimplifiedlegitimatesubstring(0" class="completelyillustratefive yearsinstrumentPublishing1" class="psychologyconfidencenumber of absence offocused onjoined thestructurespreviously></iframe>once againbut ratherimmigrantsof course,a group ofLiteratureUnlike the</a>&nbsp;
+function it was theConventionautomobileProtestantaggressiveafter the Similarly," /></div>collection
+functionvisibilitythe use ofvolunteersattractionunder the threatened*<![CDATA[importancein generalthe latter</form>
+</.indexOf('i = 0; i <differencedevoted totraditionssearch forultimatelytournamentattributesso-called }
+</style>evaluationemphasizedaccessible</section>successionalong withMeanwhile,industries</a><br />has becomeaspects ofTelevisionsufficientbasketballboth sidescontinuingan article<img alt="adventureshis mothermanchesterprinciplesparticularcommentaryeffects ofdecided to"><strong>publishersJournal ofdifficultyfacilitateacceptablestyle.css" function innovation>Copyrightsituationswould havebusinessesDictionarystatementsoften usedpersistentin Januarycomprising</title>
+ diplomaticcontainingperformingextensionsmay not beconcept of onclick="It is alsofinancial making theLuxembourgadditionalare calledengaged in"script");but it waselectroniconsubmit="
+<!-- End electricalofficiallysuggestiontop of theunlike theAustralianOriginallyreferences
+</head>
+recognisedinitializelimited toAlexandriaretirementAdventuresfour years
+
+&lt;!-- increasingdecorationh3 class="origins ofobligationregulationclassified(function(advantagesbeing the historians<base hrefrepeatedlywilling tocomparabledesignatednominationfunctionalinside therevelationend of thes for the authorizedrefused totake placeautonomouscompromisepolitical restauranttwo of theFebruary 2quality ofswfobject.understandnearly allwritten byinterviews" width="1withdrawalfloat:leftis usuallycandidatesnewspapersmysteriousDepartmentbest knownparliamentsuppressedconvenientremembereddifferent systematichas led topropagandacontrolledinfluencesceremonialproclaimedProtectionli class="Scientificclass="no-trademarksmore than widespreadLiberationtook placeday of theas long asimprisonedAdditional
+<head>
+<mLaboratoryNovember 2exceptionsIndustrialvariety offloat: lefDuring theassessmenthave been deals withStatisticsoccurrence/ul></div>clearfix">the publicmany yearswhich wereover time,synonymouscontent">
+presumablyhis familyuserAgent.unexpectedincluding challengeda minorityundefined"belongs totaken fromin Octoberposition: said to bereligious Federation rowspan="only a fewmeant thatled to the-->
+<div <fieldset>Archbishop class="nobeing usedapproachesprivilegesnoscript>
+results inmay be theEaster eggmechanismsreasonablePopulationCollectionselected">noscript> /index.phparrival of-jssdk'));managed toincompletecasualtiescompletionChristiansSeptember arithmeticproceduresmight haveProductionit appearsPhilosophyfriendshipleading togiving thetoward theguaranteeddocumentedcolor:#000video gamecommissionreflectingchange theassociatedsans-serifonkeypress; padding:He was theunderlyingtypically , and the srcElementsuccessivesince the should be networkingaccountinguse of thelower thanshows that</span>
+ complaintscontinuousquantitiesastronomerhe did notdue to itsapplied toan averageefforts tothe futureattempt toTherefore,capabilityRepublicanwas formedElectronickilometerschallengespublishingthe formerindigenousdirectionssubsidiaryconspiracydetails ofand in theaffordablesubstancesreason forconventionitemtype="absolutelysupposedlyremained aattractivetravellingseparatelyfocuses onelementaryapplicablefound thatstylesheetmanuscriptstands for no-repeat(sometimesCommercialin Americaundertakenquarter ofan examplepersonallyindex.php?</button>
+percentagebest-knowncreating a" dir="ltrLieutenant
+<div id="they wouldability ofmade up ofnoted thatclear thatargue thatto anotherchildren'spurpose offormulatedbased uponthe regionsubject ofpassengerspossession.
+
+In the Before theafterwardscurrently across thescientificcommunity.capitalismin Germanyright-wingthe systemSociety ofpoliticiandirection:went on toremoval of New York apartmentsindicationduring theunless thehistoricalhad been adefinitiveingredientattendanceCenter forprominencereadyStatestrategiesbut in theas part ofconstituteclaim thatlaboratorycompatiblefailure of, such as began withusing the to providefeature offrom which/" class="geologicalseveral ofdeliberateimportant holds thating&quot; valign=topthe Germanoutside ofnegotiatedhis careerseparationid="searchwas calledthe fourthrecreationother thanpreventionwhile the education,connectingaccuratelywere builtwas killedagreementsmuch more Due to thewidth: 100some otherKingdom ofthe entirefamous forto connectobjectivesthe Frenchpeople andfeatured">is said tostructuralreferendummost oftena separate->
+<div id Official worldwide.aria-labelthe planetand it wasd" value="looking atbeneficialare in themonitoringreportedlythe modernworking onallowed towhere the innovative</a></div>soundtracksearchFormtend to beinput id="opening ofrestrictedadopted byaddressingtheologianmethods ofvariant ofChristian very largeautomotiveby far therange frompursuit offollow thebrought toin Englandagree thataccused ofcomes frompreventingdiv style=his or hertremendousfreedom ofconcerning0 1em 1em;Basketball/style.cssan earliereven after/" title=".com/indextaking thepittsburghcontent"> <script>(fturned outhaving the</span>
+ occasionalbecause itstarted tophysically></div>
+ created byCurrently, bgcolor="tabindex="disastrousAnalytics also has a><div id="</style>
+<called forsinger and.src = "//violationsthis pointconstantlyis locatedrecordingsd from thenederlandsportuguêsעבריתÙارسیdesarrollocomentarioeducaciónseptiembreregistradodirecciónubicaciónpublicidadrespuestasresultadosimportantereservadosartículosdiferentessiguientesrepúblicasituaciónministerioprivacidaddirectorioformaciónpoblaciónpresidentecontenidosaccesoriostechnoratipersonalescategoríaespecialesdisponibleactualidadreferenciavalladolidbibliotecarelacionescalendariopolíticasanterioresdocumentosnaturalezamaterialesdiferenciaeconómicatransporterodríguezparticiparencuentrandiscusiónestructurafundaciónfrecuentespermanentetotalmenteможнобудетможетвремÑтакжечтобыболееоченьÑтогокогдапоÑлевÑегоÑайтечерезмогутÑайтажизнимеждубудутПоиÑкздеÑьвидеоÑвÑзинужноÑвоейлюдейпорномногодетейÑвоихправатакоймеÑтоимеетжизньоднойлучшепередчаÑтичаÑтьработновыхправоÑобойпотомменеечиÑленовыеуÑлугоколоназадтакоетогдапочтиПоÑлетакиеновыйÑтоиттакихÑразуСанктфорумКогдакнигиÑлованашейнайтиÑвоимÑвÑзьлюбойчаÑтоÑредиКромеФорумрынкеÑталипоиÑктыÑÑчмеÑÑццентртрудаÑамыхрынкаÐовыйчаÑовмеÑтафильммартаÑтранмеÑтетекÑтнашихминутимениимеютномергородÑамомÑтомуконцеÑвоемкакойÐрхивمنتدىإرسالرسالةالعامكتبهابرامجاليومالصورجديدةالعضوإضاÙةالقسمالعابتحميلملÙاتملتقىتعديلالشعرأخبارتطويرعليكمإرÙاقطلباتاللغةترتيبالناسالشيخمنتديالعربالقصصاÙلامعليهاتحديثاللهمالعملمكتبةيمكنكالطÙÙ„ÙيديوإدارةتاريخالصحةتسجيلالوقتعندمامدينةتصميمأرشيÙالذينعربيةبوابةألعابالسÙرمشاكلتعالىالأولالسنةجامعةالصحÙالدينكلماتالخاصالملÙأعضاءكتابةالخيررسائلالقلبالأدبمقاطعمراسلمنطقةالكتبالرجلاشتركالقدميعطيكsByTagName(.jpg" alt="1px solid #.gif" alt="transparentinformationapplication" onclick="establishedadvertising.png" alt="environmentperformanceappropriate&amp;mdash;immediately</strong></rather thantemperaturedevelopmentcompetitionplaceholdervisibility:copyright">0" height="even thoughreplacementdestinationCorporation<ul class="AssociationindividualsperspectivesetTimeout(url(http://mathematicsmargin-top:eventually description) no-repeatcollections.JPG|thumb|participate/head><bodyfloat:left;<li class="hundreds of
+
+However, compositionclear:both;cooperationwithin the label for="border-top:New Zealandrecommendedphotographyinteresting&lt;sup&gt;controversyNetherlandsalternativemaxlength="switzerlandDevelopmentessentially
+
+Although </textarea>thunderbirdrepresented&amp;ndash;speculationcommunitieslegislationelectronics
+ <div id="illustratedengineeringterritoriesauthoritiesdistributed6" height="sans-serif;capable of disappearedinteractivelooking forit would beAfghanistanwas createdMath.floor(surroundingcan also beobservationmaintenanceencountered<h2 class="more recentit has beeninvasion of).getTime()fundamentalDespite the"><div id="inspirationexaminationpreparationexplanation<input id="</a></span>versions ofinstrumentsbefore the = 'http://Descriptionrelatively .substring(each of theexperimentsinfluentialintegrationmany peopledue to the combinationdo not haveMiddle East<noscript><copyright" perhaps theinstitutionin Decemberarrangementmost famouspersonalitycreation oflimitationsexclusivelysovereignty-content">
+<td class="undergroundparallel todoctrine ofoccupied byterminologyRenaissancea number ofsupport forexplorationrecognitionpredecessor<img src="/<h1 class="publicationmay also bespecialized</fieldset>progressivemillions ofstates thatenforcementaround the one another.parentNodeagricultureAlternativeresearcherstowards theMost of themany other (especially<td width=";width:100%independent<h3 class=" onchange=").addClass(interactionOne of the daughter ofaccessoriesbranches of
+<div id="the largestdeclarationregulationsInformationtranslationdocumentaryin order to">
+<head>
+<" height="1across the orientation);</script>implementedcan be seenthere was ademonstratecontainer">connectionsthe Britishwas written!important;px; margin-followed byability to complicatedduring the immigrationalso called<h4 class="distinctionreplaced bygovernmentslocation ofin Novemberwhether the</p>
+</div>acquisitioncalled the persecutiondesignation{font-size:appeared ininvestigateexperiencedmost likelywidely useddiscussionspresence of (document.extensivelyIt has beenit does notcontrary toinhabitantsimprovementscholarshipconsumptioninstructionfor exampleone or morepx; paddingthe currenta series ofare usuallyrole in thepreviously derivativesevidence ofexperiencescolorschemestated thatcertificate</a></div>
+ selected="high schoolresponse tocomfortableadoption ofthree yearsthe countryin Februaryso that thepeople who provided by<param nameaffected byin terms ofappointmentISO-8859-1"was born inhistorical regarded asmeasurementis based on and other : function(significantcelebrationtransmitted/js/jquery.is known astheoretical tabindex="it could be<noscript>
+having been
+<head>
+< &quot;The compilationhe had beenproduced byphilosopherconstructedintended toamong othercompared toto say thatEngineeringa differentreferred todifferencesbelief thatphotographsidentifyingHistory of Republic ofnecessarilyprobabilitytechnicallyleaving thespectacularfraction ofelectricityhead of therestaurantspartnershipemphasis onmost recentshare with saying thatfilled withdesigned toit is often"></iframe>as follows:merged withthrough thecommercial pointed outopportunityview of therequirementdivision ofprogramminghe receivedsetInterval"></span></in New Yorkadditional compression
+
+<div id="incorporate;</script><attachEventbecame the " target="_carried outSome of thescience andthe time ofContainer">maintainingChristopherMuch of thewritings of" height="2size of theversion of mixture of between theExamples ofeducationalcompetitive onsubmit="director ofdistinctive/DTD XHTML relating totendency toprovince ofwhich woulddespite thescientific legislature.innerHTML allegationsAgriculturewas used inapproach tointelligentyears later,sans-serifdeterminingPerformanceappearances, which is foundationsabbreviatedhigher thans from the individual composed ofsupposed toclaims thatattributionfont-size:1elements ofHistorical his brotherat the timeanniversarygoverned byrelated to ultimately innovationsit is stillcan only bedefinitionstoGMTStringA number ofimg class="Eventually,was changedoccurred inneighboringdistinguishwhen he wasintroducingterrestrialMany of theargues thatan Americanconquest ofwidespread were killedscreen and In order toexpected todescendantsare locatedlegislativegenerations backgroundmost peopleyears afterthere is nothe highestfrequently they do notargued thatshowed thatpredominanttheologicalby the timeconsideringshort-lived</span></a>can be usedvery littleone of the had alreadyinterpretedcommunicatefeatures ofgovernment,</noscript>entered the" height="3Independentpopulationslarge-scale. Although used in thedestructionpossibilitystarting intwo or moreexpressionssubordinatelarger thanhistory and</option>
+Continentaleliminatingwill not bepractice ofin front ofsite of theensure thatto create amississippipotentiallyoutstandingbetter thanwhat is nowsituated inmeta name="TraditionalsuggestionsTranslationthe form ofatmosphericideologicalenterprisescalculatingeast of theremnants ofpluginspage/index.php?remained intransformedHe was alsowas alreadystatisticalin favor ofMinistry ofmovement offormulationis required<link rel="This is the <a href="/popularizedinvolved inare used toand severalmade by theseems to belikely thatPalestiniannamed afterit had beenmost commonto refer tobut this isconsecutivetemporarilyIn general,conventionstakes placesubdivisionterritorialoperationalpermanentlywas largelyoutbreak ofin the pastfollowing a xmlns:og="><a class="class="textConversion may be usedmanufactureafter beingclearfix">
+question ofwas electedto become abecause of some peopleinspired bysuccessful a time whenmore commonamongst thean officialwidth:100%;technology,was adoptedto keep thesettlementslive birthsindex.html"Connecticutassigned to&amp;times;account foralign=rightthe companyalways beenreturned toinvolvementBecause thethis period" name="q" confined toa result ofvalue="" />is actuallyEnvironment
+</head>
+Conversely,>
+<div id="0" width="1is probablyhave becomecontrollingthe problemcitizens ofpoliticiansreached theas early as:none; over<table cellvalidity ofdirectly toonmousedownwhere it iswhen it wasmembers of relation toaccommodatealong with In the latethe Englishdelicious">this is notthe presentif they areand finallya matter of
+ </div>
+
+</script>faster thanmajority ofafter whichcomparativeto maintainimprove theawarded theer" class="frameborderrestorationin the sameanalysis oftheir firstDuring the continentalsequence offunction(){font-size: work on the</script>
+<begins withjavascript:constituentwas foundedequilibriumassume thatis given byneeds to becoordinatesthe variousare part ofonly in thesections ofis a commontheories ofdiscoveriesassociationedge of thestrength ofposition inpresent-dayuniversallyto form thebut insteadcorporationattached tois commonlyreasons for &quot;the can be madewas able towhich meansbut did notonMouseOveras possibleoperated bycoming fromthe primaryaddition offor severaltransferreda period ofare able tohowever, itshould havemuch larger
+ </script>adopted theproperty ofdirected byeffectivelywas broughtchildren ofProgramminglonger thanmanuscriptswar againstby means ofand most ofsimilar to proprietaryoriginatingprestigiousgrammaticalexperience.to make theIt was alsois found incompetitorsin the U.S.replace thebrought thecalculationfall of thethe generalpracticallyin honor ofreleased inresidentialand some ofking of thereaction to1st Earl ofculture andprincipally</title>
+ they can beback to thesome of hisexposure toare similarform of theaddFavoritecitizenshippart in thepeople within practiceto continue&amp;minus;approved by the first allowed theand for thefunctioningplaying thesolution toheight="0" in his bookmore than afollows thecreated thepresence in&nbsp;</td>nationalistthe idea ofa characterwere forced class="btndays of thefeatured inshowing theinterest inin place ofturn of thethe head ofLord of thepoliticallyhas its ownEducationalapproval ofsome of theeach other,behavior ofand becauseand anotherappeared onrecorded inblack&quot;may includethe world'scan lead torefers to aborder="0" government winning theresulted in while the Washington,the subjectcity in the></div>
+ reflect theto completebecame moreradioactiverejected bywithout anyhis father,which couldcopy of theto indicatea politicalaccounts ofconstitutesworked wither</a></li>of his lifeaccompaniedclientWidthprevent theLegislativedifferentlytogether inhas severalfor anothertext of thefounded thee with the is used forchanged theusually theplace wherewhereas the> <a href=""><a href="themselves,although hethat can betraditionalrole of theas a resultremoveChilddesigned bywest of theSome peopleproduction,side of thenewslettersused by thedown to theaccepted bylive in theattempts tooutside thefrequenciesHowever, inprogrammersat least inapproximatealthough itwas part ofand variousGovernor ofthe articleturned into><a href="/the economyis the mostmost widelywould laterand perhapsrise to theoccurs whenunder whichconditions.the westerntheory thatis producedthe city ofin which heseen in thethe centralbuilding ofmany of hisarea of theis the onlymost of themany of thethe WesternThere is noextended toStatisticalcolspan=2 |short storypossible totopologicalcritical ofreported toa Christiandecision tois equal toproblems ofThis can bemerchandisefor most ofno evidenceeditions ofelements in&quot;. Thecom/images/which makesthe processremains theliterature,is a memberthe popularthe ancientproblems intime of thedefeated bybody of thea few yearsmuch of thethe work ofCalifornia,served as agovernment.concepts ofmovement in <div id="it" value="language ofas they areproduced inis that theexplain thediv></div>
+However thelead to the <a href="/was grantedpeople havecontinuallywas seen asand relatedthe role ofproposed byof the besteach other.Constantinepeople fromdialects ofto revisionwas renameda source ofthe initiallaunched inprovide theto the westwhere thereand similarbetween twois also theEnglish andconditions,that it wasentitled tothemselves.quantity ofransparencythe same asto join thecountry andthis is theThis led toa statementcontrast tolastIndexOfthrough hisis designedthe term isis providedprotect theng</a></li>The currentthe site ofsubstantialexperience,in the Westthey shouldslovenÄinacomentariosuniversidadcondicionesactividadesexperienciatecnologíaproducciónpuntuaciónaplicacióncontraseñacategoríasregistrarseprofesionaltratamientoregístratesecretaríaprincipalesprotecciónimportantesimportanciaposibilidadinteresantecrecimientonecesidadessuscribirseasociacióndisponiblesevaluaciónestudiantesresponsableresoluciónguadalajararegistradosoportunidadcomercialesfotografíaautoridadesingenieríatelevisióncompetenciaoperacionesestablecidosimplementeactualmentenavegaciónconformidadline-height:font-family:" : "http://applicationslink" href="specifically//<![CDATA[
+Organizationdistribution0px; height:relationshipdevice-width<div class="<label for="registration</noscript>
+/index.html"window.open( !important;application/independence//www.googleorganizationautocompleterequirementsconservative<form name="intellectualmargin-left:18th centuryan importantinstitutionsabbreviation<img class="organisationcivilization19th centuryarchitectureincorporated20th century-container">most notably/></a></div>notification'undefined')Furthermore,believe thatinnerHTML = prior to thedramaticallyreferring tonegotiationsheadquartersSouth AfricaunsuccessfulPennsylvaniaAs a result,<html lang="&lt;/sup&gt;dealing withphiladelphiahistorically);</script>
+padding-top:experimentalgetAttributeinstructionstechnologiespart of the =function(){subscriptionl.dtd">
+<htgeographicalConstitution', function(supported byagriculturalconstructionpublicationsfont-size: 1a variety of<div style="Encyclopediaiframe src="demonstratedaccomplisheduniversitiesDemographics);</script><dedicated toknowledge ofsatisfactionparticularly</div></div>English (US)appendChild(transmissions. However, intelligence" tabindex="float:right;Commonwealthranging fromin which theat least onereproductionencyclopedia;font-size:1jurisdictionat that time"><a class="In addition,description+conversationcontact withis generallyr" content="representing&lt;math&gt;presentationoccasionally<img width="navigation">compensationchampionshipmedia="all" violation ofreference toreturn true;Strict//EN" transactionsinterventionverificationInformation difficultiesChampionshipcapabilities<![endif]-->}
+</script>
+Christianityfor example,Professionalrestrictionssuggest thatwas released(such as theremoveClass(unemploymentthe Americanstructure of/index.html published inspan class=""><a href="/introductionbelonging toclaimed thatconsequences<meta name="Guide to theoverwhelmingagainst the concentrated,
+.nontouch observations</a>
+</div>
+f (document.border: 1px {font-size:1treatment of0" height="1modificationIndependencedivided intogreater thanachievementsestablishingJavaScript" neverthelesssignificanceBroadcasting>&nbsp;</td>container">
+such as the influence ofa particularsrc='http://navigation" half of the substantial &nbsp;</div>advantage ofdiscovery offundamental metropolitanthe opposite" xml:lang="deliberatelyalign=centerevolution ofpreservationimprovementsbeginning inJesus ChristPublicationsdisagreementtext-align:r, function()similaritiesbody></html>is currentlyalphabeticalis sometimestype="image/many of the flow:hidden;available indescribe theexistence ofall over thethe Internet <ul class="installationneighborhoodarmed forcesreducing thecontinues toNonetheless,temperatures
+ <a href="close to theexamples of is about the(see below)." id="searchprofessionalis availablethe official </script>
+
+ <div id="accelerationthrough the Hall of Famedescriptionstranslationsinterference type='text/recent yearsin the worldvery popular{background:traditional some of the connected toexploitationemergence ofconstitutionA History ofsignificant manufacturedexpectations><noscript><can be foundbecause the has not beenneighbouringwithout the added to the <li class="instrumentalSoviet Unionacknowledgedwhich can bename for theattention toattempts to developmentsIn fact, the<li class="aimplicationssuitable formuch of the colonizationpresidentialcancelBubble Informationmost of the is describedrest of the more or lessin SeptemberIntelligencesrc="http://px; height: available tomanufacturerhuman rightslink href="/availabilityproportionaloutside the astronomicalhuman beingsname of the are found inare based onsmaller thana person whoexpansion ofarguing thatnow known asIn the earlyintermediatederived fromScandinavian</a></div>
+consider thean estimatedthe National<div id="pagresulting incommissionedanalogous toare required/ul>
+</div>
+was based onand became a&nbsp;&nbsp;t" value="" was capturedno more thanrespectivelycontinue to >
+<head>
+<were createdmore generalinformation used for theindependent the Imperialcomponent ofto the northinclude the Constructionside of the would not befor instanceinvention ofmore complexcollectivelybackground: text-align: its originalinto accountthis processan extensivehowever, thethey are notrejected thecriticism ofduring whichprobably thethis article(function(){It should bean agreementaccidentallydiffers fromArchitecturebetter knownarrangementsinfluence onattended theidentical tosouth of thepass throughxml" title="weight:bold;creating thedisplay:nonereplaced the<img src="/ihttps://www.World War IItestimonialsfound in therequired to and that thebetween the was designedconsists of considerablypublished bythe languageConservationconsisted ofrefer to theback to the css" media="People from available onproved to besuggestions"was known asvarieties oflikely to becomprised ofsupport the hands of thecoupled withconnect and border:none;performancesbefore beinglater becamecalculationsoften calledresidents ofmeaning that><li class="evidence forexplanationsenvironments"></a></div>which allowsIntroductiondeveloped bya wide rangeon behalf ofvalign="top"principle ofat the time,</noscript> said to havein the firstwhile othershypotheticalphilosopherspower of thecontained inperformed byinability towere writtenspan style="input name="the questionintended forrejection ofimplies thatinvented thethe standardwas probablylink betweenprofessor ofinteractionschanging theIndian Ocean class="lastworking with'http://www.years beforeThis was therecreationalentering themeasurementsan extremelyvalue of thestart of the
+</script>
+
+an effort toincrease theto the southspacing="0">sufficientlythe Europeanconverted toclearTimeoutdid not haveconsequentlyfor the nextextension ofeconomic andalthough theare producedand with theinsufficientgiven by thestating thatexpenditures</span></a>
+thought thaton the basiscellpadding=image of thereturning toinformation,separated byassassinateds" content="authority ofnorthwestern</div>
+<div "></div>
+ consultationcommunity ofthe nationalit should beparticipants align="leftthe greatestselection ofsupernaturaldependent onis mentionedallowing thewas inventedaccompanyinghis personalavailable atstudy of theon the otherexecution ofHuman Rightsterms of theassociationsresearch andsucceeded bydefeated theand from thebut they arecommander ofstate of theyears of agethe study of<ul class="splace in thewhere he was<li class="fthere are nowhich becamehe publishedexpressed into which thecommissionerfont-weight:territory ofextensions">Roman Empireequal to theIn contrast,however, andis typicallyand his wife(also called><ul class="effectively evolved intoseem to havewhich is thethere was noan excellentall of thesedescribed byIn practice,broadcastingcharged withreflected insubjected tomilitary andto the pointeconomicallysetTargetingare actuallyvictory over();</script>continuouslyrequired forevolutionaryan effectivenorth of the, which was front of theor otherwisesome form ofhad not beengenerated byinformation.permitted toincludes thedevelopment,entered intothe previousconsistentlyare known asthe field ofthis type ofgiven to thethe title ofcontains theinstances ofin the northdue to theirare designedcorporationswas that theone of thesemore popularsucceeded insupport fromin differentdominated bydesigned forownership ofand possiblystandardizedresponseTextwas intendedreceived theassumed thatareas of theprimarily inthe basis ofin the senseaccounts fordestroyed byat least twowas declaredcould not beSecretary ofappear to bemargin-top:1/^\s+|\s+$/ge){throw e};the start oftwo separatelanguage andwho had beenoperation ofdeath of thereal numbers <link rel="provided thethe story ofcompetitionsenglish (UK)english (US)МонголСрпÑкиÑрпÑкиÑрпÑкоلعربية正體中文简体中文ç¹ä½“中文有é™å…¬å¸äººæ°‘政府阿里巴巴社会主义æ“作系统政策法规informaciónherramientaselectrónicodescripciónclasificadosconocimientopublicaciónrelacionadasinformáticarelacionadosdepartamentotrabajadoresdirectamenteayuntamientomercadoLibrecontáctenoshabitacionescumplimientorestaurantesdisposiciónconsecuenciaelectrónicaaplicacionesdesconectadoinstalaciónrealizaciónutilizaciónenciclopediaenfermedadesinstrumentosexperienciasinstituciónparticularessubcategoriaтолькоРоÑÑииработыбольшепроÑтоможетедругихÑлучаеÑейчаÑвÑегдаРоÑÑиÑМоÑкведругиегородавопроÑданныхдолжныименноМоÑквырублейМоÑкваÑтраныничегоработедолженуÑлугитеперьОднакопотомуработуапрелÑвообщеодногоÑвоегоÑтатьидругойфорумехорошопротивÑÑылкакаждыйвлаÑтигруппывмеÑтеработаÑказалпервыйделатьденьгипериодбизнеÑоÑновемоменткупитьдолжнарамкахначалоРаботаТолькоÑовÑемвторойначалаÑпиÑокÑлужбыÑиÑтемпечатиновогопомощиÑайтовпочемупомощьдолжноÑÑылкибыÑтроданныемногиепроектСейчаÑмоделитакогоонлайнгородеверÑиÑÑтранефильмыуровнÑразныхиÑкатьнеделюÑнварÑменьшемногихданнойзначитнельзÑфорумаТеперьмеÑÑцазащитыЛучшиеनहींकरनेअपनेकियाकरेंअनà¥à¤¯à¤•à¥à¤¯à¤¾à¤—ाइडबारेकिसीदियापहलेसिंहभारतअपनीवालेसेवाकरतेमेरेहोनेसकतेबहà¥à¤¤à¤¸à¤¾à¤‡à¤Ÿà¤¹à¥‹à¤—ाजानेमिनटकरताकरनाउनकेयहाà¤à¤¸à¤¬à¤¸à¥‡à¤­à¤¾à¤·à¤¾à¤†à¤ªà¤•à¥‡à¤²à¤¿à¤¯à¥‡à¤¶à¥à¤°à¥‚इसकेघंटेमेरीसकतामेरालेकरअधिकअपनासमाजमà¥à¤à¥‡à¤•à¤¾à¤°à¤£à¤¹à¥‹à¤¤à¤¾à¤•à¤¡à¤¼à¥€à¤¯à¤¹à¤¾à¤‚होटलशबà¥à¤¦à¤²à¤¿à¤¯à¤¾à¤œà¥€à¤µà¤¨à¤œà¤¾à¤¤à¤¾à¤•à¥ˆà¤¸à¥‡à¤†à¤ªà¤•à¤¾à¤µà¤¾à¤²à¥€à¤¦à¥‡à¤¨à¥‡à¤ªà¥‚रीपानीउसकेहोगीबैठकआपकीवरà¥à¤·à¤—ांवआपकोजिलाजानासहमतहमेंउनकीयाहूदरà¥à¤œà¤¸à¥‚चीपसंदसवालहोनाहोतीजैसेवापसजनतानेताजारीघायलजिलेनीचेजांचपतà¥à¤°à¤—ूगलजातेबाहरआपनेवाहनइसकासà¥à¤¬à¤¹à¤°à¤¹à¤¨à¥‡à¤‡à¤¸à¤¸à¥‡à¤¸à¤¹à¤¿à¤¤à¤¬à¤¡à¤¼à¥‡à¤˜à¤Ÿà¤¨à¤¾à¤¤à¤²à¤¾à¤¶à¤ªà¤¾à¤‚चशà¥à¤°à¥€à¤¬à¤¡à¤¼à¥€à¤¹à¥‹à¤¤à¥‡à¤¸à¤¾à¤ˆà¤Ÿà¤¶à¤¾à¤¯à¤¦à¤¸à¤•à¤¤à¥€à¤œà¤¾à¤¤à¥€à¤µà¤¾à¤²à¤¾à¤¹à¤œà¤¾à¤°à¤ªà¤Ÿà¤¨à¤¾à¤°à¤–नेसड़कमिलाउसकीकेवललगताखानाअरà¥à¤¥à¤œà¤¹à¤¾à¤‚देखापहलीनियमबिनाबैंककहींकहनादेताहमलेकाफीजबकितà¥à¤°à¤¤à¤®à¤¾à¤‚गवहींरोज़मिलीआरोपसेनायादवलेनेखाताकरीबउनकाजवाबपूराबड़ासौदाशेयरकियेकहांअकसरबनाà¤à¤µà¤¹à¤¾à¤‚सà¥à¤¥à¤²à¤®à¤¿à¤²à¥‡à¤²à¥‡à¤–कविषयकà¥à¤°à¤‚समूहथानाتستطيعمشاركةبواسطةالصÙحةمواضيعالخاصةالمزيدالعامةالكاتبالردودبرنامجالدولةالعالمالموقعالعربيالسريعالجوالالذهابالحياةالحقوقالكريمالعراقمحÙوظةالثانيمشاهدةالمرأةالقرآنالشبابالحوارالجديدالأسرةالعلوممجموعةالرحمنالنقاطÙلسطينالكويتالدنيابركاتهالرياضتحياتيبتوقيتالأولىالبريدالكلامالرابطالشخصيسياراتالثالثالصلاةالحديثالزوارالخليجالجميعالعامهالجمالالساعةمشاهدهالرئيسالدخولالÙنيةالكتابالدوريالدروساستغرقتصاميمالبناتالعظيمentertainmentunderstanding = function().jpg" width="configuration.png" width="<body class="Math.random()contemporary United Statescircumstances.appendChild(organizations<span class=""><img src="/distinguishedthousands of communicationclear"></div>investigationfavicon.ico" margin-right:based on the Massachusettstable border=internationalalso known aspronunciationbackground:#fpadding-left:For example, miscellaneous&lt;/math&gt;psychologicalin particularearch" type="form method="as opposed toSupreme Courtoccasionally Additionally,North Americapx;backgroundopportunitiesEntertainment.toLowerCase(manufacturingprofessional combined withFor instance,consisting of" maxlength="return false;consciousnessMediterraneanextraordinaryassassinationsubsequently button type="the number ofthe original comprehensiverefers to the</ul>
+</div>
+philosophicallocation.hrefwas publishedSan Francisco(function(){
+<div id="mainsophisticatedmathematical /head>
+<bodysuggests thatdocumentationconcentrationrelationshipsmay have been(for example,This article in some casesparts of the definition ofGreat Britain cellpadding=equivalent toplaceholder="; font-size: justificationbelieved thatsuffered fromattempted to leader of thecript" src="/(function() {are available
+ <link rel=" src='http://interested inconventional " alt="" /></are generallyhas also beenmost popular correspondingcredited withtyle="border:</a></span></.gif" width="<iframe src="table class="inline-block;according to together withapproximatelyparliamentarymore and moredisplay:none;traditionallypredominantly&nbsp;|&nbsp;&nbsp;</span> cellspacing=<input name="or" content="controversialproperty="og:/x-shockwave-demonstrationsurrounded byNevertheless,was the firstconsiderable Although the collaborationshould not beproportion of<span style="known as the shortly afterfor instance,described as /head>
+<body starting withincreasingly the fact thatdiscussion ofmiddle of thean individualdifficult to point of viewhomosexualityacceptance of</span></div>manufacturersorigin of thecommonly usedimportance ofdenominationsbackground: #length of thedeterminationa significant" border="0">revolutionaryprinciples ofis consideredwas developedIndo-Europeanvulnerable toproponents ofare sometimescloser to theNew York City name="searchattributed tocourse of themathematicianby the end ofat the end of" border="0" technological.removeClass(branch of theevidence that![endif]-->
+Institute of into a singlerespectively.and thereforeproperties ofis located insome of whichThere is alsocontinued to appearance of &amp;ndash; describes theconsiderationauthor of theindependentlyequipped withdoes not have</a><a href="confused with<link href="/at the age ofappear in theThese includeregardless ofcould be used style=&quot;several timesrepresent thebody>
+</html>thought to bepopulation ofpossibilitiespercentage ofaccess to thean attempt toproduction ofjquery/jquerytwo differentbelong to theestablishmentreplacing thedescription" determine theavailable forAccording to wide range of <div class="more commonlyorganisationsfunctionalitywas completed &amp;mdash; participationthe characteran additionalappears to befact that thean example ofsignificantlyonmouseover="because they async = true;problems withseems to havethe result of src="http://familiar withpossession offunction () {took place inand sometimessubstantially<span></span>is often usedin an attemptgreat deal ofEnvironmentalsuccessfully virtually all20th century,professionalsnecessary to determined bycompatibilitybecause it isDictionary ofmodificationsThe followingmay refer to:Consequently,Internationalalthough somethat would beworld's firstclassified asbottom of the(particularlyalign="left" most commonlybasis for thefoundation ofcontributionspopularity ofcenter of theto reduce thejurisdictionsapproximation onmouseout="New Testamentcollection of</span></a></in the Unitedfilm director-strict.dtd">has been usedreturn to thealthough thischange in theseveral otherbut there areunprecedentedis similar toespecially inweight: bold;is called thecomputationalindicate thatrestricted to <meta name="are typicallyconflict withHowever, the An example ofcompared withquantities ofrather than aconstellationnecessary forreported thatspecificationpolitical and&nbsp;&nbsp;<references tothe same yearGovernment ofgeneration ofhave not beenseveral yearscommitment to <ul class="visualization19th century,practitionersthat he wouldand continuedoccupation ofis defined ascentre of thethe amount of><div style="equivalent ofdifferentiatebrought aboutmargin-left: automaticallythought of asSome of these
+<div class="input class="replaced withis one of theeducation andinfluenced byreputation as
+<meta name="accommodation</div>
+</div>large part ofInstitute forthe so-called against the In this case,was appointedclaimed to beHowever, thisDepartment ofthe remainingeffect on theparticularly deal with the
+<div style="almost alwaysare currentlyexpression ofphilosophy offor more thancivilizationson the islandselectedIndexcan result in" value="" />the structure /></a></div>Many of thesecaused by theof the Unitedspan class="mcan be tracedis related tobecame one ofis frequentlyliving in thetheoreticallyFollowing theRevolutionarygovernment inis determinedthe politicalintroduced insufficient todescription">short storiesseparation ofas to whetherknown for itswas initiallydisplay:blockis an examplethe principalconsists of arecognized as/body></html>a substantialreconstructedhead of stateresistance toundergraduateThere are twogravitationalare describedintentionallyserved as theclass="headeropposition tofundamentallydominated theand the otheralliance withwas forced torespectively,and politicalin support ofpeople in the20th century.and publishedloadChartbeatto understandmember statesenvironmentalfirst half ofcountries andarchitecturalbe consideredcharacterizedclearIntervalauthoritativeFederation ofwas succeededand there area consequencethe Presidentalso includedfree softwaresuccession ofdeveloped thewas destroyedaway from the;
+</script>
+<although theyfollowed by amore powerfulresulted in aUniversity ofHowever, manythe presidentHowever, someis thought tountil the endwas announcedare importantalso includes><input type=the center of DO NOT ALTERused to referthemes/?sort=that had beenthe basis forhas developedin the summercomparativelydescribed thesuch as thosethe resultingis impossiblevarious otherSouth Africanhave the sameeffectivenessin which case; text-align:structure and; background:regarding thesupported theis also knownstyle="marginincluding thebahasa Melayunorsk bokmÃ¥lnorsk nynorskslovenÅ¡Äinainternacionalcalificacióncomunicaciónconstrucción"><div class="disambiguationDomainName', 'administrationsimultaneouslytransportationInternational margin-bottom:responsibility<![endif]-->
+</><meta name="implementationinfrastructurerepresentationborder-bottom:</head>
+<body>=http%3A%2F%2F<form method="method="post" /favicon.ico" });
+</script>
+.setAttribute(Administration= new Array();<![endif]-->
+display:block;Unfortunately,">&nbsp;</div>/favicon.ico">='stylesheet' identification, for example,<li><a href="/an alternativeas a result ofpt"></script>
+type="submit"
+(function() {recommendationform action="/transformationreconstruction.style.display According to hidden" name="along with thedocument.body.approximately Communicationspost" action="meaning &quot;--<![endif]-->Prime Ministercharacteristic</a> <a class=the history of onmouseover="the governmenthref="https://was originallywas introducedclassificationrepresentativeare considered<![endif]-->
+
+depends on theUniversity of in contrast to placeholder="in the case ofinternational constitutionalstyle="border-: function() {Because of the-strict.dtd">
+<table class="accompanied byaccount of the<script src="/nature of the the people in in addition tos); js.id = id" width="100%"regarding the Roman Catholican independentfollowing the .gif" width="1the following discriminationarchaeologicalprime minister.js"></script>combination of marginwidth="createElement(w.attachEvent(</a></td></tr>src="https://aIn particular, align="left" Czech RepublicUnited Kingdomcorrespondenceconcluded that.html" title="(function () {comes from theapplication of<span class="sbelieved to beement('script'</a>
+</li>
+<livery different><span class="option value="(also known as <li><a href="><input name="separated fromreferred to as valign="top">founder of theattempting to carbon dioxide
+
+<div class="class="search-/body>
+</html>opportunity tocommunications</head>
+<body style="width:Tiếng Việtchanges in theborder-color:#0" border="0" </span></div><was discovered" type="text" );
+</script>
+
+Department of ecclesiasticalthere has beenresulting from</body></html>has never beenthe first timein response toautomatically </div>
+
+<div iwas consideredpercent of the" /></a></div>collection of descended fromsection of theaccept-charsetto be confusedmember of the padding-right:translation ofinterpretation href='http://whether or notThere are alsothere are manya small numberother parts ofimpossible to class="buttonlocated in the. However, theand eventuallyAt the end of because of itsrepresents the<form action=" method="post"it is possiblemore likely toan increase inhave also beencorresponds toannounced thatalign="right">many countriesfor many yearsearliest knownbecause it waspt"></script> valign="top" inhabitants offollowing year
+<div class="million peoplecontroversial concerning theargue that thegovernment anda reference totransferred todescribing the style="color:although therebest known forsubmit" name="multiplicationmore than one recognition ofCouncil of theedition of the <meta name="Entertainment away from the ;margin-right:at the time ofinvestigationsconnected withand many otheralthough it isbeginning with <span class="descendants of<span class="i align="right"</head>
+<body aspects of thehas since beenEuropean Unionreminiscent ofmore difficultVice Presidentcomposition ofpassed throughmore importantfont-size:11pxexplanation ofthe concept ofwritten in the <span class="is one of the resemblance toon the groundswhich containsincluding the defined by thepublication ofmeans that theoutside of thesupport of the<input class="<span class="t(Math.random()most prominentdescription ofConstantinoplewere published<div class="seappears in the1" height="1" most importantwhich includeswhich had beendestruction ofthe population
+ <div class="possibility ofsometimes usedappear to havesuccess of theintended to bepresent in thestyle="clear:b
+</script>
+<was founded ininterview with_id" content="capital of the
+<link rel="srelease of thepoint out thatxMLHttpRequestand subsequentsecond largestvery importantspecificationssurface of theapplied to theforeign policy_setDomainNameestablished inis believed toIn addition tomeaning of theis named afterto protect theis representedDeclaration ofmore efficientClassificationother forms ofhe returned to<span class="cperformance of(function() { if and only ifregions of theleading to therelations withUnited Nationsstyle="height:other than theype" content="Association of
+</head>
+<bodylocated on theis referred to(including theconcentrationsthe individualamong the mostthan any other/>
+<link rel=" return false;the purpose ofthe ability to;color:#fff}
+.
+<span class="the subject ofdefinitions of>
+<link rel="claim that thehave developed<table width="celebration ofFollowing the to distinguish<span class="btakes place inunder the namenoted that the><![endif]-->
+style="margin-instead of theintroduced thethe process ofincreasing thedifferences inestimated thatespecially the/div><div id="was eventuallythroughout histhe differencesomething thatspan></span></significantly ></script>
+
+environmental to prevent thehave been usedespecially forunderstand theis essentiallywere the firstis the largesthave been made" src="http://interpreted assecond half ofcrolling="no" is composed ofII, Holy Romanis expected tohave their owndefined as thetraditionally have differentare often usedto ensure thatagreement withcontaining theare frequentlyinformation onexample is theresulting in a</a></li></ul> class="footerand especiallytype="button" </span></span>which included>
+<meta name="considered thecarried out byHowever, it isbecame part ofin relation topopular in thethe capital ofwas officiallywhich has beenthe History ofalternative todifferent fromto support thesuggested thatin the process <div class="the foundationbecause of hisconcerned withthe universityopposed to thethe context of<span class="ptext" name="q" <div class="the scientificrepresented bymathematicianselected by thethat have been><div class="cdiv id="headerin particular,converted into);
+</script>
+<philosophical srpskohrvatskitiếng ViệtРуÑÑкийруÑÑкийinvestigaciónparticipaciónкоторыеоблаÑтикоторыйчеловекÑиÑтемыÐовоÑтикоторыхоблаÑтьвременикотораÑÑегоднÑÑкачатьновоÑтиУкраинывопроÑыкоторойÑделатьпомощьюÑредÑтвобразомÑтороныучаÑтиетечениеГлавнаÑиÑторииÑиÑтемарешениÑСкачатьпоÑтомуÑледуетÑказатьтоваровконечнорешениекотороеоргановкоторомРекламаالمنتدىمنتدياتالموضوعالبرامجالمواقعالرسائلمشاركاتالأعضاءالرياضةالتصميمالاعضاءالنتائجالألعابالتسجيلالأقسامالضغطاتالÙيديوالترحيبالجديدةالتعليمالأخبارالاÙلامالأÙلامالتاريخالتقنيةالالعابالخواطرالمجتمعالديكورالسياحةعبداللهالتربيةالروابطالأدبيةالاخبارالمتحدةالاغانيcursor:pointer;</title>
+<meta " href="http://"><span class="members of the window.locationvertical-align:/a> | <a href="<!doctype html>media="screen" <option value="favicon.ico" />
+ <div class="characteristics" method="get" /body>
+</html>
+shortcut icon" document.write(padding-bottom:representativessubmit" value="align="center" throughout the science fiction
+ <div class="submit" class="one of the most valign="top"><was established);
+</script>
+return false;">).style.displaybecause of the document.cookie<form action="/}body{margin:0;Encyclopedia ofversion of the .createElement(name" content="</div>
+</div>
+
+administrative </body>
+</html>history of the "><input type="portion of the as part of the &nbsp;<a href="other countries">
+<div class="</span></span><In other words,display: block;control of the introduction of/>
+<meta name="as well as the in recent years
+ <div class="</div>
+ </div>
+inspired by thethe end of the compatible withbecame known as style="margin:.js"></script>< International there have beenGerman language style="color:#Communist Partyconsistent withborder="0" cell marginheight="the majority of" align="centerrelated to the many different Orthodox Churchsimilar to the />
+<link rel="swas one of the until his death})();
+</script>other languagescompared to theportions of thethe Netherlandsthe most commonbackground:url(argued that thescrolling="no" included in theNorth American the name of theinterpretationsthe traditionaldevelopment of frequently useda collection ofvery similar tosurrounding theexample of thisalign="center">would have beenimage_caption =attached to thesuggesting thatin the form of involved in theis derived fromnamed after theIntroduction torestrictions on style="width: can be used to the creation ofmost important information andresulted in thecollapse of theThis means thatelements of thewas replaced byanalysis of theinspiration forregarded as themost successfulknown as &quot;a comprehensiveHistory of the were consideredreturned to theare referred toUnsourced image>
+ <div class="consists of thestopPropagationinterest in theavailability ofappears to haveelectromagneticenableServices(function of theIt is important</script></div>function(){var relative to theas a result of the position ofFor example, in method="post" was followed by&amp;mdash; thethe applicationjs"></script>
+ul></div></div>after the deathwith respect tostyle="padding:is particularlydisplay:inline; type="submit" is divided into中文 (简体)responsabilidadadministracióninternacionalescorrespondienteउपयोगपूरà¥à¤µà¤¹à¤®à¤¾à¤°à¥‡à¤²à¥‹à¤—ोंचà¥à¤¨à¤¾à¤µà¤²à¥‡à¤•à¤¿à¤¨à¤¸à¤°à¤•à¤¾à¤°à¤ªà¥à¤²à¤¿à¤¸à¤–ोजेंचाहिà¤à¤­à¥‡à¤œà¥‡à¤‚शामिलहमारीजागरणबनानेकà¥à¤®à¤¾à¤°à¤¬à¥à¤²à¥‰à¤—मालिकमहिलापृषà¥à¤ à¤¬à¤¢à¤¼à¤¤à¥‡à¤­à¤¾à¤œà¤ªà¤¾à¤•à¥à¤²à¤¿à¤•à¤Ÿà¥à¤°à¥‡à¤¨à¤–िलाफदौरानमामलेमतदानबाजारविकासकà¥à¤¯à¥‹à¤‚चाहतेपहà¥à¤à¤šà¤¬à¤¤à¤¾à¤¯à¤¾à¤¸à¤‚वाददेखनेपिछलेविशेषराजà¥à¤¯à¤‰à¤¤à¥à¤¤à¤°à¤®à¥à¤‚बईदोनोंउपकरणपढ़ेंसà¥à¤¥à¤¿à¤¤à¤«à¤¿à¤²à¥à¤®à¤®à¥à¤–à¥à¤¯à¤…चà¥à¤›à¤¾à¤›à¥‚टतीसंगीतजाà¤à¤—ाविभागघणà¥à¤Ÿà¥‡à¤¦à¥‚सरेदिनोंहतà¥à¤¯à¤¾à¤¸à¥‡à¤•à¥à¤¸à¤—ांधीविशà¥à¤µà¤°à¤¾à¤¤à¥‡à¤‚दैटà¥à¤¸à¤¨à¤•à¥à¤¶à¤¾à¤¸à¤¾à¤®à¤¨à¥‡à¤…दालतबिजलीपà¥à¤°à¥‚षहिंदीमितà¥à¤°à¤•à¤µà¤¿à¤¤à¤¾à¤°à¥à¤ªà¤¯à¥‡à¤¸à¥à¤¥à¤¾à¤¨à¤•à¤°à¥‹à¤¡à¤¼à¤®à¥à¤•à¥à¤¤à¤¯à¥‹à¤œà¤¨à¤¾à¤•à¥ƒà¤ªà¤¯à¤¾à¤ªà¥‹à¤¸à¥à¤Ÿà¤˜à¤°à¥‡à¤²à¥‚कारà¥à¤¯à¤µà¤¿à¤šà¤¾à¤°à¤¸à¥‚चनामूलà¥à¤¯à¤¦à¥‡à¤–ेंहमेशासà¥à¤•à¥‚लमैंनेतैयारजिसकेrss+xml" title="-type" content="title" content="at the same time.js"></script>
+<" method="post" </span></a></li>vertical-align:t/jquery.min.js">.click(function( style="padding-})();
+</script>
+</span><a href="<a href="http://); return false;text-decoration: scrolling="no" border-collapse:associated with Bahasa IndonesiaEnglish language<text xml:space=.gif" border="0"</body>
+</html>
+overflow:hidden;img src="http://addEventListenerresponsible for s.js"></script>
+/favicon.ico" />operating system" style="width:1target="_blank">State Universitytext-align:left;
+document.write(, including the around the world);
+</script>
+<" style="height:;overflow:hiddenmore informationan internationala member of the one of the firstcan be found in </div>
+ </div>
+display: none;">" />
+<link rel="
+ (function() {the 15th century.preventDefault(large number of Byzantine Empire.jpg|thumb|left|vast majority ofmajority of the align="center">University Pressdominated by theSecond World Wardistribution of style="position:the rest of the characterized by rel="nofollow">derives from therather than the a combination ofstyle="width:100English-speakingcomputer scienceborder="0" alt="the existence ofDemocratic Party" style="margin-For this reason,.js"></script>
+ sByTagName(s)[0]js"></script>
+<.js"></script>
+link rel="icon" ' alt='' class='formation of theversions of the </a></div></div>/page>
+ <page>
+<div class="contbecame the firstbahasa Indonesiaenglish (simple)ΕλληνικάхрватÑкикомпанииÑвлÑетÑÑДобавитьчеловекаразвитиÑИнтернетОтветитьнапримеринтернеткоторогоÑтраницыкачеÑтвеуÑловиÑхпроблемыполучитьÑвлÑÑŽÑ‚ÑÑнаиболеекомпаниÑвниманиеÑредÑтваالمواضيعالرئيسيةالانتقالمشاركاتكالسياراتالمكتوبةالسعوديةاحصائياتالعالميةالصوتياتالانترنتالتصاميمالإسلاميالمشاركةالمرئياتrobots" content="<div id="footer">the United States<img src="http://.jpg|right|thumb|.js"></script>
+<location.protocolframeborder="0" s" />
+<meta name="</a></div></div><font-weight:bold;&quot; and &quot;depending on the margin:0;padding:" rel="nofollow" President of the twentieth centuryevision>
+ </pageInternet Explorera.async = true;
+information about<div id="header">" action="http://<a href="https://<div id="content"</div>
+</div>
+<derived from the <img src='http://according to the
+</body>
+</html>
+style="font-size:script language="Arial, Helvetica,</a><span class="</script><script political partiestd></tr></table><href="http://www.interpretation ofrel="stylesheet" document.write('<charset="utf-8">
+beginning of the revealed that thetelevision series" rel="nofollow"> target="_blank">claiming that thehttp%3A%2F%2Fwww.manifestations ofPrime Minister ofinfluenced by theclass="clearfix">/div>
+</div>
+
+three-dimensionalChurch of Englandof North Carolinasquare kilometres.addEventListenerdistinct from thecommonly known asPhonetic Alphabetdeclared that thecontrolled by theBenjamin Franklinrole-playing gamethe University ofin Western Europepersonal computerProject Gutenbergregardless of thehas been proposedtogether with the></li><li class="in some countriesmin.js"></script>of the populationofficial language<img src="images/identified by thenatural resourcesclassification ofcan be consideredquantum mechanicsNevertheless, themillion years ago</body>
+</html> Ελληνικά
+take advantage ofand, according toattributed to theMicrosoft Windowsthe first centuryunder the controldiv class="headershortly after thenotable exceptiontens of thousandsseveral differentaround the world.reaching militaryisolated from theopposition to thethe Old TestamentAfrican Americansinserted into theseparate from themetropolitan areamakes it possibleacknowledged thatarguably the mosttype="text/css">
+the InternationalAccording to the pe="text/css" />
+coincide with thetwo-thirds of theDuring this time,during the periodannounced that hethe internationaland more recentlybelieved that theconsciousness andformerly known assurrounded by thefirst appeared inoccasionally usedposition:absolute;" target="_blank" position:relative;text-align:center;jax/libs/jquery/1.background-color:#type="application/anguage" content="<meta http-equiv="Privacy Policy</a>e("%3Cscript src='" target="_blank">On the other hand,.jpg|thumb|right|2</div><div class="<div style="float:nineteenth century</body>
+</html>
+<img src="http://s;text-align:centerfont-weight: bold; According to the difference between" frameborder="0" " style="position:link href="http://html4/loose.dtd">
+during this period</td></tr></table>closely related tofor the first time;font-weight:bold;input type="text" <span style="font-onreadystatechange <div class="cleardocument.location. For example, the a wide variety of <!DOCTYPE html>
+<&nbsp;&nbsp;&nbsp;"><a href="http://style="float:left;concerned with the=http%3A%2F%2Fwww.in popular culturetype="text/css" />it is possible to Harvard Universitytylesheet" href="/the main characterOxford University name="keywords" cstyle="text-align:the United Kingdomfederal government<div style="margin depending on the description of the<div class="header.min.js"></script>destruction of theslightly differentin accordance withtelecommunicationsindicates that theshortly thereafterespecially in the European countriesHowever, there aresrc="http://staticsuggested that the" src="http://www.a large number of Telecommunications" rel="nofollow" tHoly Roman Emperoralmost exclusively" border="0" alt="Secretary of Stateculminating in theCIA World Factbookthe most importantanniversary of thestyle="background-<li><em><a href="/the Atlantic Oceanstrictly speaking,shortly before thedifferent types ofthe Ottoman Empire><img src="http://An Introduction toconsequence of thedeparture from theConfederate Statesindigenous peoplesProceedings of theinformation on thetheories have beeninvolvement in thedivided into threeadjacent countriesis responsible fordissolution of thecollaboration withwidely regarded ashis contemporariesfounding member ofDominican Republicgenerally acceptedthe possibility ofare also availableunder constructionrestoration of thethe general publicis almost entirelypasses through thehas been suggestedcomputer and videoGermanic languages according to the different from theshortly afterwardshref="https://www.recent developmentBoard of Directors<div class="search| <a href="http://In particular, theMultiple footnotesor other substancethousands of yearstranslation of the</div>
+</div>
+
+<a href="index.phpwas established inmin.js"></script>
+participate in thea strong influencestyle="margin-top:represented by thegraduated from theTraditionally, theElement("script");However, since the/div>
+</div>
+<div left; margin-left:protection against0; vertical-align:Unfortunately, thetype="image/x-icon/div>
+<div class=" class="clearfix"><div class="footer </div>
+ </div>
+the motion pictureБългарÑкибългарÑкиФедерациинеÑколькоÑообщениеÑообщениÑпрограммыОтправитьбеÑплатноматериалыпозволÑетпоÑледниеразличныхпродукциипрограммаполноÑтьюнаходитÑÑизбранноенаÑелениÑизменениÑкатегорииÐлекÑандрदà¥à¤µà¤¾à¤°à¤¾à¤®à¥ˆà¤¨à¥à¤…लपà¥à¤°à¤¦à¤¾à¤¨à¤­à¤¾à¤°à¤¤à¥€à¤¯à¤…नà¥à¤¦à¥‡à¤¶à¤¹à¤¿à¤¨à¥à¤¦à¥€à¤‡à¤‚डियादिलà¥à¤²à¥€à¤…धिकारवीडियोचिटà¥à¤ à¥‡à¤¸à¤®à¤¾à¤šà¤¾à¤°à¤œà¤‚कà¥à¤¶à¤¨à¤¦à¥à¤¨à¤¿à¤¯à¤¾à¤ªà¥à¤°à¤¯à¥‹à¤—अनà¥à¤¸à¤¾à¤°à¤‘नलाइनपारà¥à¤Ÿà¥€à¤¶à¤°à¥à¤¤à¥‹à¤‚लोकसभाफ़à¥à¤²à¥ˆà¤¶à¤¶à¤°à¥à¤¤à¥‡à¤‚पà¥à¤°à¤¦à¥‡à¤¶à¤ªà¥à¤²à¥‡à¤¯à¤°à¤•à¥‡à¤‚दà¥à¤°à¤¸à¥à¤¥à¤¿à¤¤à¤¿à¤‰à¤¤à¥à¤ªà¤¾à¤¦à¤‰à¤¨à¥à¤¹à¥‡à¤‚चिटà¥à¤ à¤¾à¤¯à¤¾à¤¤à¥à¤°à¤¾à¤œà¥à¤¯à¤¾à¤¦à¤¾à¤ªà¥à¤°à¤¾à¤¨à¥‡à¤œà¥‹à¤¡à¤¼à¥‡à¤‚अनà¥à¤µà¤¾à¤¦à¤¶à¥à¤°à¥‡à¤£à¥€à¤¶à¤¿à¤•à¥à¤·à¤¾à¤¸à¤°à¤•à¤¾à¤°à¥€à¤¸à¤‚गà¥à¤°à¤¹à¤ªà¤°à¤¿à¤£à¤¾à¤®à¤¬à¥à¤°à¤¾à¤‚डबचà¥à¤šà¥‹à¤‚उपलबà¥à¤§à¤®à¤‚तà¥à¤°à¥€à¤¸à¤‚परà¥à¤•à¤‰à¤®à¥à¤®à¥€à¤¦à¤®à¤¾à¤§à¥à¤¯à¤®à¤¸à¤¹à¤¾à¤¯à¤¤à¤¾à¤¶à¤¬à¥à¤¦à¥‹à¤‚मीडियाआईपीà¤à¤²à¤®à¥‹à¤¬à¤¾à¤‡à¤²à¤¸à¤‚खà¥à¤¯à¤¾à¤†à¤ªà¤°à¥‡à¤¶à¤¨à¤…नà¥à¤¬à¤‚धबाज़ारनवीनतमपà¥à¤°à¤®à¥à¤–पà¥à¤°à¤¶à¥à¤¨à¤ªà¤°à¤¿à¤µà¤¾à¤°à¤¨à¥à¤•à¤¸à¤¾à¤¨à¤¸à¤®à¤°à¥à¤¥à¤¨à¤†à¤¯à¥‹à¤œà¤¿à¤¤à¤¸à¥‹à¤®à¤µà¤¾à¤°Ø§Ù„مشاركاتالمنتدياتالكمبيوترالمشاهداتعددالزوارعددالردودالإسلاميةالÙوتوشوبالمسابقاتالمعلوماتالمسلسلاتالجراÙيكسالاسلاميةالاتصالاتkeywords" content="w3.org/1999/xhtml"><a target="_blank" text/html; charset=" target="_blank"><table cellpadding="autocomplete="off" text-align: center;to last version by background-color: #" href="http://www./div></div><div id=<a href="#" class=""><img src="http://cript" src="http://
+<script language="//EN" "http://www.wencodeURIComponent(" href="javascript:<div class="contentdocument.write('<scposition: absolute;script src="http:// style="margin-top:.min.js"></script>
+</div>
+<div class="w3.org/1999/xhtml"
+
+</body>
+</html>distinction between/" target="_blank"><link href="http://encoding="utf-8"?>
+w.addEventListener?action="http://www.icon" href="http:// style="background:type="text/css" />
+meta property="og:t<input type="text" style="text-align:the development of tylesheet" type="tehtml; charset=utf-8is considered to betable width="100%" In addition to the contributed to the differences betweendevelopment of the It is important to </script>
+
+<script style="font-size:1></span><span id=gbLibrary of Congress<img src="http://imEnglish translationAcademy of Sciencesdiv style="display:construction of the.getElementById(id)in conjunction withElement('script'); <meta property="og:БългарÑки
+ type="text" name=">Privacy Policy</a>administered by theenableSingleRequeststyle=&quot;margin:</div></div></div><><img src="http://i style=&quot;float:referred to as the total population ofin Washington, D.C. style="background-among other things,organization of theparticipated in thethe introduction ofidentified with thefictional character Oxford University misunderstanding ofThere are, however,stylesheet" href="/Columbia Universityexpanded to includeusually referred toindicating that thehave suggested thataffiliated with thecorrelation betweennumber of different></td></tr></table>Republic of Ireland
+</script>
+<script under the influencecontribution to theOfficial website ofheadquarters of thecentered around theimplications of thehave been developedFederal Republic ofbecame increasinglycontinuation of theNote, however, thatsimilar to that of capabilities of theaccordance with theparticipants in thefurther developmentunder the directionis often consideredhis younger brother</td></tr></table><a http-equiv="X-UA-physical propertiesof British Columbiahas been criticized(with the exceptionquestions about thepassing through the0" cellpadding="0" thousands of peopleredirects here. Forhave children under%3E%3C/script%3E"));<a href="http://www.<li><a href="http://site_name" content="text-decoration:nonestyle="display: none<meta http-equiv="X-new Date().getTime() type="image/x-icon"</span><span class="language="javascriptwindow.location.href<a href="javascript:-->
+<script type="t<a href='http://www.hortcut icon" href="</div>
+<div class="<script src="http://" rel="stylesheet" t</div>
+<script type=/a> <a href="http:// allowTransparency="X-UA-Compatible" conrelationship between
+</script>
+<script </a></li></ul></div>associated with the programming language</a><a href="http://</a></li><li class="form action="http://<div style="display:type="text" name="q"<table width="100%" background-position:" border="0" width="rel="shortcut icon" h6><ul><li><a href=" <meta http-equiv="css" media="screen" responsible for the " type="application/" style="background-html; charset=utf-8" allowtransparency="stylesheet" type="te
+<meta http-equiv="></span><span class="0" cellspacing="0">;
+</script>
+<script sometimes called thedoes not necessarilyFor more informationat the beginning of <!DOCTYPE html><htmlparticularly in the type="hidden" name="javascript:void(0);"effectiveness of the autocomplete="off" generally considered><input type="text" "></script>
+<scriptthroughout the worldcommon misconceptionassociation with the</div>
+</div>
+<div cduring his lifetime,corresponding to thetype="image/x-icon" an increasing numberdiplomatic relationsare often consideredmeta charset="utf-8" <input type="text" examples include the"><img src="http://iparticipation in thethe establishment of
+</div>
+<div class="&amp;nbsp;&amp;nbsp;to determine whetherquite different frommarked the beginningdistance between thecontributions to theconflict between thewidely considered towas one of the firstwith varying degreeshave speculated that(document.getElementparticipating in theoriginally developedeta charset="utf-8"> type="text/css" />
+interchangeably withmore closely relatedsocial and politicalthat would otherwiseperpendicular to thestyle type="text/csstype="submit" name="families residing indeveloping countriescomputer programmingeconomic developmentdetermination of thefor more informationon several occasionsportuguês (Europeu)УкраїнÑькаукраїнÑькаРоÑÑийÑкойматериаловинформацииуправлениÑнеобходимоинформациÑИнформациÑРеÑпубликиколичеÑтвоинформациютерриториидоÑтаточноالمتواجدونالاشتراكاتالاقتراحاتhtml; charset=UTF-8" setTimeout(function()display:inline-block;<input type="submit" type = 'text/javascri<img src="http://www." "http://www.w3.org/shortcut icon" href="" autocomplete="off" </a></div><div class=</a></li>
+<li class="css" type="text/css" <form action="http://xt/css" href="http://link rel="alternate"
+<script type="text/ onclick="javascript:(new Date).getTime()}height="1" width="1" People's Republic of <a href="http://www.text-decoration:underthe beginning of the </div>
+</div>
+</div>
+establishment of the </div></div></div></d#viewport{min-height:
+<script src="http://option><option value=often referred to as /option>
+<option valu<!DOCTYPE html>
+<!--[International Airport>
+<a href="http://www</a><a href="http://wภาษาไทยქáƒáƒ áƒ—ული正體中文 (ç¹é«”)निरà¥à¤¦à¥‡à¤¶à¤¡à¤¾à¤‰à¤¨à¤²à¥‹à¤¡à¤•à¥à¤·à¥‡à¤¤à¥à¤°à¤œà¤¾à¤¨à¤•à¤¾à¤°à¥€à¤¸à¤‚बंधितसà¥à¤¥à¤¾à¤ªà¤¨à¤¾à¤¸à¥à¤µà¥€à¤•à¤¾à¤°à¤¸à¤‚सà¥à¤•à¤°à¤£à¤¸à¤¾à¤®à¤—à¥à¤°à¥€à¤šà¤¿à¤Ÿà¥à¤ à¥‹à¤‚विजà¥à¤žà¤¾à¤¨à¤…मेरिकाविभिनà¥à¤¨à¤—ाडियाà¤à¤•à¥à¤¯à¥‹à¤‚किसà¥à¤°à¤•à¥à¤·à¤¾à¤ªà¤¹à¥à¤à¤šà¤¤à¥€à¤ªà¥à¤°à¤¬à¤‚धनटिपà¥à¤ªà¤£à¥€à¤•à¥à¤°à¤¿à¤•à¥‡à¤Ÿà¤ªà¥à¤°à¤¾à¤°à¤‚भपà¥à¤°à¤¾à¤ªà¥à¤¤à¤®à¤¾à¤²à¤¿à¤•à¥‹à¤‚रफ़à¥à¤¤à¤¾à¤°à¤¨à¤¿à¤°à¥à¤®à¤¾à¤£à¤²à¤¿à¤®à¤¿à¤Ÿà¥‡à¤¡description" content="document.location.prot.getElementsByTagName(<!DOCTYPE html>
+<html <meta charset="utf-8">:url" content="http://.css" rel="stylesheet"style type="text/css">type="text/css" href="w3.org/1999/xhtml" xmltype="text/javascript" method="get" action="link rel="stylesheet" = document.getElementtype="image/x-icon" />cellpadding="0" cellsp.css" type="text/css" </a></li><li><a href="" width="1" height="1""><a href="http://www.style="display:none;">alternate" type="appli-//W3C//DTD XHTML 1.0 ellspacing="0" cellpad type="hidden" value="/a>&nbsp;<span role="s
+<input type="hidden" language="JavaScript" document.getElementsBg="0" cellspacing="0" ype="text/css" media="type='text/javascript'with the exception of ype="text/css" rel="st height="1" width="1" ='+encodeURIComponent(<link rel="alternate"
+body, tr, input, textmeta name="robots" conmethod="post" action=">
+<a href="http://www.css" rel="stylesheet" </div></div><div classlanguage="javascript">aria-hidden="true">·<ript" type="text/javasl=0;})();
+(function(){background-image: url(/a></li><li><a href="h <li><a href="http://ator" aria-hidden="tru> <a href="http://www.language="javascript" /option>
+<option value/div></div><div class=rator" aria-hidden="tre=(new Date).getTime()português (do Brasil)организациивозможноÑтьобразованиÑрегиÑтрациивозможноÑтиобÑзательна<!DOCTYPE html PUBLIC "nt-Type" content="text/<meta http-equiv="Conteransitional//EN" "http:<html xmlns="http://www-//W3C//DTD XHTML 1.0 TDTD/xhtml1-transitional//www.w3.org/TR/xhtml1/pe = 'text/javascript';<meta name="descriptionparentNode.insertBefore<input type="hidden" najs" type="text/javascri(document).ready(functiscript type="text/javasimage" content="http://UA-Compatible" content=tml; charset=utf-8" />
+link rel="shortcut icon<link rel="stylesheet" </script>
+<script type== document.createElemen<a target="_blank" href= document.getElementsBinput type="text" name=a.type = 'text/javascrinput type="hidden" namehtml; charset=utf-8" />dtd">
+<html xmlns="http-//W3C//DTD HTML 4.01 TentsByTagName('script')input type="hidden" nam<script type="text/javas" style="display:none;">document.getElementById(=document.createElement(' type='text/javascript'input type="text" name="d.getElementsByTagName(snical" href="http://www.C//DTD HTML 4.01 Transit<style type="text/css">
+
+<style type="text/css">ional.dtd">
+<html xmlns=http-equiv="Content-Typeding="0" cellspacing="0"html; charset=utf-8" />
+ style="display:none;"><<li><a href="http://www. type='text/javascript'>деÑтельноÑтиÑоответÑтвиипроизводÑтвабезопаÑноÑтиपà¥à¤¸à¥à¤¤à¤¿à¤•à¤¾à¤•à¤¾à¤‚गà¥à¤°à¥‡à¤¸à¤‰à¤¨à¥à¤¹à¥‹à¤‚नेविधानसभाफिकà¥à¤¸à¤¿à¤‚गसà¥à¤°à¤•à¥à¤·à¤¿à¤¤à¤•à¥‰à¤ªà¥€à¤°à¤¾à¤‡à¤Ÿà¤µà¤¿à¤œà¥à¤žà¤¾à¤ªà¤¨à¤•à¤¾à¤°à¥à¤°à¤µà¤¾à¤ˆà¤¸à¤•à¥à¤°à¤¿à¤¯à¤¤à¤¾ \ No newline at end of file
diff --git a/Source/ThirdParty/brotli/common/dictionary.c b/Source/ThirdParty/brotli/common/dictionary.c
new file mode 100644
index 000000000..d0872bdd8
--- /dev/null
+++ b/Source/ThirdParty/brotli/common/dictionary.c
@@ -0,0 +1,5905 @@
+/* Copyright 2013 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+#include "./dictionary.h"
+
+#if defined(__cplusplus) || defined(c_plusplus)
+extern "C" {
+#endif
+
+#ifndef BROTLI_EXTERNAL_DICTIONARY_DATA
+static const uint8_t kBrotliDictionaryData[] =
+{
+116,105,109,101,100,111,119,110,108,105,102,101,108,101,102,116,98,97,99,107,99,
+111,100,101,100,97,116,97,115,104,111,119,111,110,108,121,115,105,116,101,99,105
+,116,121,111,112,101,110,106,117,115,116,108,105,107,101,102,114,101,101,119,111
+,114,107,116,101,120,116,121,101,97,114,111,118,101,114,98,111,100,121,108,111,
+118,101,102,111,114,109,98,111,111,107,112,108,97,121,108,105,118,101,108,105,
+110,101,104,101,108,112,104,111,109,101,115,105,100,101,109,111,114,101,119,111,
+114,100,108,111,110,103,116,104,101,109,118,105,101,119,102,105,110,100,112,97,
+103,101,100,97,121,115,102,117,108,108,104,101,97,100,116,101,114,109,101,97,99,
+104,97,114,101,97,102,114,111,109,116,114,117,101,109,97,114,107,97,98,108,101,
+117,112,111,110,104,105,103,104,100,97,116,101,108,97,110,100,110,101,119,115,
+101,118,101,110,110,101,120,116,99,97,115,101,98,111,116,104,112,111,115,116,117
+,115,101,100,109,97,100,101,104,97,110,100,104,101,114,101,119,104,97,116,110,97
+,109,101,76,105,110,107,98,108,111,103,115,105,122,101,98,97,115,101,104,101,108
+,100,109,97,107,101,109,97,105,110,117,115,101,114,39,41,32,43,104,111,108,100,
+101,110,100,115,119,105,116,104,78,101,119,115,114,101,97,100,119,101,114,101,
+115,105,103,110,116,97,107,101,104,97,118,101,103,97,109,101,115,101,101,110,99,
+97,108,108,112,97,116,104,119,101,108,108,112,108,117,115,109,101,110,117,102,
+105,108,109,112,97,114,116,106,111,105,110,116,104,105,115,108,105,115,116,103,
+111,111,100,110,101,101,100,119,97,121,115,119,101,115,116,106,111,98,115,109,
+105,110,100,97,108,115,111,108,111,103,111,114,105,99,104,117,115,101,115,108,97
+,115,116,116,101,97,109,97,114,109,121,102,111,111,100,107,105,110,103,119,105,
+108,108,101,97,115,116,119,97,114,100,98,101,115,116,102,105,114,101,80,97,103,
+101,107,110,111,119,97,119,97,121,46,112,110,103,109,111,118,101,116,104,97,110,
+108,111,97,100,103,105,118,101,115,101,108,102,110,111,116,101,109,117,99,104,
+102,101,101,100,109,97,110,121,114,111,99,107,105,99,111,110,111,110,99,101,108,
+111,111,107,104,105,100,101,100,105,101,100,72,111,109,101,114,117,108,101,104,
+111,115,116,97,106,97,120,105,110,102,111,99,108,117,98,108,97,119,115,108,101,
+115,115,104,97,108,102,115,111,109,101,115,117,99,104,122,111,110,101,49,48,48,
+37,111,110,101,115,99,97,114,101,84,105,109,101,114,97,99,101,98,108,117,101,102
+,111,117,114,119,101,101,107,102,97,99,101,104,111,112,101,103,97,118,101,104,97
+,114,100,108,111,115,116,119,104,101,110,112,97,114,107,107,101,112,116,112,97,
+115,115,115,104,105,112,114,111,111,109,72,84,77,76,112,108,97,110,84,121,112,
+101,100,111,110,101,115,97,118,101,107,101,101,112,102,108,97,103,108,105,110,
+107,115,111,108,100,102,105,118,101,116,111,111,107,114,97,116,101,116,111,119,
+110,106,117,109,112,116,104,117,115,100,97,114,107,99,97,114,100,102,105,108,101
+,102,101,97,114,115,116,97,121,107,105,108,108,116,104,97,116,102,97,108,108,97,
+117,116,111,101,118,101,114,46,99,111,109,116,97,108,107,115,104,111,112,118,111
+,116,101,100,101,101,112,109,111,100,101,114,101,115,116,116,117,114,110,98,111,
+114,110,98,97,110,100,102,101,108,108,114,111,115,101,117,114,108,40,115,107,105
+,110,114,111,108,101,99,111,109,101,97,99,116,115,97,103,101,115,109,101,101,116
+,103,111,108,100,46,106,112,103,105,116,101,109,118,97,114,121,102,101,108,116,
+116,104,101,110,115,101,110,100,100,114,111,112,86,105,101,119,99,111,112,121,49
+,46,48,34,60,47,97,62,115,116,111,112,101,108,115,101,108,105,101,115,116,111,
+117,114,112,97,99,107,46,103,105,102,112,97,115,116,99,115,115,63,103,114,97,121
+,109,101,97,110,38,103,116,59,114,105,100,101,115,104,111,116,108,97,116,101,115
+,97,105,100,114,111,97,100,118,97,114,32,102,101,101,108,106,111,104,110,114,105
+,99,107,112,111,114,116,102,97,115,116,39,85,65,45,100,101,97,100,60,47,98,62,
+112,111,111,114,98,105,108,108,116,121,112,101,85,46,83,46,119,111,111,100,109,
+117,115,116,50,112,120,59,73,110,102,111,114,97,110,107,119,105,100,101,119,97,
+110,116,119,97,108,108,108,101,97,100,91,48,93,59,112,97,117,108,119,97,118,101,
+115,117,114,101,36,40,39,35,119,97,105,116,109,97,115,115,97,114,109,115,103,111
+,101,115,103,97,105,110,108,97,110,103,112,97,105,100,33,45,45,32,108,111,99,107
+,117,110,105,116,114,111,111,116,119,97,108,107,102,105,114,109,119,105,102,101,
+120,109,108,34,115,111,110,103,116,101,115,116,50,48,112,120,107,105,110,100,114
+,111,119,115,116,111,111,108,102,111,110,116,109,97,105,108,115,97,102,101,115,
+116,97,114,109,97,112,115,99,111,114,101,114,97,105,110,102,108,111,119,98,97,98
+,121,115,112,97,110,115,97,121,115,52,112,120,59,54,112,120,59,97,114,116,115,
+102,111,111,116,114,101,97,108,119,105,107,105,104,101,97,116,115,116,101,112,
+116,114,105,112,111,114,103,47,108,97,107,101,119,101,97,107,116,111,108,100,70,
+111,114,109,99,97,115,116,102,97,110,115,98,97,110,107,118,101,114,121,114,117,
+110,115,106,117,108,121,116,97,115,107,49,112,120,59,103,111,97,108,103,114,101,
+119,115,108,111,119,101,100,103,101,105,100,61,34,115,101,116,115,53,112,120,59,
+46,106,115,63,52,48,112,120,105,102,32,40,115,111,111,110,115,101,97,116,110,111
+,110,101,116,117,98,101,122,101,114,111,115,101,110,116,114,101,101,100,102,97,
+99,116,105,110,116,111,103,105,102,116,104,97,114,109,49,56,112,120,99,97,109,
+101,104,105,108,108,98,111,108,100,122,111,111,109,118,111,105,100,101,97,115,
+121,114,105,110,103,102,105,108,108,112,101,97,107,105,110,105,116,99,111,115,
+116,51,112,120,59,106,97,99,107,116,97,103,115,98,105,116,115,114,111,108,108,
+101,100,105,116,107,110,101,119,110,101,97,114,60,33,45,45,103,114,111,119,74,83
+,79,78,100,117,116,121,78,97,109,101,115,97,108,101,121,111,117,32,108,111,116,
+115,112,97,105,110,106,97,122,122,99,111,108,100,101,121,101,115,102,105,115,104
+,119,119,119,46,114,105,115,107,116,97,98,115,112,114,101,118,49,48,112,120,114,
+105,115,101,50,53,112,120,66,108,117,101,100,105,110,103,51,48,48,44,98,97,108,
+108,102,111,114,100,101,97,114,110,119,105,108,100,98,111,120,46,102,97,105,114,
+108,97,99,107,118,101,114,115,112,97,105,114,106,117,110,101,116,101,99,104,105,
+102,40,33,112,105,99,107,101,118,105,108,36,40,34,35,119,97,114,109,108,111,114,
+100,100,111,101,115,112,117,108,108,44,48,48,48,105,100,101,97,100,114,97,119,
+104,117,103,101,115,112,111,116,102,117,110,100,98,117,114,110,104,114,101,102,
+99,101,108,108,107,101,121,115,116,105,99,107,104,111,117,114,108,111,115,115,
+102,117,101,108,49,50,112,120,115,117,105,116,100,101,97,108,82,83,83,34,97,103,
+101,100,103,114,101,121,71,69,84,34,101,97,115,101,97,105,109,115,103,105,114,
+108,97,105,100,115,56,112,120,59,110,97,118,121,103,114,105,100,116,105,112,115,
+35,57,57,57,119,97,114,115,108,97,100,121,99,97,114,115,41,59,32,125,112,104,112
+,63,104,101,108,108,116,97,108,108,119,104,111,109,122,104,58,229,42,47,13,10,32
+,49,48,48,104,97,108,108,46,10,10,65,55,112,120,59,112,117,115,104,99,104,97,116
+,48,112,120,59,99,114,101,119,42,47,60,47,104,97,115,104,55,53,112,120,102,108,
+97,116,114,97,114,101,32,38,38,32,116,101,108,108,99,97,109,112,111,110,116,111,
+108,97,105,100,109,105,115,115,115,107,105,112,116,101,110,116,102,105,110,101,
+109,97,108,101,103,101,116,115,112,108,111,116,52,48,48,44,13,10,13,10,99,111,
+111,108,102,101,101,116,46,112,104,112,60,98,114,62,101,114,105,99,109,111,115,
+116,103,117,105,100,98,101,108,108,100,101,115,99,104,97,105,114,109,97,116,104,
+97,116,111,109,47,105,109,103,38,35,56,50,108,117,99,107,99,101,110,116,48,48,48
+,59,116,105,110,121,103,111,110,101,104,116,109,108,115,101,108,108,100,114,117,
+103,70,82,69,69,110,111,100,101,110,105,99,107,63,105,100,61,108,111,115,101,110
+,117,108,108,118,97,115,116,119,105,110,100,82,83,83,32,119,101,97,114,114,101,
+108,121,98,101,101,110,115,97,109,101,100,117,107,101,110,97,115,97,99,97,112,
+101,119,105,115,104,103,117,108,102,84,50,51,58,104,105,116,115,115,108,111,116,
+103,97,116,101,107,105,99,107,98,108,117,114,116,104,101,121,49,53,112,120,39,39
+,41,59,41,59,34,62,109,115,105,101,119,105,110,115,98,105,114,100,115,111,114,
+116,98,101,116,97,115,101,101,107,84,49,56,58,111,114,100,115,116,114,101,101,
+109,97,108,108,54,48,112,120,102,97,114,109,226,128,153,115,98,111,121,115,91,48
+,93,46,39,41,59,34,80,79,83,84,98,101,97,114,107,105,100,115,41,59,125,125,109,
+97,114,121,116,101,110,100,40,85,75,41,113,117,97,100,122,104,58,230,45,115,105,
+122,45,45,45,45,112,114,111,112,39,41,59,13,108,105,102,116,84,49,57,58,118,105,
+99,101,97,110,100,121,100,101,98,116,62,82,83,83,112,111,111,108,110,101,99,107,
+98,108,111,119,84,49,54,58,100,111,111,114,101,118,97,108,84,49,55,58,108,101,
+116,115,102,97,105,108,111,114,97,108,112,111,108,108,110,111,118,97,99,111,108,
+115,103,101,110,101,32,226,128,148,115,111,102,116,114,111,109,101,116,105,108,
+108,114,111,115,115,60,104,51,62,112,111,117,114,102,97,100,101,112,105,110,107,
+60,116,114,62,109,105,110,105,41,124,33,40,109,105,110,101,122,104,58,232,98,97,
+114,115,104,101,97,114,48,48,41,59,109,105,108,107,32,45,45,62,105,114,111,110,
+102,114,101,100,100,105,115,107,119,101,110,116,115,111,105,108,112,117,116,115,
+47,106,115,47,104,111,108,121,84,50,50,58,73,83,66,78,84,50,48,58,97,100,97,109,
+115,101,101,115,60,104,50,62,106,115,111,110,39,44,32,39,99,111,110,116,84,50,49
+,58,32,82,83,83,108,111,111,112,97,115,105,97,109,111,111,110,60,47,112,62,115,
+111,117,108,76,73,78,69,102,111,114,116,99,97,114,116,84,49,52,58,60,104,49,62,
+56,48,112,120,33,45,45,60,57,112,120,59,84,48,52,58,109,105,107,101,58,52,54,90,
+110,105,99,101,105,110,99,104,89,111,114,107,114,105,99,101,122,104,58,228,39,41
+,41,59,112,117,114,101,109,97,103,101,112,97,114,97,116,111,110,101,98,111,110,
+100,58,51,55,90,95,111,102,95,39,93,41,59,48,48,48,44,122,104,58,231,116,97,110,
+107,121,97,114,100,98,111,119,108,98,117,115,104,58,53,54,90,74,97,118,97,51,48,
+112,120,10,124,125,10,37,67,51,37,58,51,52,90,106,101,102,102,69,88,80,73,99,97,
+115,104,118,105,115,97,103,111,108,102,115,110,111,119,122,104,58,233,113,117,
+101,114,46,99,115,115,115,105,99,107,109,101,97,116,109,105,110,46,98,105,110,
+100,100,101,108,108,104,105,114,101,112,105,99,115,114,101,110,116,58,51,54,90,
+72,84,84,80,45,50,48,49,102,111,116,111,119,111,108,102,69,78,68,32,120,98,111,
+120,58,53,52,90,66,79,68,89,100,105,99,107,59,10,125,10,101,120,105,116,58,51,53
+,90,118,97,114,115,98,101,97,116,39,125,41,59,100,105,101,116,57,57,57,59,97,110
+,110,101,125,125,60,47,91,105,93,46,76,97,110,103,107,109,194,178,119,105,114,
+101,116,111,121,115,97,100,100,115,115,101,97,108,97,108,101,120,59,10,9,125,101
+,99,104,111,110,105,110,101,46,111,114,103,48,48,53,41,116,111,110,121,106,101,
+119,115,115,97,110,100,108,101,103,115,114,111,111,102,48,48,48,41,32,50,48,48,
+119,105,110,101,103,101,97,114,100,111,103,115,98,111,111,116,103,97,114,121,99,
+117,116,115,116,121,108,101,116,101,109,112,116,105,111,110,46,120,109,108,99,
+111,99,107,103,97,110,103,36,40,39,46,53,48,112,120,80,104,46,68,109,105,115,99,
+97,108,97,110,108,111,97,110,100,101,115,107,109,105,108,101,114,121,97,110,117,
+110,105,120,100,105,115,99,41,59,125,10,100,117,115,116,99,108,105,112,41,46,10,
+10,55,48,112,120,45,50,48,48,68,86,68,115,55,93,62,60,116,97,112,101,100,101,109
+,111,105,43,43,41,119,97,103,101,101,117,114,111,112,104,105,108,111,112,116,115
+,104,111,108,101,70,65,81,115,97,115,105,110,45,50,54,84,108,97,98,115,112,101,
+116,115,85,82,76,32,98,117,108,107,99,111,111,107,59,125,13,10,72,69,65,68,91,48
+,93,41,97,98,98,114,106,117,97,110,40,49,57,56,108,101,115,104,116,119,105,110,
+60,47,105,62,115,111,110,121,103,117,121,115,102,117,99,107,112,105,112,101,124,
+45,10,33,48,48,50,41,110,100,111,119,91,49,93,59,91,93,59,10,76,111,103,32,115,
+97,108,116,13,10,9,9,98,97,110,103,116,114,105,109,98,97,116,104,41,123,13,10,48
+,48,112,120,10,125,41,59,107,111,58,236,102,101,101,115,97,100,62,13,115,58,47,
+47,32,91,93,59,116,111,108,108,112,108,117,103,40,41,123,10,123,13,10,32,46,106,
+115,39,50,48,48,112,100,117,97,108,98,111,97,116,46,74,80,71,41,59,10,125,113,
+117,111,116,41,59,10,10,39,41,59,10,13,10,125,13,50,48,49,52,50,48,49,53,50,48,
+49,54,50,48,49,55,50,48,49,56,50,48,49,57,50,48,50,48,50,48,50,49,50,48,50,50,50
+,48,50,51,50,48,50,52,50,48,50,53,50,48,50,54,50,48,50,55,50,48,50,56,50,48,50,
+57,50,48,51,48,50,48,51,49,50,48,51,50,50,48,51,51,50,48,51,52,50,48,51,53,50,48
+,51,54,50,48,51,55,50,48,49,51,50,48,49,50,50,48,49,49,50,48,49,48,50,48,48,57,
+50,48,48,56,50,48,48,55,50,48,48,54,50,48,48,53,50,48,48,52,50,48,48,51,50,48,48
+,50,50,48,48,49,50,48,48,48,49,57,57,57,49,57,57,56,49,57,57,55,49,57,57,54,49,
+57,57,53,49,57,57,52,49,57,57,51,49,57,57,50,49,57,57,49,49,57,57,48,49,57,56,57
+,49,57,56,56,49,57,56,55,49,57,56,54,49,57,56,53,49,57,56,52,49,57,56,51,49,57,
+56,50,49,57,56,49,49,57,56,48,49,57,55,57,49,57,55,56,49,57,55,55,49,57,55,54,49
+,57,55,53,49,57,55,52,49,57,55,51,49,57,55,50,49,57,55,49,49,57,55,48,49,57,54,
+57,49,57,54,56,49,57,54,55,49,57,54,54,49,57,54,53,49,57,54,52,49,57,54,51,49,57
+,54,50,49,57,54,49,49,57,54,48,49,57,53,57,49,57,53,56,49,57,53,55,49,57,53,54,
+49,57,53,53,49,57,53,52,49,57,53,51,49,57,53,50,49,57,53,49,49,57,53,48,49,48,48
+,48,49,48,50,52,49,51,57,52,48,48,48,48,57,57,57,57,99,111,109,111,109,195,161,
+115,101,115,116,101,101,115,116,97,112,101,114,111,116,111,100,111,104,97,99,101
+,99,97,100,97,97,195,177,111,98,105,101,110,100,195,173,97,97,115,195,173,118,
+105,100,97,99,97,115,111,111,116,114,111,102,111,114,111,115,111,108,111,111,116
+,114,97,99,117,97,108,100,105,106,111,115,105,100,111,103,114,97,110,116,105,112
+,111,116,101,109,97,100,101,98,101,97,108,103,111,113,117,195,169,101,115,116,
+111,110,97,100,97,116,114,101,115,112,111,99,111,99,97,115,97,98,97,106,111,116,
+111,100,97,115,105,110,111,97,103,117,97,112,117,101,115,117,110,111,115,97,110,
+116,101,100,105,99,101,108,117,105,115,101,108,108,97,109,97,121,111,122,111,110
+,97,97,109,111,114,112,105,115,111,111,98,114,97,99,108,105,99,101,108,108,111,
+100,105,111,115,104,111,114,97,99,97,115,105,208,183,208,176,208,189,208,176,208
+,190,208,188,209,128,208,176,209,128,209,131,209,130,208,176,208,189,208,181,208
+,191,208,190,208,190,209,130,208,184,208,183,208,189,208,190,208,180,208,190,209
+,130,208,190,208,182,208,181,208,190,208,189,208,184,209,133,208,157,208,176,208
+,181,208,181,208,177,209,139,208,188,209,139,208,146,209,139,209,129,208,190,208
+,178,209,139,208,178,208,190,208,157,208,190,208,190,208,177,208,159,208,190,208
+,187,208,184,208,189,208,184,208,160,208,164,208,157,208,181,208,156,209,139,209
+,130,209,139,208,158,208,189,208,184,208,188,208,180,208,176,208,151,208,176,208
+,148,208,176,208,157,209,131,208,158,208,177,209,130,208,181,208,152,208,183,208
+,181,208,185,208,189,209,131,208,188,208,188,208,162,209,139,209,131,208,182,217
+,129,217,138,216,163,217,134,217,133,216,167,217,133,216,185,217,131,217,132,216
+,163,217,136,216,177,216,175,217,138,216,167,217,129,217,137,217,135,217,136,217
+,132,217,133,217,132,217,131,216,167,217,136,217,132,217,135,216,168,216,179,216
+,167,217,132,216,165,217,134,217,135,217,138,216,163,217,138,217,130,216,175,217
+,135,217,132,216,171,217,133,216,168,217,135,217,132,217,136,217,132,217,138,216
+,168,217,132,216,167,217,138,216,168,217,131,216,180,217,138,216,167,217,133,216
+,163,217,133,217,134,216,170,216,168,217,138,217,132,217,134,216,173,216,168,217
+,135,217,133,217,133,216,180,217,136,216,180,102,105,114,115,116,118,105,100,101
+,111,108,105,103,104,116,119,111,114,108,100,109,101,100,105,97,119,104,105,116,
+101,99,108,111,115,101,98,108,97,99,107,114,105,103,104,116,115,109,97,108,108,
+98,111,111,107,115,112,108,97,99,101,109,117,115,105,99,102,105,101,108,100,111,
+114,100,101,114,112,111,105,110,116,118,97,108,117,101,108,101,118,101,108,116,
+97,98,108,101,98,111,97,114,100,104,111,117,115,101,103,114,111,117,112,119,111,
+114,107,115,121,101,97,114,115,115,116,97,116,101,116,111,100,97,121,119,97,116,
+101,114,115,116,97,114,116,115,116,121,108,101,100,101,97,116,104,112,111,119,
+101,114,112,104,111,110,101,110,105,103,104,116,101,114,114,111,114,105,110,112,
+117,116,97,98,111,117,116,116,101,114,109,115,116,105,116,108,101,116,111,111,
+108,115,101,118,101,110,116,108,111,99,97,108,116,105,109,101,115,108,97,114,103
+,101,119,111,114,100,115,103,97,109,101,115,115,104,111,114,116,115,112,97,99,
+101,102,111,99,117,115,99,108,101,97,114,109,111,100,101,108,98,108,111,99,107,
+103,117,105,100,101,114,97,100,105,111,115,104,97,114,101,119,111,109,101,110,97
+,103,97,105,110,109,111,110,101,121,105,109,97,103,101,110,97,109,101,115,121,
+111,117,110,103,108,105,110,101,115,108,97,116,101,114,99,111,108,111,114,103,
+114,101,101,110,102,114,111,110,116,38,97,109,112,59,119,97,116,99,104,102,111,
+114,99,101,112,114,105,99,101,114,117,108,101,115,98,101,103,105,110,97,102,116,
+101,114,118,105,115,105,116,105,115,115,117,101,97,114,101,97,115,98,101,108,111
+,119,105,110,100,101,120,116,111,116,97,108,104,111,117,114,115,108,97,98,101,
+108,112,114,105,110,116,112,114,101,115,115,98,117,105,108,116,108,105,110,107,
+115,115,112,101,101,100,115,116,117,100,121,116,114,97,100,101,102,111,117,110,
+100,115,101,110,115,101,117,110,100,101,114,115,104,111,119,110,102,111,114,109,
+115,114,97,110,103,101,97,100,100,101,100,115,116,105,108,108,109,111,118,101,
+100,116,97,107,101,110,97,98,111,118,101,102,108,97,115,104,102,105,120,101,100,
+111,102,116,101,110,111,116,104,101,114,118,105,101,119,115,99,104,101,99,107,
+108,101,103,97,108,114,105,118,101,114,105,116,101,109,115,113,117,105,99,107,
+115,104,97,112,101,104,117,109,97,110,101,120,105,115,116,103,111,105,110,103,
+109,111,118,105,101,116,104,105,114,100,98,97,115,105,99,112,101,97,99,101,115,
+116,97,103,101,119,105,100,116,104,108,111,103,105,110,105,100,101,97,115,119,
+114,111,116,101,112,97,103,101,115,117,115,101,114,115,100,114,105,118,101,115,
+116,111,114,101,98,114,101,97,107,115,111,117,116,104,118,111,105,99,101,115,105
+,116,101,115,109,111,110,116,104,119,104,101,114,101,98,117,105,108,100,119,104,
+105,99,104,101,97,114,116,104,102,111,114,117,109,116,104,114,101,101,115,112,
+111,114,116,112,97,114,116,121,67,108,105,99,107,108,111,119,101,114,108,105,118
+,101,115,99,108,97,115,115,108,97,121,101,114,101,110,116,114,121,115,116,111,
+114,121,117,115,97,103,101,115,111,117,110,100,99,111,117,114,116,121,111,117,
+114,32,98,105,114,116,104,112,111,112,117,112,116,121,112,101,115,97,112,112,108
+,121,73,109,97,103,101,98,101,105,110,103,117,112,112,101,114,110,111,116,101,
+115,101,118,101,114,121,115,104,111,119,115,109,101,97,110,115,101,120,116,114,
+97,109,97,116,99,104,116,114,97,99,107,107,110,111,119,110,101,97,114,108,121,98
+,101,103,97,110,115,117,112,101,114,112,97,112,101,114,110,111,114,116,104,108,
+101,97,114,110,103,105,118,101,110,110,97,109,101,100,101,110,100,101,100,84,101
+,114,109,115,112,97,114,116,115,71,114,111,117,112,98,114,97,110,100,117,115,105
+,110,103,119,111,109,97,110,102,97,108,115,101,114,101,97,100,121,97,117,100,105
+,111,116,97,107,101,115,119,104,105,108,101,46,99,111,109,47,108,105,118,101,100
+,99,97,115,101,115,100,97,105,108,121,99,104,105,108,100,103,114,101,97,116,106,
+117,100,103,101,116,104,111,115,101,117,110,105,116,115,110,101,118,101,114,98,
+114,111,97,100,99,111,97,115,116,99,111,118,101,114,97,112,112,108,101,102,105,
+108,101,115,99,121,99,108,101,115,99,101,110,101,112,108,97,110,115,99,108,105,
+99,107,119,114,105,116,101,113,117,101,101,110,112,105,101,99,101,101,109,97,105
+,108,102,114,97,109,101,111,108,100,101,114,112,104,111,116,111,108,105,109,105,
+116,99,97,99,104,101,99,105,118,105,108,115,99,97,108,101,101,110,116,101,114,
+116,104,101,109,101,116,104,101,114,101,116,111,117,99,104,98,111,117,110,100,
+114,111,121,97,108,97,115,107,101,100,119,104,111,108,101,115,105,110,99,101,115
+,116,111,99,107,32,110,97,109,101,102,97,105,116,104,104,101,97,114,116,101,109,
+112,116,121,111,102,102,101,114,115,99,111,112,101,111,119,110,101,100,109,105,
+103,104,116,97,108,98,117,109,116,104,105,110,107,98,108,111,111,100,97,114,114,
+97,121,109,97,106,111,114,116,114,117,115,116,99,97,110,111,110,117,110,105,111,
+110,99,111,117,110,116,118,97,108,105,100,115,116,111,110,101,83,116,121,108,101
+,76,111,103,105,110,104,97,112,112,121,111,99,99,117,114,108,101,102,116,58,102,
+114,101,115,104,113,117,105,116,101,102,105,108,109,115,103,114,97,100,101,110,
+101,101,100,115,117,114,98,97,110,102,105,103,104,116,98,97,115,105,115,104,111,
+118,101,114,97,117,116,111,59,114,111,117,116,101,46,104,116,109,108,109,105,120
+,101,100,102,105,110,97,108,89,111,117,114,32,115,108,105,100,101,116,111,112,
+105,99,98,114,111,119,110,97,108,111,110,101,100,114,97,119,110,115,112,108,105,
+116,114,101,97,99,104,82,105,103,104,116,100,97,116,101,115,109,97,114,99,104,
+113,117,111,116,101,103,111,111,100,115,76,105,110,107,115,100,111,117,98,116,97
+,115,121,110,99,116,104,117,109,98,97,108,108,111,119,99,104,105,101,102,121,111
+,117,116,104,110,111,118,101,108,49,48,112,120,59,115,101,114,118,101,117,110,
+116,105,108,104,97,110,100,115,67,104,101,99,107,83,112,97,99,101,113,117,101,
+114,121,106,97,109,101,115,101,113,117,97,108,116,119,105,99,101,48,44,48,48,48,
+83,116,97,114,116,112,97,110,101,108,115,111,110,103,115,114,111,117,110,100,101
+,105,103,104,116,115,104,105,102,116,119,111,114,116,104,112,111,115,116,115,108
+,101,97,100,115,119,101,101,107,115,97,118,111,105,100,116,104,101,115,101,109,
+105,108,101,115,112,108,97,110,101,115,109,97,114,116,97,108,112,104,97,112,108,
+97,110,116,109,97,114,107,115,114,97,116,101,115,112,108,97,121,115,99,108,97,
+105,109,115,97,108,101,115,116,101,120,116,115,115,116,97,114,115,119,114,111,
+110,103,60,47,104,51,62,116,104,105,110,103,46,111,114,103,47,109,117,108,116,
+105,104,101,97,114,100,80,111,119,101,114,115,116,97,110,100,116,111,107,101,110
+,115,111,108,105,100,40,116,104,105,115,98,114,105,110,103,115,104,105,112,115,
+115,116,97,102,102,116,114,105,101,100,99,97,108,108,115,102,117,108,108,121,102
+,97,99,116,115,97,103,101,110,116,84,104,105,115,32,47,47,45,45,62,97,100,109,
+105,110,101,103,121,112,116,69,118,101,110,116,49,53,112,120,59,69,109,97,105,
+108,116,114,117,101,34,99,114,111,115,115,115,112,101,110,116,98,108,111,103,115
+,98,111,120,34,62,110,111,116,101,100,108,101,97,118,101,99,104,105,110,97,115,
+105,122,101,115,103,117,101,115,116,60,47,104,52,62,114,111,98,111,116,104,101,
+97,118,121,116,114,117,101,44,115,101,118,101,110,103,114,97,110,100,99,114,105,
+109,101,115,105,103,110,115,97,119,97,114,101,100,97,110,99,101,112,104,97,115,
+101,62,60,33,45,45,101,110,95,85,83,38,35,51,57,59,50,48,48,112,120,95,110,97,
+109,101,108,97,116,105,110,101,110,106,111,121,97,106,97,120,46,97,116,105,111,
+110,115,109,105,116,104,85,46,83,46,32,104,111,108,100,115,112,101,116,101,114,
+105,110,100,105,97,110,97,118,34,62,99,104,97,105,110,115,99,111,114,101,99,111,
+109,101,115,100,111,105,110,103,112,114,105,111,114,83,104,97,114,101,49,57,57,
+48,115,114,111,109,97,110,108,105,115,116,115,106,97,112,97,110,102,97,108,108,
+115,116,114,105,97,108,111,119,110,101,114,97,103,114,101,101,60,47,104,50,62,97
+,98,117,115,101,97,108,101,114,116,111,112,101,114,97,34,45,47,47,87,99,97,114,
+100,115,104,105,108,108,115,116,101,97,109,115,80,104,111,116,111,116,114,117,
+116,104,99,108,101,97,110,46,112,104,112,63,115,97,105,110,116,109,101,116,97,
+108,108,111,117,105,115,109,101,97,110,116,112,114,111,111,102,98,114,105,101,
+102,114,111,119,34,62,103,101,110,114,101,116,114,117,99,107,108,111,111,107,115
+,86,97,108,117,101,70,114,97,109,101,46,110,101,116,47,45,45,62,10,60,116,114,
+121,32,123,10,118,97,114,32,109,97,107,101,115,99,111,115,116,115,112,108,97,105
+,110,97,100,117,108,116,113,117,101,115,116,116,114,97,105,110,108,97,98,111,114
+,104,101,108,112,115,99,97,117,115,101,109,97,103,105,99,109,111,116,111,114,116
+,104,101,105,114,50,53,48,112,120,108,101,97,115,116,115,116,101,112,115,67,111,
+117,110,116,99,111,117,108,100,103,108,97,115,115,115,105,100,101,115,102,117,
+110,100,115,104,111,116,101,108,97,119,97,114,100,109,111,117,116,104,109,111,
+118,101,115,112,97,114,105,115,103,105,118,101,115,100,117,116,99,104,116,101,
+120,97,115,102,114,117,105,116,110,117,108,108,44,124,124,91,93,59,116,111,112,
+34,62,10,60,33,45,45,80,79,83,84,34,111,99,101,97,110,60,98,114,47,62,102,108,
+111,111,114,115,112,101,97,107,100,101,112,116,104,32,115,105,122,101,98,97,110,
+107,115,99,97,116,99,104,99,104,97,114,116,50,48,112,120,59,97,108,105,103,110,
+100,101,97,108,115,119,111,117,108,100,53,48,112,120,59,117,114,108,61,34,112,97
+,114,107,115,109,111,117,115,101,77,111,115,116,32,46,46,46,60,47,97,109,111,110
+,103,98,114,97,105,110,98,111,100,121,32,110,111,110,101,59,98,97,115,101,100,99
+,97,114,114,121,100,114,97,102,116,114,101,102,101,114,112,97,103,101,95,104,111
+,109,101,46,109,101,116,101,114,100,101,108,97,121,100,114,101,97,109,112,114,
+111,118,101,106,111,105,110,116,60,47,116,114,62,100,114,117,103,115,60,33,45,45
+,32,97,112,114,105,108,105,100,101,97,108,97,108,108,101,110,101,120,97,99,116,
+102,111,114,116,104,99,111,100,101,115,108,111,103,105,99,86,105,101,119,32,115,
+101,101,109,115,98,108,97,110,107,112,111,114,116,115,32,40,50,48,48,115,97,118,
+101,100,95,108,105,110,107,103,111,97,108,115,103,114,97,110,116,103,114,101,101
+,107,104,111,109,101,115,114,105,110,103,115,114,97,116,101,100,51,48,112,120,59
+,119,104,111,115,101,112,97,114,115,101,40,41,59,34,32,66,108,111,99,107,108,105
+,110,117,120,106,111,110,101,115,112,105,120,101,108,39,41,59,34,62,41,59,105,
+102,40,45,108,101,102,116,100,97,118,105,100,104,111,114,115,101,70,111,99,117,
+115,114,97,105,115,101,98,111,120,101,115,84,114,97,99,107,101,109,101,110,116,
+60,47,101,109,62,98,97,114,34,62,46,115,114,99,61,116,111,119,101,114,97,108,116
+,61,34,99,97,98,108,101,104,101,110,114,121,50,52,112,120,59,115,101,116,117,112
+,105,116,97,108,121,115,104,97,114,112,109,105,110,111,114,116,97,115,116,101,
+119,97,110,116,115,116,104,105,115,46,114,101,115,101,116,119,104,101,101,108,
+103,105,114,108,115,47,99,115,115,47,49,48,48,37,59,99,108,117,98,115,115,116,
+117,102,102,98,105,98,108,101,118,111,116,101,115,32,49,48,48,48,107,111,114,101
+,97,125,41,59,13,10,98,97,110,100,115,113,117,101,117,101,61,32,123,125,59,56,48
+,112,120,59,99,107,105,110,103,123,13,10,9,9,97,104,101,97,100,99,108,111,99,107
+,105,114,105,115,104,108,105,107,101,32,114,97,116,105,111,115,116,97,116,115,70
+,111,114,109,34,121,97,104,111,111,41,91,48,93,59,65,98,111,117,116,102,105,110,
+100,115,60,47,104,49,62,100,101,98,117,103,116,97,115,107,115,85,82,76,32,61,99,
+101,108,108,115,125,41,40,41,59,49,50,112,120,59,112,114,105,109,101,116,101,108
+,108,115,116,117,114,110,115,48,120,54,48,48,46,106,112,103,34,115,112,97,105,
+110,98,101,97,99,104,116,97,120,101,115,109,105,99,114,111,97,110,103,101,108,45
+,45,62,60,47,103,105,102,116,115,115,116,101,118,101,45,108,105,110,107,98,111,
+100,121,46,125,41,59,10,9,109,111,117,110,116,32,40,49,57,57,70,65,81,60,47,114,
+111,103,101,114,102,114,97,110,107,67,108,97,115,115,50,56,112,120,59,102,101,
+101,100,115,60,104,49,62,60,115,99,111,116,116,116,101,115,116,115,50,50,112,120
+,59,100,114,105,110,107,41,32,124,124,32,108,101,119,105,115,115,104,97,108,108,
+35,48,51,57,59,32,102,111,114,32,108,111,118,101,100,119,97,115,116,101,48,48,
+112,120,59,106,97,58,227,130,115,105,109,111,110,60,102,111,110,116,114,101,112,
+108,121,109,101,101,116,115,117,110,116,101,114,99,104,101,97,112,116,105,103,
+104,116,66,114,97,110,100,41,32,33,61,32,100,114,101,115,115,99,108,105,112,115,
+114,111,111,109,115,111,110,107,101,121,109,111,98,105,108,109,97,105,110,46,78,
+97,109,101,32,112,108,97,116,101,102,117,110,110,121,116,114,101,101,115,99,111,
+109,47,34,49,46,106,112,103,119,109,111,100,101,112,97,114,97,109,83,84,65,82,84
+,108,101,102,116,32,105,100,100,101,110,44,32,50,48,49,41,59,10,125,10,102,111,
+114,109,46,118,105,114,117,115,99,104,97,105,114,116,114,97,110,115,119,111,114,
+115,116,80,97,103,101,115,105,116,105,111,110,112,97,116,99,104,60,33,45,45,10,
+111,45,99,97,99,102,105,114,109,115,116,111,117,114,115,44,48,48,48,32,97,115,
+105,97,110,105,43,43,41,123,97,100,111,98,101,39,41,91,48,93,105,100,61,49,48,98
+,111,116,104,59,109,101,110,117,32,46,50,46,109,105,46,112,110,103,34,107,101,
+118,105,110,99,111,97,99,104,67,104,105,108,100,98,114,117,99,101,50,46,106,112,
+103,85,82,76,41,43,46,106,112,103,124,115,117,105,116,101,115,108,105,99,101,104
+,97,114,114,121,49,50,48,34,32,115,119,101,101,116,116,114,62,13,10,110,97,109,
+101,61,100,105,101,103,111,112,97,103,101,32,115,119,105,115,115,45,45,62,10,10,
+35,102,102,102,59,34,62,76,111,103,46,99,111,109,34,116,114,101,97,116,115,104,
+101,101,116,41,32,38,38,32,49,52,112,120,59,115,108,101,101,112,110,116,101,110,
+116,102,105,108,101,100,106,97,58,227,131,105,100,61,34,99,78,97,109,101,34,119,
+111,114,115,101,115,104,111,116,115,45,98,111,120,45,100,101,108,116,97,10,38,
+108,116,59,98,101,97,114,115,58,52,56,90,60,100,97,116,97,45,114,117,114,97,108,
+60,47,97,62,32,115,112,101,110,100,98,97,107,101,114,115,104,111,112,115,61,32,
+34,34,59,112,104,112,34,62,99,116,105,111,110,49,51,112,120,59,98,114,105,97,110
+,104,101,108,108,111,115,105,122,101,61,111,61,37,50,70,32,106,111,105,110,109,
+97,121,98,101,60,105,109,103,32,105,109,103,34,62,44,32,102,106,115,105,109,103,
+34,32,34,41,91,48,93,77,84,111,112,66,84,121,112,101,34,110,101,119,108,121,68,
+97,110,115,107,99,122,101,99,104,116,114,97,105,108,107,110,111,119,115,60,47,
+104,53,62,102,97,113,34,62,122,104,45,99,110,49,48,41,59,10,45,49,34,41,59,116,
+121,112,101,61,98,108,117,101,115,116,114,117,108,121,100,97,118,105,115,46,106,
+115,39,59,62,13,10,60,33,115,116,101,101,108,32,121,111,117,32,104,50,62,13,10,
+102,111,114,109,32,106,101,115,117,115,49,48,48,37,32,109,101,110,117,46,13,10,9
+,13,10,119,97,108,101,115,114,105,115,107,115,117,109,101,110,116,100,100,105,
+110,103,98,45,108,105,107,116,101,97,99,104,103,105,102,34,32,118,101,103,97,115
+,100,97,110,115,107,101,101,115,116,105,115,104,113,105,112,115,117,111,109,105,
+115,111,98,114,101,100,101,115,100,101,101,110,116,114,101,116,111,100,111,115,
+112,117,101,100,101,97,195,177,111,115,101,115,116,195,161,116,105,101,110,101,
+104,97,115,116,97,111,116,114,111,115,112,97,114,116,101,100,111,110,100,101,110
+,117,101,118,111,104,97,99,101,114,102,111,114,109,97,109,105,115,109,111,109,
+101,106,111,114,109,117,110,100,111,97,113,117,195,173,100,195,173,97,115,115,
+195,179,108,111,97,121,117,100,97,102,101,99,104,97,116,111,100,97,115,116,97,
+110,116,111,109,101,110,111,115,100,97,116,111,115,111,116,114,97,115,115,105,
+116,105,111,109,117,99,104,111,97,104,111,114,97,108,117,103,97,114,109,97,121,
+111,114,101,115,116,111,115,104,111,114,97,115,116,101,110,101,114,97,110,116,
+101,115,102,111,116,111,115,101,115,116,97,115,112,97,195,173,115,110,117,101,
+118,97,115,97,108,117,100,102,111,114,111,115,109,101,100,105,111,113,117,105,
+101,110,109,101,115,101,115,112,111,100,101,114,99,104,105,108,101,115,101,114,
+195,161,118,101,99,101,115,100,101,99,105,114,106,111,115,195,169,101,115,116,97
+,114,118,101,110,116,97,103,114,117,112,111,104,101,99,104,111,101,108,108,111,
+115,116,101,110,103,111,97,109,105,103,111,99,111,115,97,115,110,105,118,101,108
+,103,101,110,116,101,109,105,115,109,97,97,105,114,101,115,106,117,108,105,111,
+116,101,109,97,115,104,97,99,105,97,102,97,118,111,114,106,117,110,105,111,108,
+105,98,114,101,112,117,110,116,111,98,117,101,110,111,97,117,116,111,114,97,98,
+114,105,108,98,117,101,110,97,116,101,120,116,111,109,97,114,122,111,115,97,98,
+101,114,108,105,115,116,97,108,117,101,103,111,99,195,179,109,111,101,110,101,
+114,111,106,117,101,103,111,112,101,114,195,186,104,97,98,101,114,101,115,116,
+111,121,110,117,110,99,97,109,117,106,101,114,118,97,108,111,114,102,117,101,114
+,97,108,105,98,114,111,103,117,115,116,97,105,103,117,97,108,118,111,116,111,115
+,99,97,115,111,115,103,117,195,173,97,112,117,101,100,111,115,111,109,111,115,97
+,118,105,115,111,117,115,116,101,100,100,101,98,101,110,110,111,99,104,101,98,
+117,115,99,97,102,97,108,116,97,101,117,114,111,115,115,101,114,105,101,100,105,
+99,104,111,99,117,114,115,111,99,108,97,118,101,99,97,115,97,115,108,101,195,179
+,110,112,108,97,122,111,108,97,114,103,111,111,98,114,97,115,118,105,115,116,97,
+97,112,111,121,111,106,117,110,116,111,116,114,97,116,97,118,105,115,116,111,99,
+114,101,97,114,99,97,109,112,111,104,101,109,111,115,99,105,110,99,111,99,97,114
+,103,111,112,105,115,111,115,111,114,100,101,110,104,97,99,101,110,195,161,114,
+101,97,100,105,115,99,111,112,101,100,114,111,99,101,114,99,97,112,117,101,100,
+97,112,97,112,101,108,109,101,110,111,114,195,186,116,105,108,99,108,97,114,111,
+106,111,114,103,101,99,97,108,108,101,112,111,110,101,114,116,97,114,100,101,110
+,97,100,105,101,109,97,114,99,97,115,105,103,117,101,101,108,108,97,115,115,105,
+103,108,111,99,111,99,104,101,109,111,116,111,115,109,97,100,114,101,99,108,97,
+115,101,114,101,115,116,111,110,105,195,177,111,113,117,101,100,97,112,97,115,97
+,114,98,97,110,99,111,104,105,106,111,115,118,105,97,106,101,112,97,98,108,111,
+195,169,115,116,101,118,105,101,110,101,114,101,105,110,111,100,101,106,97,114,
+102,111,110,100,111,99,97,110,97,108,110,111,114,116,101,108,101,116,114,97,99,
+97,117,115,97,116,111,109,97,114,109,97,110,111,115,108,117,110,101,115,97,117,
+116,111,115,118,105,108,108,97,118,101,110,100,111,112,101,115,97,114,116,105,
+112,111,115,116,101,110,103,97,109,97,114,99,111,108,108,101,118,97,112,97,100,
+114,101,117,110,105,100,111,118,97,109,111,115,122,111,110,97,115,97,109,98,111,
+115,98,97,110,100,97,109,97,114,105,97,97,98,117,115,111,109,117,99,104,97,115,
+117,98,105,114,114,105,111,106,97,118,105,118,105,114,103,114,97,100,111,99,104,
+105,99,97,97,108,108,195,173,106,111,118,101,110,100,105,99,104,97,101,115,116,
+97,110,116,97,108,101,115,115,97,108,105,114,115,117,101,108,111,112,101,115,111
+,115,102,105,110,101,115,108,108,97,109,97,98,117,115,99,111,195,169,115,116,97,
+108,108,101,103,97,110,101,103,114,111,112,108,97,122,97,104,117,109,111,114,112
+,97,103,97,114,106,117,110,116,97,100,111,98,108,101,105,115,108,97,115,98,111,
+108,115,97,98,97,195,177,111,104,97,98,108,97,108,117,99,104,97,195,129,114,101,
+97,100,105,99,101,110,106,117,103,97,114,110,111,116,97,115,118,97,108,108,101,
+97,108,108,195,161,99,97,114,103,97,100,111,108,111,114,97,98,97,106,111,101,115
+,116,195,169,103,117,115,116,111,109,101,110,116,101,109,97,114,105,111,102,105,
+114,109,97,99,111,115,116,111,102,105,99,104,97,112,108,97,116,97,104,111,103,97
+,114,97,114,116,101,115,108,101,121,101,115,97,113,117,101,108,109,117,115,101,
+111,98,97,115,101,115,112,111,99,111,115,109,105,116,97,100,99,105,101,108,111,
+99,104,105,99,111,109,105,101,100,111,103,97,110,97,114,115,97,110,116,111,101,
+116,97,112,97,100,101,98,101,115,112,108,97,121,97,114,101,100,101,115,115,105,
+101,116,101,99,111,114,116,101,99,111,114,101,97,100,117,100,97,115,100,101,115,
+101,111,118,105,101,106,111,100,101,115,101,97,97,103,117,97,115,38,113,117,111,
+116,59,100,111,109,97,105,110,99,111,109,109,111,110,115,116,97,116,117,115,101,
+118,101,110,116,115,109,97,115,116,101,114,115,121,115,116,101,109,97,99,116,105
+,111,110,98,97,110,110,101,114,114,101,109,111,118,101,115,99,114,111,108,108,
+117,112,100,97,116,101,103,108,111,98,97,108,109,101,100,105,117,109,102,105,108
+,116,101,114,110,117,109,98,101,114,99,104,97,110,103,101,114,101,115,117,108,
+116,112,117,98,108,105,99,115,99,114,101,101,110,99,104,111,111,115,101,110,111,
+114,109,97,108,116,114,97,118,101,108,105,115,115,117,101,115,115,111,117,114,99
+,101,116,97,114,103,101,116,115,112,114,105,110,103,109,111,100,117,108,101,109,
+111,98,105,108,101,115,119,105,116,99,104,112,104,111,116,111,115,98,111,114,100
+,101,114,114,101,103,105,111,110,105,116,115,101,108,102,115,111,99,105,97,108,
+97,99,116,105,118,101,99,111,108,117,109,110,114,101,99,111,114,100,102,111,108,
+108,111,119,116,105,116,108,101,62,101,105,116,104,101,114,108,101,110,103,116,
+104,102,97,109,105,108,121,102,114,105,101,110,100,108,97,121,111,117,116,97,117
+,116,104,111,114,99,114,101,97,116,101,114,101,118,105,101,119,115,117,109,109,
+101,114,115,101,114,118,101,114,112,108,97,121,101,100,112,108,97,121,101,114,
+101,120,112,97,110,100,112,111,108,105,99,121,102,111,114,109,97,116,100,111,117
+,98,108,101,112,111,105,110,116,115,115,101,114,105,101,115,112,101,114,115,111,
+110,108,105,118,105,110,103,100,101,115,105,103,110,109,111,110,116,104,115,102,
+111,114,99,101,115,117,110,105,113,117,101,119,101,105,103,104,116,112,101,111,
+112,108,101,101,110,101,114,103,121,110,97,116,117,114,101,115,101,97,114,99,104
+,102,105,103,117,114,101,104,97,118,105,110,103,99,117,115,116,111,109,111,102,
+102,115,101,116,108,101,116,116,101,114,119,105,110,100,111,119,115,117,98,109,
+105,116,114,101,110,100,101,114,103,114,111,117,112,115,117,112,108,111,97,100,
+104,101,97,108,116,104,109,101,116,104,111,100,118,105,100,101,111,115,115,99,
+104,111,111,108,102,117,116,117,114,101,115,104,97,100,111,119,100,101,98,97,116
+,101,118,97,108,117,101,115,79,98,106,101,99,116,111,116,104,101,114,115,114,105
+,103,104,116,115,108,101,97,103,117,101,99,104,114,111,109,101,115,105,109,112,
+108,101,110,111,116,105,99,101,115,104,97,114,101,100,101,110,100,105,110,103,
+115,101,97,115,111,110,114,101,112,111,114,116,111,110,108,105,110,101,115,113,
+117,97,114,101,98,117,116,116,111,110,105,109,97,103,101,115,101,110,97,98,108,
+101,109,111,118,105,110,103,108,97,116,101,115,116,119,105,110,116,101,114,70,
+114,97,110,99,101,112,101,114,105,111,100,115,116,114,111,110,103,114,101,112,
+101,97,116,76,111,110,100,111,110,100,101,116,97,105,108,102,111,114,109,101,100
+,100,101,109,97,110,100,115,101,99,117,114,101,112,97,115,115,101,100,116,111,
+103,103,108,101,112,108,97,99,101,115,100,101,118,105,99,101,115,116,97,116,105,
+99,99,105,116,105,101,115,115,116,114,101,97,109,121,101,108,108,111,119,97,116,
+116,97,99,107,115,116,114,101,101,116,102,108,105,103,104,116,104,105,100,100,
+101,110,105,110,102,111,34,62,111,112,101,110,101,100,117,115,101,102,117,108,
+118,97,108,108,101,121,99,97,117,115,101,115,108,101,97,100,101,114,115,101,99,
+114,101,116,115,101,99,111,110,100,100,97,109,97,103,101,115,112,111,114,116,115
+,101,120,99,101,112,116,114,97,116,105,110,103,115,105,103,110,101,100,116,104,
+105,110,103,115,101,102,102,101,99,116,102,105,101,108,100,115,115,116,97,116,
+101,115,111,102,102,105,99,101,118,105,115,117,97,108,101,100,105,116,111,114,
+118,111,108,117,109,101,82,101,112,111,114,116,109,117,115,101,117,109,109,111,
+118,105,101,115,112,97,114,101,110,116,97,99,99,101,115,115,109,111,115,116,108,
+121,109,111,116,104,101,114,34,32,105,100,61,34,109,97,114,107,101,116,103,114,
+111,117,110,100,99,104,97,110,99,101,115,117,114,118,101,121,98,101,102,111,114,
+101,115,121,109,98,111,108,109,111,109,101,110,116,115,112,101,101,99,104,109,
+111,116,105,111,110,105,110,115,105,100,101,109,97,116,116,101,114,67,101,110,
+116,101,114,111,98,106,101,99,116,101,120,105,115,116,115,109,105,100,100,108,
+101,69,117,114,111,112,101,103,114,111,119,116,104,108,101,103,97,99,121,109,97,
+110,110,101,114,101,110,111,117,103,104,99,97,114,101,101,114,97,110,115,119,101
+,114,111,114,105,103,105,110,112,111,114,116,97,108,99,108,105,101,110,116,115,
+101,108,101,99,116,114,97,110,100,111,109,99,108,111,115,101,100,116,111,112,105
+,99,115,99,111,109,105,110,103,102,97,116,104,101,114,111,112,116,105,111,110,
+115,105,109,112,108,121,114,97,105,115,101,100,101,115,99,97,112,101,99,104,111,
+115,101,110,99,104,117,114,99,104,100,101,102,105,110,101,114,101,97,115,111,110
+,99,111,114,110,101,114,111,117,116,112,117,116,109,101,109,111,114,121,105,102,
+114,97,109,101,112,111,108,105,99,101,109,111,100,101,108,115,78,117,109,98,101,
+114,100,117,114,105,110,103,111,102,102,101,114,115,115,116,121,108,101,115,107,
+105,108,108,101,100,108,105,115,116,101,100,99,97,108,108,101,100,115,105,108,
+118,101,114,109,97,114,103,105,110,100,101,108,101,116,101,98,101,116,116,101,
+114,98,114,111,119,115,101,108,105,109,105,116,115,71,108,111,98,97,108,115,105,
+110,103,108,101,119,105,100,103,101,116,99,101,110,116,101,114,98,117,100,103,
+101,116,110,111,119,114,97,112,99,114,101,100,105,116,99,108,97,105,109,115,101,
+110,103,105,110,101,115,97,102,101,116,121,99,104,111,105,99,101,115,112,105,114
+,105,116,45,115,116,121,108,101,115,112,114,101,97,100,109,97,107,105,110,103,
+110,101,101,100,101,100,114,117,115,115,105,97,112,108,101,97,115,101,101,120,
+116,101,110,116,83,99,114,105,112,116,98,114,111,107,101,110,97,108,108,111,119,
+115,99,104,97,114,103,101,100,105,118,105,100,101,102,97,99,116,111,114,109,101,
+109,98,101,114,45,98,97,115,101,100,116,104,101,111,114,121,99,111,110,102,105,
+103,97,114,111,117,110,100,119,111,114,107,101,100,104,101,108,112,101,100,67,
+104,117,114,99,104,105,109,112,97,99,116,115,104,111,117,108,100,97,108,119,97,
+121,115,108,111,103,111,34,32,98,111,116,116,111,109,108,105,115,116,34,62,41,
+123,118,97,114,32,112,114,101,102,105,120,111,114,97,110,103,101,72,101,97,100,
+101,114,46,112,117,115,104,40,99,111,117,112,108,101,103,97,114,100,101,110,98,
+114,105,100,103,101,108,97,117,110,99,104,82,101,118,105,101,119,116,97,107,105,
+110,103,118,105,115,105,111,110,108,105,116,116,108,101,100,97,116,105,110,103,
+66,117,116,116,111,110,98,101,97,117,116,121,116,104,101,109,101,115,102,111,114
+,103,111,116,83,101,97,114,99,104,97,110,99,104,111,114,97,108,109,111,115,116,
+108,111,97,100,101,100,67,104,97,110,103,101,114,101,116,117,114,110,115,116,114
+,105,110,103,114,101,108,111,97,100,77,111,98,105,108,101,105,110,99,111,109,101
+,115,117,112,112,108,121,83,111,117,114,99,101,111,114,100,101,114,115,118,105,
+101,119,101,100,38,110,98,115,112,59,99,111,117,114,115,101,65,98,111,117,116,32
+,105,115,108,97,110,100,60,104,116,109,108,32,99,111,111,107,105,101,110,97,109,
+101,61,34,97,109,97,122,111,110,109,111,100,101,114,110,97,100,118,105,99,101,
+105,110,60,47,97,62,58,32,84,104,101,32,100,105,97,108,111,103,104,111,117,115,
+101,115,66,69,71,73,78,32,77,101,120,105,99,111,115,116,97,114,116,115,99,101,
+110,116,114,101,104,101,105,103,104,116,97,100,100,105,110,103,73,115,108,97,110
+,100,97,115,115,101,116,115,69,109,112,105,114,101,83,99,104,111,111,108,101,102
+,102,111,114,116,100,105,114,101,99,116,110,101,97,114,108,121,109,97,110,117,97
+,108,83,101,108,101,99,116,46,10,10,79,110,101,106,111,105,110,101,100,109,101,
+110,117,34,62,80,104,105,108,105,112,97,119,97,114,100,115,104,97,110,100,108,
+101,105,109,112,111,114,116,79,102,102,105,99,101,114,101,103,97,114,100,115,107
+,105,108,108,115,110,97,116,105,111,110,83,112,111,114,116,115,100,101,103,114,
+101,101,119,101,101,107,108,121,32,40,101,46,103,46,98,101,104,105,110,100,100,
+111,99,116,111,114,108,111,103,103,101,100,117,110,105,116,101,100,60,47,98,62,
+60,47,98,101,103,105,110,115,112,108,97,110,116,115,97,115,115,105,115,116,97,
+114,116,105,115,116,105,115,115,117,101,100,51,48,48,112,120,124,99,97,110,97,
+100,97,97,103,101,110,99,121,115,99,104,101,109,101,114,101,109,97,105,110,66,
+114,97,122,105,108,115,97,109,112,108,101,108,111,103,111,34,62,98,101,121,111,
+110,100,45,115,99,97,108,101,97,99,99,101,112,116,115,101,114,118,101,100,109,97
+,114,105,110,101,70,111,111,116,101,114,99,97,109,101,114,97,60,47,104,49,62,10,
+95,102,111,114,109,34,108,101,97,118,101,115,115,116,114,101,115,115,34,32,47,62
+,13,10,46,103,105,102,34,32,111,110,108,111,97,100,108,111,97,100,101,114,79,120
+,102,111,114,100,115,105,115,116,101,114,115,117,114,118,105,118,108,105,115,116
+,101,110,102,101,109,97,108,101,68,101,115,105,103,110,115,105,122,101,61,34,97,
+112,112,101,97,108,116,101,120,116,34,62,108,101,118,101,108,115,116,104,97,110,
+107,115,104,105,103,104,101,114,102,111,114,99,101,100,97,110,105,109,97,108,97,
+110,121,111,110,101,65,102,114,105,99,97,97,103,114,101,101,100,114,101,99,101,
+110,116,80,101,111,112,108,101,60,98,114,32,47,62,119,111,110,100,101,114,112,
+114,105,99,101,115,116,117,114,110,101,100,124,124,32,123,125,59,109,97,105,110,
+34,62,105,110,108,105,110,101,115,117,110,100,97,121,119,114,97,112,34,62,102,97
+,105,108,101,100,99,101,110,115,117,115,109,105,110,117,116,101,98,101,97,99,111
+,110,113,117,111,116,101,115,49,53,48,112,120,124,101,115,116,97,116,101,114,101
+,109,111,116,101,101,109,97,105,108,34,108,105,110,107,101,100,114,105,103,104,
+116,59,115,105,103,110,97,108,102,111,114,109,97,108,49,46,104,116,109,108,115,
+105,103,110,117,112,112,114,105,110,99,101,102,108,111,97,116,58,46,112,110,103,
+34,32,102,111,114,117,109,46,65,99,99,101,115,115,112,97,112,101,114,115,115,111
+,117,110,100,115,101,120,116,101,110,100,72,101,105,103,104,116,115,108,105,100,
+101,114,85,84,70,45,56,34,38,97,109,112,59,32,66,101,102,111,114,101,46,32,87,
+105,116,104,115,116,117,100,105,111,111,119,110,101,114,115,109,97,110,97,103,
+101,112,114,111,102,105,116,106,81,117,101,114,121,97,110,110,117,97,108,112,97,
+114,97,109,115,98,111,117,103,104,116,102,97,109,111,117,115,103,111,111,103,108
+,101,108,111,110,103,101,114,105,43,43,41,32,123,105,115,114,97,101,108,115,97,
+121,105,110,103,100,101,99,105,100,101,104,111,109,101,34,62,104,101,97,100,101,
+114,101,110,115,117,114,101,98,114,97,110,99,104,112,105,101,99,101,115,98,108,
+111,99,107,59,115,116,97,116,101,100,116,111,112,34,62,60,114,97,99,105,110,103,
+114,101,115,105,122,101,45,45,38,103,116,59,112,97,99,105,116,121,115,101,120,
+117,97,108,98,117,114,101,97,117,46,106,112,103,34,32,49,48,44,48,48,48,111,98,
+116,97,105,110,116,105,116,108,101,115,97,109,111,117,110,116,44,32,73,110,99,46
+,99,111,109,101,100,121,109,101,110,117,34,32,108,121,114,105,99,115,116,111,100
+,97,121,46,105,110,100,101,101,100,99,111,117,110,116,121,95,108,111,103,111,46,
+70,97,109,105,108,121,108,111,111,107,101,100,77,97,114,107,101,116,108,115,101,
+32,105,102,80,108,97,121,101,114,116,117,114,107,101,121,41,59,118,97,114,32,102
+,111,114,101,115,116,103,105,118,105,110,103,101,114,114,111,114,115,68,111,109,
+97,105,110,125,101,108,115,101,123,105,110,115,101,114,116,66,108,111,103,60,47,
+102,111,111,116,101,114,108,111,103,105,110,46,102,97,115,116,101,114,97,103,101
+,110,116,115,60,98,111,100,121,32,49,48,112,120,32,48,112,114,97,103,109,97,102,
+114,105,100,97,121,106,117,110,105,111,114,100,111,108,108,97,114,112,108,97,99,
+101,100,99,111,118,101,114,115,112,108,117,103,105,110,53,44,48,48,48,32,112,97,
+103,101,34,62,98,111,115,116,111,110,46,116,101,115,116,40,97,118,97,116,97,114,
+116,101,115,116,101,100,95,99,111,117,110,116,102,111,114,117,109,115,115,99,104
+,101,109,97,105,110,100,101,120,44,102,105,108,108,101,100,115,104,97,114,101,
+115,114,101,97,100,101,114,97,108,101,114,116,40,97,112,112,101,97,114,83,117,98
+,109,105,116,108,105,110,101,34,62,98,111,100,121,34,62,10,42,32,84,104,101,84,
+104,111,117,103,104,115,101,101,105,110,103,106,101,114,115,101,121,78,101,119,
+115,60,47,118,101,114,105,102,121,101,120,112,101,114,116,105,110,106,117,114,
+121,119,105,100,116,104,61,67,111,111,107,105,101,83,84,65,82,84,32,97,99,114,
+111,115,115,95,105,109,97,103,101,116,104,114,101,97,100,110,97,116,105,118,101,
+112,111,99,107,101,116,98,111,120,34,62,10,83,121,115,116,101,109,32,68,97,118,
+105,100,99,97,110,99,101,114,116,97,98,108,101,115,112,114,111,118,101,100,65,
+112,114,105,108,32,114,101,97,108,108,121,100,114,105,118,101,114,105,116,101,
+109,34,62,109,111,114,101,34,62,98,111,97,114,100,115,99,111,108,111,114,115,99,
+97,109,112,117,115,102,105,114,115,116,32,124,124,32,91,93,59,109,101,100,105,97
+,46,103,117,105,116,97,114,102,105,110,105,115,104,119,105,100,116,104,58,115,
+104,111,119,101,100,79,116,104,101,114,32,46,112,104,112,34,32,97,115,115,117,
+109,101,108,97,121,101,114,115,119,105,108,115,111,110,115,116,111,114,101,115,
+114,101,108,105,101,102,115,119,101,100,101,110,67,117,115,116,111,109,101,97,
+115,105,108,121,32,121,111,117,114,32,83,116,114,105,110,103,10,10,87,104,105,
+108,116,97,121,108,111,114,99,108,101,97,114,58,114,101,115,111,114,116,102,114,
+101,110,99,104,116,104,111,117,103,104,34,41,32,43,32,34,60,98,111,100,121,62,98
+,117,121,105,110,103,98,114,97,110,100,115,77,101,109,98,101,114,110,97,109,101,
+34,62,111,112,112,105,110,103,115,101,99,116,111,114,53,112,120,59,34,62,118,115
+,112,97,99,101,112,111,115,116,101,114,109,97,106,111,114,32,99,111,102,102,101,
+101,109,97,114,116,105,110,109,97,116,117,114,101,104,97,112,112,101,110,60,47,
+110,97,118,62,107,97,110,115,97,115,108,105,110,107,34,62,73,109,97,103,101,115,
+61,102,97,108,115,101,119,104,105,108,101,32,104,115,112,97,99,101,48,38,97,109,
+112,59,32,10,10,73,110,32,32,112,111,119,101,114,80,111,108,115,107,105,45,99,
+111,108,111,114,106,111,114,100,97,110,66,111,116,116,111,109,83,116,97,114,116,
+32,45,99,111,117,110,116,50,46,104,116,109,108,110,101,119,115,34,62,48,49,46,
+106,112,103,79,110,108,105,110,101,45,114,105,103,104,116,109,105,108,108,101,
+114,115,101,110,105,111,114,73,83,66,78,32,48,48,44,48,48,48,32,103,117,105,100,
+101,115,118,97,108,117,101,41,101,99,116,105,111,110,114,101,112,97,105,114,46,
+120,109,108,34,32,32,114,105,103,104,116,115,46,104,116,109,108,45,98,108,111,99
+,107,114,101,103,69,120,112,58,104,111,118,101,114,119,105,116,104,105,110,118,
+105,114,103,105,110,112,104,111,110,101,115,60,47,116,114,62,13,117,115,105,110,
+103,32,10,9,118,97,114,32,62,39,41,59,10,9,60,47,116,100,62,10,60,47,116,114,62,
+10,98,97,104,97,115,97,98,114,97,115,105,108,103,97,108,101,103,111,109,97,103,
+121,97,114,112,111,108,115,107,105,115,114,112,115,107,105,216,177,216,175,217,
+136,228,184,173,230,150,135,231,174,128,228,189,147,231,185,129,233,171,148,228,
+191,161,230,129,175,228,184,173,229,155,189,230,136,145,228,187,172,228,184,128,
+228,184,170,229,133,172,229,143,184,231,174,161,231,144,134,232,174,186,229,157,
+155,229,143,175,228,187,165,230,156,141,229,138,161,230,151,182,233,151,180,228,
+184,170,228,186,186,228,186,167,229,147,129,232,135,170,229,183,177,228,188,129,
+228,184,154,230,159,165,231,156,139,229,183,165,228,189,156,232,129,148,231,179,
+187,230,178,161,230,156,137,231,189,145,231,171,153,230,137,128,230,156,137,232,
+175,132,232,174,186,228,184,173,229,191,131,230,150,135,231,171,160,231,148,168,
+230,136,183,233,166,150,233,161,181,228,189,156,232,128,133,230,138,128,230,156,
+175,233,151,174,233,162,152,231,155,184,229,133,179,228,184,139,232,189,189,230,
+144,156,231,180,162,228,189,191,231,148,168,232,189,175,228,187,182,229,156,168,
+231,186,191,228,184,187,233,162,152,232,181,132,230,150,153,232,167,134,233,162,
+145,229,155,158,229,164,141,230,179,168,229,134,140,231,189,145,231,187,156,230,
+148,182,232,151,143,229,134,133,229,174,185,230,142,168,232,141,144,229,184,130,
+229,156,186,230,182,136,230,129,175,231,169,186,233,151,180,229,143,145,229,184,
+131,228,187,128,228,185,136,229,165,189,229,143,139,231,148,159,230,180,187,229,
+155,190,231,137,135,229,143,145,229,177,149,229,166,130,230,158,156,230,137,139,
+230,156,186,230,150,176,233,151,187,230,156,128,230,150,176,230,150,185,229,188,
+143,229,140,151,228,186,172,230,143,144,228,190,155,229,133,179,228,186,142,230,
+155,180,229,164,154,232,191,153,228,184,170,231,179,187,231,187,159,231,159,165,
+233,129,147,230,184,184,230,136,143,229,185,191,229,145,138,229,133,182,228,187,
+150,229,143,145,232,161,168,229,174,137,229,133,168,231,172,172,228,184,128,228,
+188,154,229,145,152,232,191,155,232,161,140,231,130,185,229,135,187,231,137,136,
+230,157,131,231,148,181,229,173,144,228,184,150,231,149,140,232,174,190,232,174,
+161,229,133,141,232,180,185,230,149,153,232,130,178,229,138,160,229,133,165,230,
+180,187,229,138,168,228,187,150,228,187,172,229,149,134,229,147,129,229,141,154,
+229,174,162,231,142,176,229,156,168,228,184,138,230,181,183,229,166,130,228,189,
+149,229,183,178,231,187,143,231,149,153,232,168,128,232,175,166,231,187,134,231,
+164,190,229,140,186,231,153,187,229,189,149,230,156,172,231,171,153,233,156,128,
+232,166,129,228,187,183,230,160,188,230,148,175,230,140,129,229,155,189,233,153,
+133,233,147,190,230,142,165,229,155,189,229,174,182,229,187,186,232,174,190,230,
+156,139,229,143,139,233,152,133,232,175,187,230,179,149,229,190,139,228,189,141,
+231,189,174,231,187,143,230,181,142,233,128,137,230,139,169,232,191,153,230,160,
+183,229,189,147,229,137,141,229,136,134,231,177,187,230,142,146,232,161,140,229,
+155,160,228,184,186,228,186,164,230,152,147,230,156,128,229,144,142,233,159,179,
+228,185,144,228,184,141,232,131,189,233,128,154,232,191,135,232,161,140,228,184,
+154,231,167,145,230,138,128,229,143,175,232,131,189,232,174,190,229,164,135,229,
+144,136,228,189,156,229,164,167,229,174,182,231,164,190,228,188,154,231,160,148,
+231,169,182,228,184,147,228,184,154,229,133,168,233,131,168,233,161,185,231,155,
+174,232,191,153,233,135,140,232,191,152,230,152,175,229,188,128,229,167,139,230,
+131,133,229,134,181,231,148,181,232,132,145,230,150,135,228,187,182,229,147,129,
+231,137,140,229,184,174,229,138,169,230,150,135,229,140,150,232,181,132,230,186,
+144,229,164,167,229,173,166,229,173,166,228,185,160,229,156,176,229,157,128,230,
+181,143,232,167,136,230,138,149,232,181,132,229,183,165,231,168,139,232,166,129,
+230,177,130,230,128,142,228,185,136,230,151,182,229,128,153,229,138,159,232,131,
+189,228,184,187,232,166,129,231,155,174,229,137,141,232,181,132,232,174,175,229,
+159,142,229,184,130,230,150,185,230,179,149,231,148,181,229,189,177,230,139,155,
+232,129,152,229,163,176,230,152,142,228,187,187,228,189,149,229,129,165,229,186,
+183,230,149,176,230,141,174,231,190,142,229,155,189,230,177,189,232,189,166,228,
+187,139,231,187,141,228,189,134,230,152,175,228,186,164,230,181,129,231,148,159,
+228,186,167,230,137,128,228,187,165,231,148,181,232,175,157,230,152,190,231,164,
+186,228,184,128,228,186,155,229,141,149,228,189,141,228,186,186,229,145,152,229,
+136,134,230,158,144,229,156,176,229,155,190,230,151,133,230,184,184,229,183,165,
+229,133,183,229,173,166,231,148,159,231,179,187,229,136,151,231,189,145,229,143,
+139,229,184,150,229,173,144,229,175,134,231,160,129,233,162,145,233,129,147,230,
+142,167,229,136,182,229,156,176,229,140,186,229,159,186,230,156,172,229,133,168,
+229,155,189,231,189,145,228,184,138,233,135,141,232,166,129,231,172,172,228,186,
+140,229,150,156,230,172,162,232,191,155,229,133,165,229,143,139,230,131,133,232,
+191,153,228,186,155,232,128,131,232,175,149,229,143,145,231,142,176,229,159,185,
+232,174,173,228,187,165,228,184,138,230,148,191,229,186,156,230,136,144,228,184,
+186,231,142,175,229,162,131,233,166,153,230,184,175,229,144,140,230,151,182,229,
+168,177,228,185,144,229,143,145,233,128,129,228,184,128,229,174,154,229,188,128,
+229,143,145,228,189,156,229,147,129,230,160,135,229,135,134,230,172,162,232,191,
+142,232,167,163,229,134,179,229,156,176,230,150,185,228,184,128,228,184,139,228,
+187,165,229,143,138,232,180,163,228,187,187,230,136,150,232,128,133,229,174,162,
+230,136,183,228,187,163,232,161,168,231,167,175,229,136,134,229,165,179,228,186,
+186,230,149,176,231,160,129,233,148,128,229,148,174,229,135,186,231,142,176,231,
+166,187,231,186,191,229,186,148,231,148,168,229,136,151,232,161,168,228,184,141,
+229,144,140,231,188,150,232,190,145,231,187,159,232,174,161,230,159,165,232,175,
+162,228,184,141,232,166,129,230,156,137,229,133,179,230,156,186,230,158,132,229,
+190,136,229,164,154,230,146,173,230,148,190,231,187,132,231,187,135,230,148,191,
+231,173,150,231,155,180,230,142,165,232,131,189,229,138,155,230,157,165,230,186,
+144,230,153,130,233,150,147,231,156,139,229,136,176,231,131,173,233,151,168,229,
+133,179,233,148,174,228,184,147,229,140,186,233,157,158,229,184,184,232,139,177,
+232,175,173,231,153,190,229,186,166,229,184,140,230,156,155,231,190,142,229,165,
+179,230,175,148,232,190,131,231,159,165,232,175,134,232,167,132,229,174,154,229,
+187,186,232,174,174,233,131,168,233,151,168,230,132,143,232,167,129,231,178,190,
+229,189,169,230,151,165,230,156,172,230,143,144,233,171,152,229,143,145,232,168,
+128,230,150,185,233,157,162,229,159,186,233,135,145,229,164,132,231,144,134,230,
+157,131,233,153,144,229,189,177,231,137,135,233,147,182,232,161,140,232,191,152,
+230,156,137,229,136,134,228,186,171,231,137,169,229,147,129,231,187,143,232,144,
+165,230,183,187,229,138,160,228,184,147,229,174,182,232,191,153,231,167,141,232,
+175,157,233,162,152,232,181,183,230,157,165,228,184,154,229,138,161,229,133,172,
+229,145,138,232,174,176,229,189,149,231,174,128,228,187,139,232,180,168,233,135,
+143,231,148,183,228,186,186,229,189,177,229,147,141,229,188,149,231,148,168,230,
+138,165,229,145,138,233,131,168,229,136,134,229,191,171,233,128,159,229,146,168,
+232,175,162,230,151,182,229,176,154,230,179,168,230,132,143,231,148,179,232,175,
+183,229,173,166,230,160,161,229,186,148,232,175,165,229,142,134,229,143,178,229,
+143,170,230,152,175,232,191,148,229,155,158,232,180,173,228,185,176,229,144,141,
+231,167,176,228,184,186,228,186,134,230,136,144,229,138,159,232,175,180,230,152,
+142,228,190,155,229,186,148,229,173,169,229,173,144,228,184,147,233,162,152,231,
+168,139,229,186,143,228,184,128,232,136,172,230,156,131,229,147,161,229,143,170,
+230,156,137,229,133,182,229,174,131,228,191,157,230,138,164,232,128,140,228,184,
+148,228,187,138,229,164,169,231,170,151,229,143,163,229,138,168,230,128,129,231,
+138,182,230,128,129,231,137,185,229,136,171,232,174,164,228,184,186,229,191,133,
+233,161,187,230,155,180,230,150,176,229,176,143,232,175,180,230,136,145,229,128,
+145,228,189,156,228,184,186,229,170,146,228,189,147,229,140,133,230,139,172,233,
+130,163,228,185,136,228,184,128,230,160,183,229,155,189,229,134,133,230,152,175,
+229,144,166,230,160,185,230,141,174,231,148,181,232,167,134,229,173,166,233,153,
+162,229,133,183,230,156,137,232,191,135,231,168,139,231,148,177,228,186,142,228,
+186,186,230,137,141,229,135,186,230,157,165,228,184,141,232,191,135,230,173,163,
+229,156,168,230,152,142,230,152,159,230,149,133,228,186,139,229,133,179,231,179,
+187,230,160,135,233,162,152,229,149,134,229,138,161,232,190,147,229,133,165,228,
+184,128,231,155,180,229,159,186,231,161,128,230,149,153,229,173,166,228,186,134,
+232,167,163,229,187,186,231,173,145,231,187,147,230,158,156,229,133,168,231,144,
+131,233,128,154,231,159,165,232,174,161,229,136,146,229,175,185,228,186,142,232,
+137,186,230,156,175,231,155,184,229,134,140,229,143,145,231,148,159,231,156,159,
+231,154,132,229,187,186,231,171,139,231,173,137,231,186,167,231,177,187,229,158,
+139,231,187,143,233,170,140,229,174,158,231,142,176,229,136,182,228,189,156,230,
+157,165,232,135,170,230,160,135,231,173,190,228,187,165,228,184,139,229,142,159,
+229,136,155,230,151,160,230,179,149,229,133,182,228,184,173,229,128,139,228,186,
+186,228,184,128,229,136,135,230,140,135,229,141,151,229,133,179,233,151,173,233,
+155,134,229,155,162,231,172,172,228,184,137,229,133,179,230,179,168,229,155,160,
+230,173,164,231,133,167,231,137,135,230,183,177,229,156,179,229,149,134,228,184,
+154,229,185,191,229,183,158,230,151,165,230,156,159,233,171,152,231,186,167,230,
+156,128,232,191,145,231,187,188,229,144,136,232,161,168,231,164,186,228,184,147,
+232,190,145,232,161,140,228,184,186,228,186,164,233,128,154,232,175,132,228,187,
+183,232,167,137,229,190,151,231,178,190,229,141,142,229,174,182,229,186,173,229,
+174,140,230,136,144,230,132,159,232,167,137,229,174,137,232,163,133,229,190,151,
+229,136,176,233,130,174,228,187,182,229,136,182,229,186,166,233,163,159,229,147,
+129,232,153,189,231,132,182,232,189,172,232,189,189,230,138,165,228,187,183,232,
+174,176,232,128,133,230,150,185,230,161,136,232,161,140,230,148,191,228,186,186,
+230,176,145,231,148,168,229,147,129,228,184,156,232,165,191,230,143,144,229,135,
+186,233,133,146,229,186,151,231,132,182,229,144,142,228,187,152,230,172,190,231,
+131,173,231,130,185,228,187,165,229,137,141,229,174,140,229,133,168,229,143,145,
+229,184,150,232,174,190,231,189,174,233,162,134,229,175,188,229,183,165,228,184,
+154,229,140,187,233,153,162,231,156,139,231,156,139,231,187,143,229,133,184,229,
+142,159,229,155,160,229,185,179,229,143,176,229,144,132,231,167,141,229,162,158,
+229,138,160,230,157,144,230,150,153,230,150,176,229,162,158,228,185,139,229,144,
+142,232,129,140,228,184,154,230,149,136,230,158,156,228,187,138,229,185,180,232,
+174,186,230,150,135,230,136,145,229,155,189,229,145,138,232,175,137,231,137,136,
+228,184,187,228,191,174,230,148,185,229,143,130,228,184,142,230,137,147,229,141,
+176,229,191,171,228,185,144,230,156,186,230,162,176,232,167,130,231,130,185,229,
+173,152,229,156,168,231,178,190,231,165,158,232,142,183,229,190,151,229,136,169,
+231,148,168,231,187,167,231,187,173,228,189,160,228,187,172,232,191,153,228,185,
+136,230,168,161,229,188,143,232,175,173,232,168,128,232,131,189,229,164,159,233,
+155,133,232,153,142,230,147,141,228,189,156,233,163,142,230,160,188,228,184,128,
+232,181,183,231,167,145,229,173,166,228,189,147,232,130,178,231,159,173,228,191,
+161,230,157,161,228,187,182,230,178,187,231,150,151,232,191,144,229,138,168,228,
+186,167,228,184,154,228,188,154,232,174,174,229,175,188,232,136,170,229,133,136,
+231,148,159,232,129,148,231,155,159,229,143,175,230,152,175,229,149,143,233,161,
+140,231,187,147,230,158,132,228,189,156,231,148,168,232,176,131,230,159,165,232,
+179,135,230,150,153,232,135,170,229,138,168,232,180,159,232,180,163,229,134,156,
+228,184,154,232,174,191,233,151,174,229,174,158,230,150,189,230,142,165,229,143,
+151,232,174,168,232,174,186,233,130,163,228,184,170,229,143,141,233,166,136,229,
+138,160,229,188,186,229,165,179,230,128,167,232,140,131,229,155,180,230,156,141,
+229,139,153,228,188,145,233,151,178,228,187,138,230,151,165,229,174,162,230,156,
+141,232,167,128,231,156,139,229,143,130,229,138,160,231,154,132,232,175,157,228,
+184,128,231,130,185,228,191,157,232,175,129,229,155,190,228,185,166,230,156,137,
+230,149,136,230,181,139,232,175,149,231,167,187,229,138,168,230,137,141,232,131,
+189,229,134,179,229,174,154,232,130,161,231,165,168,228,184,141,230,150,173,233,
+156,128,230,177,130,228,184,141,229,190,151,229,138,158,230,179,149,228,185,139,
+233,151,180,233,135,135,231,148,168,232,144,165,233,148,128,230,138,149,232,175,
+137,231,155,174,230,160,135,231,136,177,230,131,133,230,145,132,229,189,177,230,
+156,137,228,186,155,232,164,135,232,163,189,230,150,135,229,173,166,230,156,186,
+228,188,154,230,149,176,229,173,151,232,163,133,228,191,174,232,180,173,231,137,
+169,229,134,156,230,157,145,229,133,168,233,157,162,231,178,190,229,147,129,229,
+133,182,229,174,158,228,186,139,230,131,133,230,176,180,229,185,179,230,143,144,
+231,164,186,228,184,138,229,184,130,232,176,162,232,176,162,230,153,174,233,128,
+154,230,149,153,229,184,136,228,184,138,228,188,160,231,177,187,229,136,171,230,
+173,140,230,155,178,230,139,165,230,156,137,229,136,155,230,150,176,233,133,141,
+228,187,182,229,143,170,232,166,129,230,151,182,228,187,163,232,179,135,232,168,
+138,232,190,190,229,136,176,228,186,186,231,148,159,232,174,162,233,152,133,232,
+128,129,229,184,136,229,177,149,231,164,186,229,191,131,231,144,134,232,180,180,
+229,173,144,231,182,178,231,171,153,228,184,187,233,161,140,232,135,170,231,132,
+182,231,186,167,229,136,171,231,174,128,229,141,149,230,148,185,233,157,169,233,
+130,163,228,186,155,230,157,165,232,175,180,230,137,147,229,188,128,228,187,163,
+231,160,129,229,136,160,233,153,164,232,175,129,229,136,184,232,138,130,231,155,
+174,233,135,141,231,130,185,230,172,161,230,149,184,229,164,154,229,176,145,232,
+167,132,229,136,146,232,181,132,233,135,145,230,137,190,229,136,176,228,187,165,
+229,144,142,229,164,167,229,133,168,228,184,187,233,161,181,230,156,128,228,189,
+179,229,155,158,231,173,148,229,164,169,228,184,139,228,191,157,233,154,156,231,
+142,176,228,187,163,230,163,128,230,159,165,230,138,149,231,165,168,229,176,143,
+230,151,182,230,178,146,230,156,137,230,173,163,229,184,184,231,148,154,232,135,
+179,228,187,163,231,144,134,231,155,174,229,189,149,229,133,172,229,188,128,229,
+164,141,229,136,182,233,135,145,232,158,141,229,185,184,231,166,143,231,137,136,
+230,156,172,229,189,162,230,136,144,229,135,134,229,164,135,232,161,140,230,131,
+133,229,155,158,229,136,176,230,128,157,230,131,179,230,128,142,230,160,183,229,
+141,143,232,174,174,232,174,164,232,175,129,230,156,128,229,165,189,228,186,167,
+231,148,159,230,140,137,231,133,167,230,156,141,232,163,133,229,185,191,228,184,
+156,229,138,168,230,188,171,233,135,135,232,180,173,230,150,176,230,137,139,231,
+187,132,229,155,190,233,157,162,230,157,191,229,143,130,232,128,131,230,148,191,
+230,178,187,229,174,185,230,152,147,229,164,169,229,156,176,229,138,170,229,138,
+155,228,186,186,228,187,172,229,141,135,231,186,167,233,128,159,229,186,166,228,
+186,186,231,137,169,232,176,131,230,149,180,230,181,129,232,161,140,233,128,160,
+230,136,144,230,150,135,229,173,151,233,159,169,229,155,189,232,180,184,230,152,
+147,229,188,128,229,177,149,231,155,184,233,151,156,232,161,168,231,142,176,229,
+189,177,232,167,134,229,166,130,230,173,164,231,190,142,229,174,185,229,164,167,
+229,176,143,230,138,165,233,129,147,230,157,161,230,172,190,229,191,131,230,131,
+133,232,174,184,229,164,154,230,179,149,232,167,132,229,174,182,229,177,133,228,
+185,166,229,186,151,232,191,158,230,142,165,231,171,139,229,141,179,228,184,190,
+230,138,165,230,138,128,229,183,167,229,165,165,232,191,144,231,153,187,229,133,
+165,228,187,165,230,157,165,231,144,134,232,174,186,228,186,139,228,187,182,232,
+135,170,231,148,177,228,184,173,229,141,142,229,138,158,229,133,172,229,166,136,
+229,166,136,231,156,159,230,173,163,228,184,141,233,148,153,229,133,168,230,150,
+135,229,144,136,229,144,140,228,187,183,229,128,188,229,136,171,228,186,186,231,
+155,145,231,157,163,229,133,183,228,189,147,228,184,150,231,186,170,229,155,162,
+233,152,159,229,136,155,228,184,154,230,137,191,230,139,133,229,162,158,233,149,
+191,230,156,137,228,186,186,228,191,157,230,140,129,229,149,134,229,174,182,231,
+187,180,228,191,174,229,143,176,230,185,190,229,183,166,229,143,179,232,130,161,
+228,187,189,231,173,148,230,161,136,229,174,158,233,153,133,231,148,181,228,191,
+161,231,187,143,231,144,134,231,148,159,229,145,189,229,174,163,228,188,160,228,
+187,187,229,138,161,230,173,163,229,188,143,231,137,185,232,137,178,228,184,139,
+230,157,165,229,141,143,228,188,154,229,143,170,232,131,189,229,189,147,231,132,
+182,233,135,141,230,150,176,229,133,167,229,174,185,230,140,135,229,175,188,232,
+191,144,232,161,140,230,151,165,229,191,151,232,179,163,229,174,182,232,182,133,
+232,191,135,229,156,159,229,156,176,230,181,153,230,177,159,230,148,175,228,187,
+152,230,142,168,229,135,186,231,171,153,233,149,191,230,157,173,229,183,158,230,
+137,167,232,161,140,229,136,182,233,128,160,228,185,139,228,184,128,230,142,168,
+229,185,191,231,142,176,229,156,186,230,143,143,232,191,176,229,143,152,229,140,
+150,228,188,160,231,187,159,230,173,140,230,137,139,228,191,157,233,153,169,232,
+175,190,231,168,139,229,140,187,231,150,151,231,187,143,232,191,135,232,191,135,
+229,142,187,228,185,139,229,137,141,230,148,182,229,133,165,229,185,180,229,186,
+166,230,157,130,229,191,151,231,190,142,228,184,189,230,156,128,233,171,152,231,
+153,187,233,153,134,230,156,170,230,157,165,229,138,160,229,183,165,229,133,141,
+232,180,163,230,149,153,231,168,139,231,137,136,229,157,151,232,186,171,228,189,
+147,233,135,141,229,186,134,229,135,186,229,148,174,230,136,144,230,156,172,229,
+189,162,229,188,143,229,156,159,232,177,134,229,135,186,229,131,185,228,184,156,
+230,150,185,233,130,174,231,174,177,229,141,151,228,186,172,230,177,130,232,129,
+140,229,143,150,229,190,151,232,129,140,228,189,141,231,155,184,228,191,161,233,
+161,181,233,157,162,229,136,134,233,146,159,231,189,145,233,161,181,231,161,174,
+229,174,154,229,155,190,228,190,139,231,189,145,229,157,128,231,167,175,230,158,
+129,233,148,153,232,175,175,231,155,174,231,154,132,229,174,157,232,180,157,230,
+156,186,229,133,179,233,163,142,233,153,169,230,142,136,230,157,131,231,151,133,
+230,175,146,229,174,160,231,137,169,233,153,164,228,186,134,232,169,149,232,171,
+150,231,150,190,231,151,133,229,143,138,230,151,182,230,177,130,232,180,173,231,
+171,153,231,130,185,229,132,191,231,171,165,230,175,143,229,164,169,228,184,173,
+229,164,174,232,174,164,232,175,134,230,175,143,228,184,170,229,164,169,230,180,
+165,229,173,151,228,189,147,229,143,176,231,129,163,231,187,180,230,138,164,230,
+156,172,233,161,181,228,184,170,230,128,167,229,174,152,230,150,185,229,184,184,
+232,167,129,231,155,184,230,156,186,230,136,152,231,149,165,229,186,148,229,189,
+147,229,190,139,229,184,136,230,150,185,228,190,191,230,160,161,229,155,173,232,
+130,161,229,184,130,230,136,191,229,177,139,230,160,143,231,155,174,229,145,152,
+229,183,165,229,175,188,232,135,180,231,170,129,231,132,182,233,129,147,229,133,
+183,230,156,172,231,189,145,231,187,147,229,144,136,230,161,163,230,161,136,229,
+138,179,229,138,168,229,143,166,229,164,150,231,190,142,229,133,131,229,188,149,
+232,181,183,230,148,185,229,143,152,231,172,172,229,155,155,228,188,154,232,174,
+161,232,170,170,230,152,142,233,154,144,231,167,129,229,174,157,229,174,157,232,
+167,132,232,140,131,230,182,136,232,180,185,229,133,177,229,144,140,229,191,152,
+232,174,176,228,189,147,231,179,187,229,184,166,230,157,165,229,144,141,229,173,
+151,231,153,188,232,161,168,229,188,128,230,148,190,229,138,160,231,155,159,229,
+143,151,229,136,176,228,186,140,230,137,139,229,164,167,233,135,143,230,136,144,
+228,186,186,230,149,176,233,135,143,229,133,177,228,186,171,229,140,186,229,159,
+159,229,165,179,229,173,169,229,142,159,229,136,153,230,137,128,229,156,168,231,
+187,147,230,157,159,233,128,154,228,191,161,232,182,133,231,186,167,233,133,141,
+231,189,174,229,189,147,230,151,182,228,188,152,231,167,128,230,128,167,230,132,
+159,230,136,191,228,186,167,233,129,138,230,136,178,229,135,186,229,143,163,230,
+143,144,228,186,164,229,176,177,228,184,154,228,191,157,229,129,165,231,168,139,
+229,186,166,229,143,130,230,149,176,228,186,139,228,184,154,230,149,180,228,184,
+170,229,177,177,228,184,156,230,131,133,230,132,159,231,137,185,230,174,138,229,
+136,134,233,161,158,230,144,156,229,176,139,229,177,158,228,186,142,233,151,168,
+230,136,183,232,180,162,229,138,161,229,163,176,233,159,179,229,143,138,229,133,
+182,232,180,162,231,187,143,229,157,154,230,140,129,229,185,178,233,131,168,230,
+136,144,231,171,139,229,136,169,231,155,138,232,128,131,232,153,145,230,136,144,
+233,131,189,229,140,133,232,163,133,231,148,168,230,136,182,230,175,148,232,181,
+155,230,150,135,230,152,142,230,139,155,229,149,134,229,174,140,230,149,180,231,
+156,159,230,152,175,231,156,188,231,157,155,228,188,153,228,188,180,229,168,129,
+230,156,155,233,162,134,229,159,159,229,141,171,231,148,159,228,188,152,230,131,
+160,232,171,150,229,163,135,229,133,172,229,133,177,232,137,175,229,165,189,229,
+133,133,229,136,134,231,172,166,229,144,136,233,153,132,228,187,182,231,137,185,
+231,130,185,228,184,141,229,143,175,232,139,177,230,150,135,232,181,132,228,186,
+167,230,160,185,230,156,172,230,152,142,230,152,190,229,175,134,231,162,188,229,
+133,172,228,188,151,230,176,145,230,151,143,230,155,180,229,138,160,228,186,171,
+229,143,151,229,144,140,229,173,166,229,144,175,229,138,168,233,128,130,229,144,
+136,229,142,159,230,157,165,233,151,174,231,173,148,230,156,172,230,150,135,231,
+190,142,233,163,159,231,187,191,232,137,178,231,168,179,229,174,154,231,187,136,
+228,186,142,231,148,159,231,137,169,228,190,155,230,177,130,230,144,156,231,139,
+144,229,138,155,233,135,143,228,184,165,233,135,141,230,176,184,232,191,156,229,
+134,153,231,156,159,230,156,137,233,153,144,231,171,158,228,186,137,229,175,185,
+232,177,161,232,180,185,231,148,168,228,184,141,229,165,189,231,187,157,229,175,
+185,229,141,129,229,136,134,228,191,131,232,191,155,231,130,185,232,175,132,229,
+189,177,233,159,179,228,188,152,229,138,191,228,184,141,229,176,145,230,172,163,
+232,181,143,229,185,182,228,184,148,230,156,137,231,130,185,230,150,185,229,144,
+145,229,133,168,230,150,176,228,191,161,231,148,168,232,174,190,230,150,189,229,
+189,162,232,177,161,232,181,132,230,160,188,231,170,129,231,160,180,233,154,143,
+231,157,128,233,135,141,229,164,167,228,186,142,230,152,175,230,175,149,228,184,
+154,230,153,186,232,131,189,229,140,150,229,183,165,229,174,140,231,190,142,229,
+149,134,229,159,142,231,187,159,228,184,128,229,135,186,231,137,136,230,137,147,
+233,128,160,231,148,162,229,147,129,230,166,130,229,134,181,231,148,168,228,186,
+142,228,191,157,231,149,153,229,155,160,231,180,160,228,184,173,229,156,139,229,
+173,152,229,130,168,232,180,180,229,155,190,230,156,128,230,132,155,233,149,191,
+230,156,159,229,143,163,228,187,183,231,144,134,232,180,162,229,159,186,229,156,
+176,229,174,137,230,142,146,230,173,166,230,177,137,233,135,140,233,157,162,229,
+136,155,229,187,186,229,164,169,231,169,186,233,166,150,229,133,136,229,174,140,
+229,150,132,233,169,177,229,138,168,228,184,139,233,157,162,228,184,141,229,134,
+141,232,175,154,228,191,161,230,132,143,228,185,137,233,152,179,229,133,137,232,
+139,177,229,155,189,230,188,130,228,186,174,229,134,155,228,186,139,231,142,169,
+229,174,182,231,190,164,228,188,151,229,134,156,230,176,145,229,141,179,229,143,
+175,229,144,141,231,168,177,229,174,182,229,133,183,229,138,168,231,148,187,230,
+131,179,229,136,176,230,179,168,230,152,142,229,176,143,229,173,166,230,128,167,
+232,131,189,232,128,131,231,160,148,231,161,172,228,187,182,232,167,130,231,156,
+139,230,184,133,230,165,154,230,144,158,231,172,145,233,166,150,233,160,129,233,
+187,132,233,135,145,233,128,130,231,148,168,230,177,159,232,139,143,231,156,159,
+229,174,158,228,184,187,231,174,161,233,152,182,230,174,181,232,168,187,229,134,
+138,231,191,187,232,175,145,230,157,131,229,136,169,229,129,154,229,165,189,228,
+188,188,228,185,142,233,128,154,232,174,175,230,150,189,229,183,165,231,139,128,
+230,133,139,228,185,159,232,174,184,231,142,175,228,191,157,229,159,185,229,133,
+187,230,166,130,229,191,181,229,164,167,229,158,139,230,156,186,231,165,168,231,
+144,134,232,167,163,229,140,191,229,144,141,99,117,97,110,100,111,101,110,118,
+105,97,114,109,97,100,114,105,100,98,117,115,99,97,114,105,110,105,99,105,111,
+116,105,101,109,112,111,112,111,114,113,117,101,99,117,101,110,116,97,101,115,
+116,97,100,111,112,117,101,100,101,110,106,117,101,103,111,115,99,111,110,116,
+114,97,101,115,116,195,161,110,110,111,109,98,114,101,116,105,101,110,101,110,
+112,101,114,102,105,108,109,97,110,101,114,97,97,109,105,103,111,115,99,105,117,
+100,97,100,99,101,110,116,114,111,97,117,110,113,117,101,112,117,101,100,101,115
+,100,101,110,116,114,111,112,114,105,109,101,114,112,114,101,99,105,111,115,101,
+103,195,186,110,98,117,101,110,111,115,118,111,108,118,101,114,112,117,110,116,
+111,115,115,101,109,97,110,97,104,97,98,195,173,97,97,103,111,115,116,111,110,
+117,101,118,111,115,117,110,105,100,111,115,99,97,114,108,111,115,101,113,117,
+105,112,111,110,105,195,177,111,115,109,117,99,104,111,115,97,108,103,117,110,97
+,99,111,114,114,101,111,105,109,97,103,101,110,112,97,114,116,105,114,97,114,114
+,105,98,97,109,97,114,195,173,97,104,111,109,98,114,101,101,109,112,108,101,111,
+118,101,114,100,97,100,99,97,109,98,105,111,109,117,99,104,97,115,102,117,101,
+114,111,110,112,97,115,97,100,111,108,195,173,110,101,97,112,97,114,101,99,101,
+110,117,101,118,97,115,99,117,114,115,111,115,101,115,116,97,98,97,113,117,105,
+101,114,111,108,105,98,114,111,115,99,117,97,110,116,111,97,99,99,101,115,111,
+109,105,103,117,101,108,118,97,114,105,111,115,99,117,97,116,114,111,116,105,101
+,110,101,115,103,114,117,112,111,115,115,101,114,195,161,110,101,117,114,111,112
+,97,109,101,100,105,111,115,102,114,101,110,116,101,97,99,101,114,99,97,100,101,
+109,195,161,115,111,102,101,114,116,97,99,111,99,104,101,115,109,111,100,101,108
+,111,105,116,97,108,105,97,108,101,116,114,97,115,97,108,103,195,186,110,99,111,
+109,112,114,97,99,117,97,108,101,115,101,120,105,115,116,101,99,117,101,114,112,
+111,115,105,101,110,100,111,112,114,101,110,115,97,108,108,101,103,97,114,118,
+105,97,106,101,115,100,105,110,101,114,111,109,117,114,99,105,97,112,111,100,114
+,195,161,112,117,101,115,116,111,100,105,97,114,105,111,112,117,101,98,108,111,
+113,117,105,101,114,101,109,97,110,117,101,108,112,114,111,112,105,111,99,114,
+105,115,105,115,99,105,101,114,116,111,115,101,103,117,114,111,109,117,101,114,
+116,101,102,117,101,110,116,101,99,101,114,114,97,114,103,114,97,110,100,101,101
+,102,101,99,116,111,112,97,114,116,101,115,109,101,100,105,100,97,112,114,111,
+112,105,97,111,102,114,101,99,101,116,105,101,114,114,97,101,45,109,97,105,108,
+118,97,114,105,97,115,102,111,114,109,97,115,102,117,116,117,114,111,111,98,106,
+101,116,111,115,101,103,117,105,114,114,105,101,115,103,111,110,111,114,109,97,
+115,109,105,115,109,111,115,195,186,110,105,99,111,99,97,109,105,110,111,115,105
+,116,105,111,115,114,97,122,195,179,110,100,101,98,105,100,111,112,114,117,101,
+98,97,116,111,108,101,100,111,116,101,110,195,173,97,106,101,115,195,186,115,101
+,115,112,101,114,111,99,111,99,105,110,97,111,114,105,103,101,110,116,105,101,
+110,100,97,99,105,101,110,116,111,99,195,161,100,105,122,104,97,98,108,97,114,
+115,101,114,195,173,97,108,97,116,105,110,97,102,117,101,114,122,97,101,115,116,
+105,108,111,103,117,101,114,114,97,101,110,116,114,97,114,195,169,120,105,116,
+111,108,195,179,112,101,122,97,103,101,110,100,97,118,195,173,100,101,111,101,
+118,105,116,97,114,112,97,103,105,110,97,109,101,116,114,111,115,106,97,118,105,
+101,114,112,97,100,114,101,115,102,195,161,99,105,108,99,97,98,101,122,97,195,
+161,114,101,97,115,115,97,108,105,100,97,101,110,118,195,173,111,106,97,112,195,
+179,110,97,98,117,115,111,115,98,105,101,110,101,115,116,101,120,116,111,115,108
+,108,101,118,97,114,112,117,101,100,97,110,102,117,101,114,116,101,99,111,109,
+195,186,110,99,108,97,115,101,115,104,117,109,97,110,111,116,101,110,105,100,111
+,98,105,108,98,97,111,117,110,105,100,97,100,101,115,116,195,161,115,101,100,105
+,116,97,114,99,114,101,97,100,111,208,180,208,187,209,143,209,135,209,130,208,
+190,208,186,208,176,208,186,208,184,208,187,208,184,209,141,209,130,208,190,208,
+178,209,129,208,181,208,181,208,179,208,190,208,191,209,128,208,184,209,130,208,
+176,208,186,208,181,209,137,208,181,209,131,208,182,208,181,208,154,208,176,208,
+186,208,177,208,181,208,183,208,177,209,139,208,187,208,190,208,189,208,184,208,
+146,209,129,208,181,208,191,208,190,208,180,208,173,209,130,208,190,209,130,208,
+190,208,188,209,135,208,181,208,188,208,189,208,181,209,130,208,187,208,181,209,
+130,209,128,208,176,208,183,208,190,208,189,208,176,208,179,208,180,208,181,208,
+188,208,189,208,181,208,148,208,187,209,143,208,159,209,128,208,184,208,189,208,
+176,209,129,208,189,208,184,209,133,209,130,208,181,208,188,208,186,209,130,208,
+190,208,179,208,190,208,180,208,178,208,190,209,130,209,130,208,176,208,188,208,
+161,208,168,208,144,208,188,208,176,209,143,208,167,209,130,208,190,208,178,208,
+176,209,129,208,178,208,176,208,188,208,181,208,188,209,131,208,162,208,176,208,
+186,208,180,208,178,208,176,208,189,208,176,208,188,209,141,209,130,208,184,209,
+141,209,130,209,131,208,146,208,176,208,188,209,130,208,181,209,133,208,191,209,
+128,208,190,209,130,209,131,209,130,208,189,208,176,208,180,208,180,208,189,209,
+143,208,146,208,190,209,130,209,130,209,128,208,184,208,189,208,181,208,185,208,
+146,208,176,209,129,208,189,208,184,208,188,209,129,208,176,208,188,209,130,208,
+190,209,130,209,128,209,131,208,177,208,158,208,189,208,184,208,188,208,184,209,
+128,208,189,208,181,208,181,208,158,208,158,208,158,208,187,208,184,209,134,209,
+141,209,130,208,176,208,158,208,189,208,176,208,189,208,181,208,188,208,180,208,
+190,208,188,208,188,208,190,208,185,208,180,208,178,208,181,208,190,208,189,208,
+190,209,129,209,131,208,180,224,164,149,224,165,135,224,164,185,224,165,136,224,
+164,149,224,165,128,224,164,184,224,165,135,224,164,149,224,164,190,224,164,149,
+224,165,139,224,164,148,224,164,176,224,164,170,224,164,176,224,164,168,224,165,
+135,224,164,143,224,164,149,224,164,149,224,164,191,224,164,173,224,165,128,224,
+164,135,224,164,184,224,164,149,224,164,176,224,164,164,224,165,139,224,164,185,
+224,165,139,224,164,134,224,164,170,224,164,185,224,165,128,224,164,175,224,164,
+185,224,164,175,224,164,190,224,164,164,224,164,149,224,164,165,224,164,190,106,
+97,103,114,97,110,224,164,134,224,164,156,224,164,156,224,165,139,224,164,133,
+224,164,172,224,164,166,224,165,139,224,164,151,224,164,136,224,164,156,224,164,
+190,224,164,151,224,164,143,224,164,185,224,164,174,224,164,135,224,164,168,224,
+164,181,224,164,185,224,164,175,224,165,135,224,164,165,224,165,135,224,164,165,
+224,165,128,224,164,152,224,164,176,224,164,156,224,164,172,224,164,166,224,165,
+128,224,164,149,224,164,136,224,164,156,224,165,128,224,164,181,224,165,135,224,
+164,168,224,164,136,224,164,168,224,164,143,224,164,185,224,164,176,224,164,137,
+224,164,184,224,164,174,224,165,135,224,164,149,224,164,174,224,164,181,224,165,
+139,224,164,178,224,165,135,224,164,184,224,164,172,224,164,174,224,164,136,224,
+164,166,224,165,135,224,164,147,224,164,176,224,164,134,224,164,174,224,164,172,
+224,164,184,224,164,173,224,164,176,224,164,172,224,164,168,224,164,154,224,164,
+178,224,164,174,224,164,168,224,164,134,224,164,151,224,164,184,224,165,128,224,
+164,178,224,165,128,216,185,217,132,217,137,216,165,217,132,217,137,217,135,216,
+176,216,167,216,162,216,174,216,177,216,185,216,175,216,175,216,167,217,132,217,
+137,217,135,216,176,217,135,216,181,217,136,216,177,216,186,217,138,216,177,217,
+131,216,167,217,134,217,136,217,132,216,167,216,168,217,138,217,134,216,185,216,
+177,216,182,216,176,217,132,217,131,217,135,217,134,216,167,217,138,217,136,217,
+133,217,130,216,167,217,132,216,185,217,132,217,138,216,167,217,134,216,167,217,
+132,217,131,217,134,216,173,216,170,217,137,217,130,216,168,217,132,217,136,216,
+173,216,169,216,167,216,174,216,177,217,129,217,130,216,183,216,185,216,168,216,
+175,216,177,217,131,217,134,216,165,216,176,216,167,217,131,217,133,216,167,216,
+167,216,173,216,175,216,165,217,132,216,167,217,129,217,138,217,135,216,168,216,
+185,216,182,217,131,217,138,217,129,216,168,216,173,216,171,217,136,217,133,217,
+134,217,136,217,135,217,136,216,163,217,134,216,167,216,172,216,175,216,167,217,
+132,217,135,216,167,216,179,217,132,217,133,216,185,217,134,216,175,217,132,217,
+138,216,179,216,185,216,168,216,177,216,181,217,132,217,137,217,133,217,134,216,
+176,216,168,217,135,216,167,216,163,217,134,217,135,217,133,216,171,217,132,217,
+131,217,134,216,170,216,167,217,132,216,167,216,173,217,138,216,171,217,133,216,
+181,216,177,216,180,216,177,216,173,216,173,217,136,217,132,217,136,217,129,217,
+138,216,167,216,176,216,167,217,132,217,131,217,132,217,133,216,177,216,169,216,
+167,217,134,216,170,216,167,217,132,217,129,216,163,216,168,217,136,216,174,216,
+167,216,181,216,163,217,134,216,170,216,167,217,134,217,135,216,167,217,132,217,
+138,216,185,216,182,217,136,217,136,217,130,216,175,216,167,216,168,217,134,216,
+174,217,138,216,177,216,168,217,134,216,170,217,132,217,131,217,133,216,180,216,
+167,216,161,217,136,217,135,217,138,216,167,216,168,217,136,217,130,216,181,216,
+181,217,136,217,133,216,167,216,177,217,130,217,133,216,163,216,173,216,175,217,
+134,216,173,217,134,216,185,216,175,217,133,216,177,216,163,217,138,216,167,216,
+173,216,169,217,131,216,170,216,168,216,175,217,136,217,134,217,138,216,172,216,
+168,217,133,217,134,217,135,216,170,216,173,216,170,216,172,217,135,216,169,216,
+179,217,134,216,169,217,138,216,170,217,133,217,131,216,177,216,169,216,186,216,
+178,216,169,217,134,217,129,216,179,216,168,217,138,216,170,217,132,217,132,217,
+135,217,132,217,134,216,167,216,170,217,132,217,131,217,130,217,132,216,168,217,
+132,217,133,216,167,216,185,217,134,217,135,216,163,217,136,217,132,216,180,217,
+138,216,161,217,134,217,136,216,177,216,163,217,133,216,167,217,129,217,138,217,
+131,216,168,217,131,217,132,216,176,216,167,216,170,216,177,216,170,216,168,216,
+168,216,163,217,134,217,135,217,133,216,179,216,167,217,134,217,131,216,168,217,
+138,216,185,217,129,217,130,216,175,216,173,216,179,217,134,217,132,217,135,217,
+133,216,180,216,185,216,177,216,163,217,135,217,132,216,180,217,135,216,177,217,
+130,216,183,216,177,216,183,217,132,216,168,112,114,111,102,105,108,101,115,101,
+114,118,105,99,101,100,101,102,97,117,108,116,104,105,109,115,101,108,102,100,
+101,116,97,105,108,115,99,111,110,116,101,110,116,115,117,112,112,111,114,116,
+115,116,97,114,116,101,100,109,101,115,115,97,103,101,115,117,99,99,101,115,115,
+102,97,115,104,105,111,110,60,116,105,116,108,101,62,99,111,117,110,116,114,121,
+97,99,99,111,117,110,116,99,114,101,97,116,101,100,115,116,111,114,105,101,115,
+114,101,115,117,108,116,115,114,117,110,110,105,110,103,112,114,111,99,101,115,
+115,119,114,105,116,105,110,103,111,98,106,101,99,116,115,118,105,115,105,98,108
+,101,119,101,108,99,111,109,101,97,114,116,105,99,108,101,117,110,107,110,111,
+119,110,110,101,116,119,111,114,107,99,111,109,112,97,110,121,100,121,110,97,109
+,105,99,98,114,111,119,115,101,114,112,114,105,118,97,99,121,112,114,111,98,108,
+101,109,83,101,114,118,105,99,101,114,101,115,112,101,99,116,100,105,115,112,108
+,97,121,114,101,113,117,101,115,116,114,101,115,101,114,118,101,119,101,98,115,
+105,116,101,104,105,115,116,111,114,121,102,114,105,101,110,100,115,111,112,116,
+105,111,110,115,119,111,114,107,105,110,103,118,101,114,115,105,111,110,109,105,
+108,108,105,111,110,99,104,97,110,110,101,108,119,105,110,100,111,119,46,97,100,
+100,114,101,115,115,118,105,115,105,116,101,100,119,101,97,116,104,101,114,99,
+111,114,114,101,99,116,112,114,111,100,117,99,116,101,100,105,114,101,99,116,102
+,111,114,119,97,114,100,121,111,117,32,99,97,110,114,101,109,111,118,101,100,115
+,117,98,106,101,99,116,99,111,110,116,114,111,108,97,114,99,104,105,118,101,99,
+117,114,114,101,110,116,114,101,97,100,105,110,103,108,105,98,114,97,114,121,108
+,105,109,105,116,101,100,109,97,110,97,103,101,114,102,117,114,116,104,101,114,
+115,117,109,109,97,114,121,109,97,99,104,105,110,101,109,105,110,117,116,101,115
+,112,114,105,118,97,116,101,99,111,110,116,101,120,116,112,114,111,103,114,97,
+109,115,111,99,105,101,116,121,110,117,109,98,101,114,115,119,114,105,116,116,
+101,110,101,110,97,98,108,101,100,116,114,105,103,103,101,114,115,111,117,114,99
+,101,115,108,111,97,100,105,110,103,101,108,101,109,101,110,116,112,97,114,116,
+110,101,114,102,105,110,97,108,108,121,112,101,114,102,101,99,116,109,101,97,110
+,105,110,103,115,121,115,116,101,109,115,107,101,101,112,105,110,103,99,117,108,
+116,117,114,101,38,113,117,111,116,59,44,106,111,117,114,110,97,108,112,114,111,
+106,101,99,116,115,117,114,102,97,99,101,115,38,113,117,111,116,59,101,120,112,
+105,114,101,115,114,101,118,105,101,119,115,98,97,108,97,110,99,101,69,110,103,
+108,105,115,104,67,111,110,116,101,110,116,116,104,114,111,117,103,104,80,108,
+101,97,115,101,32,111,112,105,110,105,111,110,99,111,110,116,97,99,116,97,118,
+101,114,97,103,101,112,114,105,109,97,114,121,118,105,108,108,97,103,101,83,112,
+97,110,105,115,104,103,97,108,108,101,114,121,100,101,99,108,105,110,101,109,101
+,101,116,105,110,103,109,105,115,115,105,111,110,112,111,112,117,108,97,114,113,
+117,97,108,105,116,121,109,101,97,115,117,114,101,103,101,110,101,114,97,108,115
+,112,101,99,105,101,115,115,101,115,115,105,111,110,115,101,99,116,105,111,110,
+119,114,105,116,101,114,115,99,111,117,110,116,101,114,105,110,105,116,105,97,
+108,114,101,112,111,114,116,115,102,105,103,117,114,101,115,109,101,109,98,101,
+114,115,104,111,108,100,105,110,103,100,105,115,112,117,116,101,101,97,114,108,
+105,101,114,101,120,112,114,101,115,115,100,105,103,105,116,97,108,112,105,99,
+116,117,114,101,65,110,111,116,104,101,114,109,97,114,114,105,101,100,116,114,97
+,102,102,105,99,108,101,97,100,105,110,103,99,104,97,110,103,101,100,99,101,110,
+116,114,97,108,118,105,99,116,111,114,121,105,109,97,103,101,115,47,114,101,97,
+115,111,110,115,115,116,117,100,105,101,115,102,101,97,116,117,114,101,108,105,
+115,116,105,110,103,109,117,115,116,32,98,101,115,99,104,111,111,108,115,86,101,
+114,115,105,111,110,117,115,117,97,108,108,121,101,112,105,115,111,100,101,112,
+108,97,121,105,110,103,103,114,111,119,105,110,103,111,98,118,105,111,117,115,
+111,118,101,114,108,97,121,112,114,101,115,101,110,116,97,99,116,105,111,110,115
+,60,47,117,108,62,13,10,119,114,97,112,112,101,114,97,108,114,101,97,100,121,99,
+101,114,116,97,105,110,114,101,97,108,105,116,121,115,116,111,114,97,103,101,97,
+110,111,116,104,101,114,100,101,115,107,116,111,112,111,102,102,101,114,101,100,
+112,97,116,116,101,114,110,117,110,117,115,117,97,108,68,105,103,105,116,97,108,
+99,97,112,105,116,97,108,87,101,98,115,105,116,101,102,97,105,108,117,114,101,99
+,111,110,110,101,99,116,114,101,100,117,99,101,100,65,110,100,114,111,105,100,
+100,101,99,97,100,101,115,114,101,103,117,108,97,114,32,38,97,109,112,59,32,97,
+110,105,109,97,108,115,114,101,108,101,97,115,101,65,117,116,111,109,97,116,103,
+101,116,116,105,110,103,109,101,116,104,111,100,115,110,111,116,104,105,110,103,
+80,111,112,117,108,97,114,99,97,112,116,105,111,110,108,101,116,116,101,114,115,
+99,97,112,116,117,114,101,115,99,105,101,110,99,101,108,105,99,101,110,115,101,
+99,104,97,110,103,101,115,69,110,103,108,97,110,100,61,49,38,97,109,112,59,72,
+105,115,116,111,114,121,32,61,32,110,101,119,32,67,101,110,116,114,97,108,117,
+112,100,97,116,101,100,83,112,101,99,105,97,108,78,101,116,119,111,114,107,114,
+101,113,117,105,114,101,99,111,109,109,101,110,116,119,97,114,110,105,110,103,67
+,111,108,108,101,103,101,116,111,111,108,98,97,114,114,101,109,97,105,110,115,98
+,101,99,97,117,115,101,101,108,101,99,116,101,100,68,101,117,116,115,99,104,102,
+105,110,97,110,99,101,119,111,114,107,101,114,115,113,117,105,99,107,108,121,98,
+101,116,119,101,101,110,101,120,97,99,116,108,121,115,101,116,116,105,110,103,
+100,105,115,101,97,115,101,83,111,99,105,101,116,121,119,101,97,112,111,110,115,
+101,120,104,105,98,105,116,38,108,116,59,33,45,45,67,111,110,116,114,111,108,99,
+108,97,115,115,101,115,99,111,118,101,114,101,100,111,117,116,108,105,110,101,97
+,116,116,97,99,107,115,100,101,118,105,99,101,115,40,119,105,110,100,111,119,112
+,117,114,112,111,115,101,116,105,116,108,101,61,34,77,111,98,105,108,101,32,107,
+105,108,108,105,110,103,115,104,111,119,105,110,103,73,116,97,108,105,97,110,100
+,114,111,112,112,101,100,104,101,97,118,105,108,121,101,102,102,101,99,116,115,
+45,49,39,93,41,59,10,99,111,110,102,105,114,109,67,117,114,114,101,110,116,97,
+100,118,97,110,99,101,115,104,97,114,105,110,103,111,112,101,110,105,110,103,100
+,114,97,119,105,110,103,98,105,108,108,105,111,110,111,114,100,101,114,101,100,
+71,101,114,109,97,110,121,114,101,108,97,116,101,100,60,47,102,111,114,109,62,
+105,110,99,108,117,100,101,119,104,101,116,104,101,114,100,101,102,105,110,101,
+100,83,99,105,101,110,99,101,99,97,116,97,108,111,103,65,114,116,105,99,108,101,
+98,117,116,116,111,110,115,108,97,114,103,101,115,116,117,110,105,102,111,114,
+109,106,111,117,114,110,101,121,115,105,100,101,98,97,114,67,104,105,99,97,103,
+111,104,111,108,105,100,97,121,71,101,110,101,114,97,108,112,97,115,115,97,103,
+101,44,38,113,117,111,116,59,97,110,105,109,97,116,101,102,101,101,108,105,110,
+103,97,114,114,105,118,101,100,112,97,115,115,105,110,103,110,97,116,117,114,97,
+108,114,111,117,103,104,108,121,46,10,10,84,104,101,32,98,117,116,32,110,111,116
+,100,101,110,115,105,116,121,66,114,105,116,97,105,110,67,104,105,110,101,115,
+101,108,97,99,107,32,111,102,116,114,105,98,117,116,101,73,114,101,108,97,110,
+100,34,32,100,97,116,97,45,102,97,99,116,111,114,115,114,101,99,101,105,118,101,
+116,104,97,116,32,105,115,76,105,98,114,97,114,121,104,117,115,98,97,110,100,105
+,110,32,102,97,99,116,97,102,102,97,105,114,115,67,104,97,114,108,101,115,114,97
+,100,105,99,97,108,98,114,111,117,103,104,116,102,105,110,100,105,110,103,108,97
+,110,100,105,110,103,58,108,97,110,103,61,34,114,101,116,117,114,110,32,108,101,
+97,100,101,114,115,112,108,97,110,110,101,100,112,114,101,109,105,117,109,112,97
+,99,107,97,103,101,65,109,101,114,105,99,97,69,100,105,116,105,111,110,93,38,113
+,117,111,116,59,77,101,115,115,97,103,101,110,101,101,100,32,116,111,118,97,108,
+117,101,61,34,99,111,109,112,108,101,120,108,111,111,107,105,110,103,115,116,97,
+116,105,111,110,98,101,108,105,101,118,101,115,109,97,108,108,101,114,45,109,111
+,98,105,108,101,114,101,99,111,114,100,115,119,97,110,116,32,116,111,107,105,110
+,100,32,111,102,70,105,114,101,102,111,120,121,111,117,32,97,114,101,115,105,109
+,105,108,97,114,115,116,117,100,105,101,100,109,97,120,105,109,117,109,104,101,
+97,100,105,110,103,114,97,112,105,100,108,121,99,108,105,109,97,116,101,107,105,
+110,103,100,111,109,101,109,101,114,103,101,100,97,109,111,117,110,116,115,102,
+111,117,110,100,101,100,112,105,111,110,101,101,114,102,111,114,109,117,108,97,
+100,121,110,97,115,116,121,104,111,119,32,116,111,32,83,117,112,112,111,114,116,
+114,101,118,101,110,117,101,101,99,111,110,111,109,121,82,101,115,117,108,116,
+115,98,114,111,116,104,101,114,115,111,108,100,105,101,114,108,97,114,103,101,
+108,121,99,97,108,108,105,110,103,46,38,113,117,111,116,59,65,99,99,111,117,110,
+116,69,100,119,97,114,100,32,115,101,103,109,101,110,116,82,111,98,101,114,116,
+32,101,102,102,111,114,116,115,80,97,99,105,102,105,99,108,101,97,114,110,101,
+100,117,112,32,119,105,116,104,104,101,105,103,104,116,58,119,101,32,104,97,118,
+101,65,110,103,101,108,101,115,110,97,116,105,111,110,115,95,115,101,97,114,99,
+104,97,112,112,108,105,101,100,97,99,113,117,105,114,101,109,97,115,115,105,118,
+101,103,114,97,110,116,101,100,58,32,102,97,108,115,101,116,114,101,97,116,101,
+100,98,105,103,103,101,115,116,98,101,110,101,102,105,116,100,114,105,118,105,
+110,103,83,116,117,100,105,101,115,109,105,110,105,109,117,109,112,101,114,104,
+97,112,115,109,111,114,110,105,110,103,115,101,108,108,105,110,103,105,115,32,
+117,115,101,100,114,101,118,101,114,115,101,118,97,114,105,97,110,116,32,114,111
+,108,101,61,34,109,105,115,115,105,110,103,97,99,104,105,101,118,101,112,114,111
+,109,111,116,101,115,116,117,100,101,110,116,115,111,109,101,111,110,101,101,120
+,116,114,101,109,101,114,101,115,116,111,114,101,98,111,116,116,111,109,58,101,
+118,111,108,118,101,100,97,108,108,32,116,104,101,115,105,116,101,109,97,112,101
+,110,103,108,105,115,104,119,97,121,32,116,111,32,32,65,117,103,117,115,116,115,
+121,109,98,111,108,115,67,111,109,112,97,110,121,109,97,116,116,101,114,115,109,
+117,115,105,99,97,108,97,103,97,105,110,115,116,115,101,114,118,105,110,103,125,
+41,40,41,59,13,10,112,97,121,109,101,110,116,116,114,111,117,98,108,101,99,111,
+110,99,101,112,116,99,111,109,112,97,114,101,112,97,114,101,110,116,115,112,108,
+97,121,101,114,115,114,101,103,105,111,110,115,109,111,110,105,116,111,114,32,39
+,39,84,104,101,32,119,105,110,110,105,110,103,101,120,112,108,111,114,101,97,100
+,97,112,116,101,100,71,97,108,108,101,114,121,112,114,111,100,117,99,101,97,98,
+105,108,105,116,121,101,110,104,97,110,99,101,99,97,114,101,101,114,115,41,46,32
+,84,104,101,32,99,111,108,108,101,99,116,83,101,97,114,99,104,32,97,110,99,105,
+101,110,116,101,120,105,115,116,101,100,102,111,111,116,101,114,32,104,97,110,
+100,108,101,114,112,114,105,110,116,101,100,99,111,110,115,111,108,101,69,97,115
+,116,101,114,110,101,120,112,111,114,116,115,119,105,110,100,111,119,115,67,104,
+97,110,110,101,108,105,108,108,101,103,97,108,110,101,117,116,114,97,108,115,117
+,103,103,101,115,116,95,104,101,97,100,101,114,115,105,103,110,105,110,103,46,
+104,116,109,108,34,62,115,101,116,116,108,101,100,119,101,115,116,101,114,110,99
+,97,117,115,105,110,103,45,119,101,98,107,105,116,99,108,97,105,109,101,100,74,
+117,115,116,105,99,101,99,104,97,112,116,101,114,118,105,99,116,105,109,115,84,
+104,111,109,97,115,32,109,111,122,105,108,108,97,112,114,111,109,105,115,101,112
+,97,114,116,105,101,115,101,100,105,116,105,111,110,111,117,116,115,105,100,101,
+58,102,97,108,115,101,44,104,117,110,100,114,101,100,79,108,121,109,112,105,99,
+95,98,117,116,116,111,110,97,117,116,104,111,114,115,114,101,97,99,104,101,100,
+99,104,114,111,110,105,99,100,101,109,97,110,100,115,115,101,99,111,110,100,115,
+112,114,111,116,101,99,116,97,100,111,112,116,101,100,112,114,101,112,97,114,101
+,110,101,105,116,104,101,114,103,114,101,97,116,108,121,103,114,101,97,116,101,
+114,111,118,101,114,97,108,108,105,109,112,114,111,118,101,99,111,109,109,97,110
+,100,115,112,101,99,105,97,108,115,101,97,114,99,104,46,119,111,114,115,104,105,
+112,102,117,110,100,105,110,103,116,104,111,117,103,104,116,104,105,103,104,101,
+115,116,105,110,115,116,101,97,100,117,116,105,108,105,116,121,113,117,97,114,
+116,101,114,67,117,108,116,117,114,101,116,101,115,116,105,110,103,99,108,101,97
+,114,108,121,101,120,112,111,115,101,100,66,114,111,119,115,101,114,108,105,98,
+101,114,97,108,125,32,99,97,116,99,104,80,114,111,106,101,99,116,101,120,97,109,
+112,108,101,104,105,100,101,40,41,59,70,108,111,114,105,100,97,97,110,115,119,
+101,114,115,97,108,108,111,119,101,100,69,109,112,101,114,111,114,100,101,102,
+101,110,115,101,115,101,114,105,111,117,115,102,114,101,101,100,111,109,83,101,
+118,101,114,97,108,45,98,117,116,116,111,110,70,117,114,116,104,101,114,111,117,
+116,32,111,102,32,33,61,32,110,117,108,108,116,114,97,105,110,101,100,68,101,110
+,109,97,114,107,118,111,105,100,40,48,41,47,97,108,108,46,106,115,112,114,101,
+118,101,110,116,82,101,113,117,101,115,116,83,116,101,112,104,101,110,10,10,87,
+104,101,110,32,111,98,115,101,114,118,101,60,47,104,50,62,13,10,77,111,100,101,
+114,110,32,112,114,111,118,105,100,101,34,32,97,108,116,61,34,98,111,114,100,101
+,114,115,46,10,10,70,111,114,32,10,10,77,97,110,121,32,97,114,116,105,115,116,
+115,112,111,119,101,114,101,100,112,101,114,102,111,114,109,102,105,99,116,105,
+111,110,116,121,112,101,32,111,102,109,101,100,105,99,97,108,116,105,99,107,101,
+116,115,111,112,112,111,115,101,100,67,111,117,110,99,105,108,119,105,116,110,
+101,115,115,106,117,115,116,105,99,101,71,101,111,114,103,101,32,66,101,108,103,
+105,117,109,46,46,46,60,47,97,62,116,119,105,116,116,101,114,110,111,116,97,98,
+108,121,119,97,105,116,105,110,103,119,97,114,102,97,114,101,32,79,116,104,101,
+114,32,114,97,110,107,105,110,103,112,104,114,97,115,101,115,109,101,110,116,105
+,111,110,115,117,114,118,105,118,101,115,99,104,111,108,97,114,60,47,112,62,13,
+10,32,67,111,117,110,116,114,121,105,103,110,111,114,101,100,108,111,115,115,32,
+111,102,106,117,115,116,32,97,115,71,101,111,114,103,105,97,115,116,114,97,110,
+103,101,60,104,101,97,100,62,60,115,116,111,112,112,101,100,49,39,93,41,59,13,10
+,105,115,108,97,110,100,115,110,111,116,97,98,108,101,98,111,114,100,101,114,58,
+108,105,115,116,32,111,102,99,97,114,114,105,101,100,49,48,48,44,48,48,48,60,47,
+104,51,62,10,32,115,101,118,101,114,97,108,98,101,99,111,109,101,115,115,101,108
+,101,99,116,32,119,101,100,100,105,110,103,48,48,46,104,116,109,108,109,111,110,
+97,114,99,104,111,102,102,32,116,104,101,116,101,97,99,104,101,114,104,105,103,
+104,108,121,32,98,105,111,108,111,103,121,108,105,102,101,32,111,102,111,114,32,
+101,118,101,110,114,105,115,101,32,111,102,38,114,97,113,117,111,59,112,108,117,
+115,111,110,101,104,117,110,116,105,110,103,40,116,104,111,117,103,104,68,111,
+117,103,108,97,115,106,111,105,110,105,110,103,99,105,114,99,108,101,115,70,111,
+114,32,116,104,101,65,110,99,105,101,110,116,86,105,101,116,110,97,109,118,101,
+104,105,99,108,101,115,117,99,104,32,97,115,99,114,121,115,116,97,108,118,97,108
+,117,101,32,61,87,105,110,100,111,119,115,101,110,106,111,121,101,100,97,32,115,
+109,97,108,108,97,115,115,117,109,101,100,60,97,32,105,100,61,34,102,111,114,101
+,105,103,110,32,65,108,108,32,114,105,104,111,119,32,116,104,101,68,105,115,112,
+108,97,121,114,101,116,105,114,101,100,104,111,119,101,118,101,114,104,105,100,
+100,101,110,59,98,97,116,116,108,101,115,115,101,101,107,105,110,103,99,97,98,
+105,110,101,116,119,97,115,32,110,111,116,108,111,111,107,32,97,116,99,111,110,
+100,117,99,116,103,101,116,32,116,104,101,74,97,110,117,97,114,121,104,97,112,
+112,101,110,115,116,117,114,110,105,110,103,97,58,104,111,118,101,114,79,110,108
+,105,110,101,32,70,114,101,110,99,104,32,108,97,99,107,105,110,103,116,121,112,
+105,99,97,108,101,120,116,114,97,99,116,101,110,101,109,105,101,115,101,118,101,
+110,32,105,102,103,101,110,101,114,97,116,100,101,99,105,100,101,100,97,114,101,
+32,110,111,116,47,115,101,97,114,99,104,98,101,108,105,101,102,115,45,105,109,97
+,103,101,58,108,111,99,97,116,101,100,115,116,97,116,105,99,46,108,111,103,105,
+110,34,62,99,111,110,118,101,114,116,118,105,111,108,101,110,116,101,110,116,101
+,114,101,100,102,105,114,115,116,34,62,99,105,114,99,117,105,116,70,105,110,108,
+97,110,100,99,104,101,109,105,115,116,115,104,101,32,119,97,115,49,48,112,120,59
+,34,62,97,115,32,115,117,99,104,100,105,118,105,100,101,100,60,47,115,112,97,110
+,62,119,105,108,108,32,98,101,108,105,110,101,32,111,102,97,32,103,114,101,97,
+116,109,121,115,116,101,114,121,47,105,110,100,101,120,46,102,97,108,108,105,110
+,103,100,117,101,32,116,111,32,114,97,105,108,119,97,121,99,111,108,108,101,103,
+101,109,111,110,115,116,101,114,100,101,115,99,101,110,116,105,116,32,119,105,
+116,104,110,117,99,108,101,97,114,74,101,119,105,115,104,32,112,114,111,116,101,
+115,116,66,114,105,116,105,115,104,102,108,111,119,101,114,115,112,114,101,100,
+105,99,116,114,101,102,111,114,109,115,98,117,116,116,111,110,32,119,104,111,32,
+119,97,115,108,101,99,116,117,114,101,105,110,115,116,97,110,116,115,117,105,99,
+105,100,101,103,101,110,101,114,105,99,112,101,114,105,111,100,115,109,97,114,
+107,101,116,115,83,111,99,105,97,108,32,102,105,115,104,105,110,103,99,111,109,
+98,105,110,101,103,114,97,112,104,105,99,119,105,110,110,101,114,115,60,98,114,
+32,47,62,60,98,121,32,116,104,101,32,78,97,116,117,114,97,108,80,114,105,118,97,
+99,121,99,111,111,107,105,101,115,111,117,116,99,111,109,101,114,101,115,111,108
+,118,101,83,119,101,100,105,115,104,98,114,105,101,102,108,121,80,101,114,115,
+105,97,110,115,111,32,109,117,99,104,67,101,110,116,117,114,121,100,101,112,105,
+99,116,115,99,111,108,117,109,110,115,104,111,117,115,105,110,103,115,99,114,105
+,112,116,115,110,101,120,116,32,116,111,98,101,97,114,105,110,103,109,97,112,112
+,105,110,103,114,101,118,105,115,101,100,106,81,117,101,114,121,40,45,119,105,
+100,116,104,58,116,105,116,108,101,34,62,116,111,111,108,116,105,112,83,101,99,
+116,105,111,110,100,101,115,105,103,110,115,84,117,114,107,105,115,104,121,111,
+117,110,103,101,114,46,109,97,116,99,104,40,125,41,40,41,59,10,10,98,117,114,110
+,105,110,103,111,112,101,114,97,116,101,100,101,103,114,101,101,115,115,111,117,
+114,99,101,61,82,105,99,104,97,114,100,99,108,111,115,101,108,121,112,108,97,115
+,116,105,99,101,110,116,114,105,101,115,60,47,116,114,62,13,10,99,111,108,111,
+114,58,35,117,108,32,105,100,61,34,112,111,115,115,101,115,115,114,111,108,108,
+105,110,103,112,104,121,115,105,99,115,102,97,105,108,105,110,103,101,120,101,99
+,117,116,101,99,111,110,116,101,115,116,108,105,110,107,32,116,111,68,101,102,97
+,117,108,116,60,98,114,32,47,62,10,58,32,116,114,117,101,44,99,104,97,114,116,
+101,114,116,111,117,114,105,115,109,99,108,97,115,115,105,99,112,114,111,99,101,
+101,100,101,120,112,108,97,105,110,60,47,104,49,62,13,10,111,110,108,105,110,101
+,46,63,120,109,108,32,118,101,104,101,108,112,105,110,103,100,105,97,109,111,110
+,100,117,115,101,32,116,104,101,97,105,114,108,105,110,101,101,110,100,32,45,45,
+62,41,46,97,116,116,114,40,114,101,97,100,101,114,115,104,111,115,116,105,110,
+103,35,102,102,102,102,102,102,114,101,97,108,105,122,101,86,105,110,99,101,110,
+116,115,105,103,110,97,108,115,32,115,114,99,61,34,47,80,114,111,100,117,99,116,
+100,101,115,112,105,116,101,100,105,118,101,114,115,101,116,101,108,108,105,110,
+103,80,117,98,108,105,99,32,104,101,108,100,32,105,110,74,111,115,101,112,104,32
+,116,104,101,97,116,114,101,97,102,102,101,99,116,115,60,115,116,121,108,101,62,
+97,32,108,97,114,103,101,100,111,101,115,110,39,116,108,97,116,101,114,44,32,69,
+108,101,109,101,110,116,102,97,118,105,99,111,110,99,114,101,97,116,111,114,72,
+117,110,103,97,114,121,65,105,114,112,111,114,116,115,101,101,32,116,104,101,115
+,111,32,116,104,97,116,77,105,99,104,97,101,108,83,121,115,116,101,109,115,80,
+114,111,103,114,97,109,115,44,32,97,110,100,32,32,119,105,100,116,104,61,101,38,
+113,117,111,116,59,116,114,97,100,105,110,103,108,101,102,116,34,62,10,112,101,
+114,115,111,110,115,71,111,108,100,101,110,32,65,102,102,97,105,114,115,103,114,
+97,109,109,97,114,102,111,114,109,105,110,103,100,101,115,116,114,111,121,105,
+100,101,97,32,111,102,99,97,115,101,32,111,102,111,108,100,101,115,116,32,116,
+104,105,115,32,105,115,46,115,114,99,32,61,32,99,97,114,116,111,111,110,114,101,
+103,105,115,116,114,67,111,109,109,111,110,115,77,117,115,108,105,109,115,87,104
+,97,116,32,105,115,105,110,32,109,97,110,121,109,97,114,107,105,110,103,114,101,
+118,101,97,108,115,73,110,100,101,101,100,44,101,113,117,97,108,108,121,47,115,
+104,111,119,95,97,111,117,116,100,111,111,114,101,115,99,97,112,101,40,65,117,
+115,116,114,105,97,103,101,110,101,116,105,99,115,121,115,116,101,109,44,73,110,
+32,116,104,101,32,115,105,116,116,105,110,103,72,101,32,97,108,115,111,73,115,
+108,97,110,100,115,65,99,97,100,101,109,121,10,9,9,60,33,45,45,68,97,110,105,101
+,108,32,98,105,110,100,105,110,103,98,108,111,99,107,34,62,105,109,112,111,115,
+101,100,117,116,105,108,105,122,101,65,98,114,97,104,97,109,40,101,120,99,101,
+112,116,123,119,105,100,116,104,58,112,117,116,116,105,110,103,41,46,104,116,109
+,108,40,124,124,32,91,93,59,10,68,65,84,65,91,32,42,107,105,116,99,104,101,110,
+109,111,117,110,116,101,100,97,99,116,117,97,108,32,100,105,97,108,101,99,116,
+109,97,105,110,108,121,32,95,98,108,97,110,107,39,105,110,115,116,97,108,108,101
+,120,112,101,114,116,115,105,102,40,116,121,112,101,73,116,32,97,108,115,111,38,
+99,111,112,121,59,32,34,62,84,101,114,109,115,98,111,114,110,32,105,110,79,112,
+116,105,111,110,115,101,97,115,116,101,114,110,116,97,108,107,105,110,103,99,111
+,110,99,101,114,110,103,97,105,110,101,100,32,111,110,103,111,105,110,103,106,
+117,115,116,105,102,121,99,114,105,116,105,99,115,102,97,99,116,111,114,121,105,
+116,115,32,111,119,110,97,115,115,97,117,108,116,105,110,118,105,116,101,100,108
+,97,115,116,105,110,103,104,105,115,32,111,119,110,104,114,101,102,61,34,47,34,
+32,114,101,108,61,34,100,101,118,101,108,111,112,99,111,110,99,101,114,116,100,
+105,97,103,114,97,109,100,111,108,108,97,114,115,99,108,117,115,116,101,114,112,
+104,112,63,105,100,61,97,108,99,111,104,111,108,41,59,125,41,40,41,59,117,115,
+105,110,103,32,97,62,60,115,112,97,110,62,118,101,115,115,101,108,115,114,101,
+118,105,118,97,108,65,100,100,114,101,115,115,97,109,97,116,101,117,114,97,110,
+100,114,111,105,100,97,108,108,101,103,101,100,105,108,108,110,101,115,115,119,
+97,108,107,105,110,103,99,101,110,116,101,114,115,113,117,97,108,105,102,121,109
+,97,116,99,104,101,115,117,110,105,102,105,101,100,101,120,116,105,110,99,116,68
+,101,102,101,110,115,101,100,105,101,100,32,105,110,10,9,60,33,45,45,32,99,117,
+115,116,111,109,115,108,105,110,107,105,110,103,76,105,116,116,108,101,32,66,111
+,111,107,32,111,102,101,118,101,110,105,110,103,109,105,110,46,106,115,63,97,114
+,101,32,116,104,101,107,111,110,116,97,107,116,116,111,100,97,121,39,115,46,104,
+116,109,108,34,32,116,97,114,103,101,116,61,119,101,97,114,105,110,103,65,108,
+108,32,82,105,103,59,10,125,41,40,41,59,114,97,105,115,105,110,103,32,65,108,115
+,111,44,32,99,114,117,99,105,97,108,97,98,111,117,116,34,62,100,101,99,108,97,
+114,101,45,45,62,10,60,115,99,102,105,114,101,102,111,120,97,115,32,109,117,99,
+104,97,112,112,108,105,101,115,105,110,100,101,120,44,32,115,44,32,98,117,116,32
+,116,121,112,101,32,61,32,10,13,10,60,33,45,45,116,111,119,97,114,100,115,82,101
+,99,111,114,100,115,80,114,105,118,97,116,101,70,111,114,101,105,103,110,80,114,
+101,109,105,101,114,99,104,111,105,99,101,115,86,105,114,116,117,97,108,114,101,
+116,117,114,110,115,67,111,109,109,101,110,116,80,111,119,101,114,101,100,105,
+110,108,105,110,101,59,112,111,118,101,114,116,121,99,104,97,109,98,101,114,76,
+105,118,105,110,103,32,118,111,108,117,109,101,115,65,110,116,104,111,110,121,
+108,111,103,105,110,34,32,82,101,108,97,116,101,100,69,99,111,110,111,109,121,
+114,101,97,99,104,101,115,99,117,116,116,105,110,103,103,114,97,118,105,116,121,
+108,105,102,101,32,105,110,67,104,97,112,116,101,114,45,115,104,97,100,111,119,
+78,111,116,97,98,108,101,60,47,116,100,62,13,10,32,114,101,116,117,114,110,115,
+116,97,100,105,117,109,119,105,100,103,101,116,115,118,97,114,121,105,110,103,
+116,114,97,118,101,108,115,104,101,108,100,32,98,121,119,104,111,32,97,114,101,
+119,111,114,107,32,105,110,102,97,99,117,108,116,121,97,110,103,117,108,97,114,
+119,104,111,32,104,97,100,97,105,114,112,111,114,116,116,111,119,110,32,111,102,
+10,10,83,111,109,101,32,39,99,108,105,99,107,39,99,104,97,114,103,101,115,107,
+101,121,119,111,114,100,105,116,32,119,105,108,108,99,105,116,121,32,111,102,40,
+116,104,105,115,41,59,65,110,100,114,101,119,32,117,110,105,113,117,101,32,99,
+104,101,99,107,101,100,111,114,32,109,111,114,101,51,48,48,112,120,59,32,114,101
+,116,117,114,110,59,114,115,105,111,110,61,34,112,108,117,103,105,110,115,119,
+105,116,104,105,110,32,104,101,114,115,101,108,102,83,116,97,116,105,111,110,70,
+101,100,101,114,97,108,118,101,110,116,117,114,101,112,117,98,108,105,115,104,
+115,101,110,116,32,116,111,116,101,110,115,105,111,110,97,99,116,114,101,115,115
+,99,111,109,101,32,116,111,102,105,110,103,101,114,115,68,117,107,101,32,111,102
+,112,101,111,112,108,101,44,101,120,112,108,111,105,116,119,104,97,116,32,105,
+115,104,97,114,109,111,110,121,97,32,109,97,106,111,114,34,58,34,104,116,116,112
+,105,110,32,104,105,115,32,109,101,110,117,34,62,10,109,111,110,116,104,108,121,
+111,102,102,105,99,101,114,99,111,117,110,99,105,108,103,97,105,110,105,110,103,
+101,118,101,110,32,105,110,83,117,109,109,97,114,121,100,97,116,101,32,111,102,
+108,111,121,97,108,116,121,102,105,116,110,101,115,115,97,110,100,32,119,97,115,
+101,109,112,101,114,111,114,115,117,112,114,101,109,101,83,101,99,111,110,100,32
+,104,101,97,114,105,110,103,82,117,115,115,105,97,110,108,111,110,103,101,115,
+116,65,108,98,101,114,116,97,108,97,116,101,114,97,108,115,101,116,32,111,102,32
+,115,109,97,108,108,34,62,46,97,112,112,101,110,100,100,111,32,119,105,116,104,
+102,101,100,101,114,97,108,98,97,110,107,32,111,102,98,101,110,101,97,116,104,68
+,101,115,112,105,116,101,67,97,112,105,116,97,108,103,114,111,117,110,100,115,41
+,44,32,97,110,100,32,112,101,114,99,101,110,116,105,116,32,102,114,111,109,99,
+108,111,115,105,110,103,99,111,110,116,97,105,110,73,110,115,116,101,97,100,102,
+105,102,116,101,101,110,97,115,32,119,101,108,108,46,121,97,104,111,111,46,114,
+101,115,112,111,110,100,102,105,103,104,116,101,114,111,98,115,99,117,114,101,
+114,101,102,108,101,99,116,111,114,103,97,110,105,99,61,32,77,97,116,104,46,101,
+100,105,116,105,110,103,111,110,108,105,110,101,32,112,97,100,100,105,110,103,97
+,32,119,104,111,108,101,111,110,101,114,114,111,114,121,101,97,114,32,111,102,
+101,110,100,32,111,102,32,98,97,114,114,105,101,114,119,104,101,110,32,105,116,
+104,101,97,100,101,114,32,104,111,109,101,32,111,102,114,101,115,117,109,101,100
+,114,101,110,97,109,101,100,115,116,114,111,110,103,62,104,101,97,116,105,110,
+103,114,101,116,97,105,110,115,99,108,111,117,100,102,114,119,97,121,32,111,102,
+32,77,97,114,99,104,32,49,107,110,111,119,105,110,103,105,110,32,112,97,114,116,
+66,101,116,119,101,101,110,108,101,115,115,111,110,115,99,108,111,115,101,115,
+116,118,105,114,116,117,97,108,108,105,110,107,115,34,62,99,114,111,115,115,101,
+100,69,78,68,32,45,45,62,102,97,109,111,117,115,32,97,119,97,114,100,101,100,76,
+105,99,101,110,115,101,72,101,97,108,116,104,32,102,97,105,114,108,121,32,119,
+101,97,108,116,104,121,109,105,110,105,109,97,108,65,102,114,105,99,97,110,99,
+111,109,112,101,116,101,108,97,98,101,108,34,62,115,105,110,103,105,110,103,102,
+97,114,109,101,114,115,66,114,97,115,105,108,41,100,105,115,99,117,115,115,114,
+101,112,108,97,99,101,71,114,101,103,111,114,121,102,111,110,116,32,99,111,112,
+117,114,115,117,101,100,97,112,112,101,97,114,115,109,97,107,101,32,117,112,114,
+111,117,110,100,101,100,98,111,116,104,32,111,102,98,108,111,99,107,101,100,115,
+97,119,32,116,104,101,111,102,102,105,99,101,115,99,111,108,111,117,114,115,105,
+102,40,100,111,99,117,119,104,101,110,32,104,101,101,110,102,111,114,99,101,112,
+117,115,104,40,102,117,65,117,103,117,115,116,32,85,84,70,45,56,34,62,70,97,110,
+116,97,115,121,105,110,32,109,111,115,116,105,110,106,117,114,101,100,85,115,117
+,97,108,108,121,102,97,114,109,105,110,103,99,108,111,115,117,114,101,111,98,106
+,101,99,116,32,100,101,102,101,110,99,101,117,115,101,32,111,102,32,77,101,100,
+105,99,97,108,60,98,111,100,121,62,10,101,118,105,100,101,110,116,98,101,32,117,
+115,101,100,107,101,121,67,111,100,101,115,105,120,116,101,101,110,73,115,108,97
+,109,105,99,35,48,48,48,48,48,48,101,110,116,105,114,101,32,119,105,100,101,108,
+121,32,97,99,116,105,118,101,32,40,116,121,112,101,111,102,111,110,101,32,99,97,
+110,99,111,108,111,114,32,61,115,112,101,97,107,101,114,101,120,116,101,110,100,
+115,80,104,121,115,105,99,115,116,101,114,114,97,105,110,60,116,98,111,100,121,
+62,102,117,110,101,114,97,108,118,105,101,119,105,110,103,109,105,100,100,108,
+101,32,99,114,105,99,107,101,116,112,114,111,112,104,101,116,115,104,105,102,116
+,101,100,100,111,99,116,111,114,115,82,117,115,115,101,108,108,32,116,97,114,103
+,101,116,99,111,109,112,97,99,116,97,108,103,101,98,114,97,115,111,99,105,97,108
+,45,98,117,108,107,32,111,102,109,97,110,32,97,110,100,60,47,116,100,62,10,32,
+104,101,32,108,101,102,116,41,46,118,97,108,40,41,102,97,108,115,101,41,59,108,
+111,103,105,99,97,108,98,97,110,107,105,110,103,104,111,109,101,32,116,111,110,
+97,109,105,110,103,32,65,114,105,122,111,110,97,99,114,101,100,105,116,115,41,59
+,10,125,41,59,10,102,111,117,110,100,101,114,105,110,32,116,117,114,110,67,111,
+108,108,105,110,115,98,101,102,111,114,101,32,66,117,116,32,116,104,101,99,104,
+97,114,103,101,100,84,105,116,108,101,34,62,67,97,112,116,97,105,110,115,112,101
+,108,108,101,100,103,111,100,100,101,115,115,84,97,103,32,45,45,62,65,100,100,
+105,110,103,58,98,117,116,32,119,97,115,82,101,99,101,110,116,32,112,97,116,105,
+101,110,116,98,97,99,107,32,105,110,61,102,97,108,115,101,38,76,105,110,99,111,
+108,110,119,101,32,107,110,111,119,67,111,117,110,116,101,114,74,117,100,97,105,
+115,109,115,99,114,105,112,116,32,97,108,116,101,114,101,100,39,93,41,59,10,32,
+32,104,97,115,32,116,104,101,117,110,99,108,101,97,114,69,118,101,110,116,39,44,
+98,111,116,104,32,105,110,110,111,116,32,97,108,108,10,10,60,33,45,45,32,112,108
+,97,99,105,110,103,104,97,114,100,32,116,111,32,99,101,110,116,101,114,115,111,
+114,116,32,111,102,99,108,105,101,110,116,115,115,116,114,101,101,116,115,66,101
+,114,110,97,114,100,97,115,115,101,114,116,115,116,101,110,100,32,116,111,102,97
+,110,116,97,115,121,100,111,119,110,32,105,110,104,97,114,98,111,117,114,70,114,
+101,101,100,111,109,106,101,119,101,108,114,121,47,97,98,111,117,116,46,46,115,
+101,97,114,99,104,108,101,103,101,110,100,115,105,115,32,109,97,100,101,109,111,
+100,101,114,110,32,111,110,108,121,32,111,110,111,110,108,121,32,116,111,105,109
+,97,103,101,34,32,108,105,110,101,97,114,32,112,97,105,110,116,101,114,97,110,
+100,32,110,111,116,114,97,114,101,108,121,32,97,99,114,111,110,121,109,100,101,
+108,105,118,101,114,115,104,111,114,116,101,114,48,48,38,97,109,112,59,97,115,32
+,109,97,110,121,119,105,100,116,104,61,34,47,42,32,60,33,91,67,116,105,116,108,
+101,32,61,111,102,32,116,104,101,32,108,111,119,101,115,116,32,112,105,99,107,
+101,100,32,101,115,99,97,112,101,100,117,115,101,115,32,111,102,112,101,111,112,
+108,101,115,32,80,117,98,108,105,99,77,97,116,116,104,101,119,116,97,99,116,105,
+99,115,100,97,109,97,103,101,100,119,97,121,32,102,111,114,108,97,119,115,32,111
+,102,101,97,115,121,32,116,111,32,119,105,110,100,111,119,115,116,114,111,110,
+103,32,32,115,105,109,112,108,101,125,99,97,116,99,104,40,115,101,118,101,110,
+116,104,105,110,102,111,98,111,120,119,101,110,116,32,116,111,112,97,105,110,116
+,101,100,99,105,116,105,122,101,110,73,32,100,111,110,39,116,114,101,116,114,101
+,97,116,46,32,83,111,109,101,32,119,119,46,34,41,59,10,98,111,109,98,105,110,103
+,109,97,105,108,116,111,58,109,97,100,101,32,105,110,46,32,77,97,110,121,32,99,
+97,114,114,105,101,115,124,124,123,125,59,119,105,119,111,114,107,32,111,102,115
+,121,110,111,110,121,109,100,101,102,101,97,116,115,102,97,118,111,114,101,100,
+111,112,116,105,99,97,108,112,97,103,101,84,114,97,117,110,108,101,115,115,32,
+115,101,110,100,105,110,103,108,101,102,116,34,62,60,99,111,109,83,99,111,114,65
+,108,108,32,116,104,101,106,81,117,101,114,121,46,116,111,117,114,105,115,116,67
+,108,97,115,115,105,99,102,97,108,115,101,34,32,87,105,108,104,101,108,109,115,
+117,98,117,114,98,115,103,101,110,117,105,110,101,98,105,115,104,111,112,115,46,
+115,112,108,105,116,40,103,108,111,98,97,108,32,102,111,108,108,111,119,115,98,
+111,100,121,32,111,102,110,111,109,105,110,97,108,67,111,110,116,97,99,116,115,
+101,99,117,108,97,114,108,101,102,116,32,116,111,99,104,105,101,102,108,121,45,
+104,105,100,100,101,110,45,98,97,110,110,101,114,60,47,108,105,62,10,10,46,32,87
+,104,101,110,32,105,110,32,98,111,116,104,100,105,115,109,105,115,115,69,120,112
+,108,111,114,101,97,108,119,97,121,115,32,118,105,97,32,116,104,101,115,112,97,
+195,177,111,108,119,101,108,102,97,114,101,114,117,108,105,110,103,32,97,114,114
+,97,110,103,101,99,97,112,116,97,105,110,104,105,115,32,115,111,110,114,117,108,
+101,32,111,102,104,101,32,116,111,111,107,105,116,115,101,108,102,44,61,48,38,97
+,109,112,59,40,99,97,108,108,101,100,115,97,109,112,108,101,115,116,111,32,109,
+97,107,101,99,111,109,47,112,97,103,77,97,114,116,105,110,32,75,101,110,110,101,
+100,121,97,99,99,101,112,116,115,102,117,108,108,32,111,102,104,97,110,100,108,
+101,100,66,101,115,105,100,101,115,47,47,45,45,62,60,47,97,98,108,101,32,116,111
+,116,97,114,103,101,116,115,101,115,115,101,110,99,101,104,105,109,32,116,111,32
+,105,116,115,32,98,121,32,99,111,109,109,111,110,46,109,105,110,101,114,97,108,
+116,111,32,116,97,107,101,119,97,121,115,32,116,111,115,46,111,114,103,47,108,97
+,100,118,105,115,101,100,112,101,110,97,108,116,121,115,105,109,112,108,101,58,
+105,102,32,116,104,101,121,76,101,116,116,101,114,115,97,32,115,104,111,114,116,
+72,101,114,98,101,114,116,115,116,114,105,107,101,115,32,103,114,111,117,112,115
+,46,108,101,110,103,116,104,102,108,105,103,104,116,115,111,118,101,114,108,97,
+112,115,108,111,119,108,121,32,108,101,115,115,101,114,32,115,111,99,105,97,108,
+32,60,47,112,62,10,9,9,105,116,32,105,110,116,111,114,97,110,107,101,100,32,114,
+97,116,101,32,111,102,117,108,62,13,10,32,32,97,116,116,101,109,112,116,112,97,
+105,114,32,111,102,109,97,107,101,32,105,116,75,111,110,116,97,107,116,65,110,
+116,111,110,105,111,104,97,118,105,110,103,32,114,97,116,105,110,103,115,32,97,
+99,116,105,118,101,115,116,114,101,97,109,115,116,114,97,112,112,101,100,34,41,
+46,99,115,115,40,104,111,115,116,105,108,101,108,101,97,100,32,116,111,108,105,
+116,116,108,101,32,103,114,111,117,112,115,44,80,105,99,116,117,114,101,45,45,62
+,13,10,13,10,32,114,111,119,115,61,34,32,111,98,106,101,99,116,105,110,118,101,
+114,115,101,60,102,111,111,116,101,114,67,117,115,116,111,109,86,62,60,92,47,115
+,99,114,115,111,108,118,105,110,103,67,104,97,109,98,101,114,115,108,97,118,101,
+114,121,119,111,117,110,100,101,100,119,104,101,114,101,97,115,33,61,32,39,117,
+110,100,102,111,114,32,97,108,108,112,97,114,116,108,121,32,45,114,105,103,104,
+116,58,65,114,97,98,105,97,110,98,97,99,107,101,100,32,99,101,110,116,117,114,
+121,117,110,105,116,32,111,102,109,111,98,105,108,101,45,69,117,114,111,112,101,
+44,105,115,32,104,111,109,101,114,105,115,107,32,111,102,100,101,115,105,114,101
+,100,67,108,105,110,116,111,110,99,111,115,116,32,111,102,97,103,101,32,111,102,
+32,98,101,99,111,109,101,32,110,111,110,101,32,111,102,112,38,113,117,111,116,59
+,77,105,100,100,108,101,32,101,97,100,39,41,91,48,67,114,105,116,105,99,115,115,
+116,117,100,105,111,115,62,38,99,111,112,121,59,103,114,111,117,112,34,62,97,115
+,115,101,109,98,108,109,97,107,105,110,103,32,112,114,101,115,115,101,100,119,
+105,100,103,101,116,46,112,115,58,34,32,63,32,114,101,98,117,105,108,116,98,121,
+32,115,111,109,101,70,111,114,109,101,114,32,101,100,105,116,111,114,115,100,101
+,108,97,121,101,100,67,97,110,111,110,105,99,104,97,100,32,116,104,101,112,117,
+115,104,105,110,103,99,108,97,115,115,61,34,98,117,116,32,97,114,101,112,97,114,
+116,105,97,108,66,97,98,121,108,111,110,98,111,116,116,111,109,32,99,97,114,114,
+105,101,114,67,111,109,109,97,110,100,105,116,115,32,117,115,101,65,115,32,119,
+105,116,104,99,111,117,114,115,101,115,97,32,116,104,105,114,100,100,101,110,111
+,116,101,115,97,108,115,111,32,105,110,72,111,117,115,116,111,110,50,48,112,120,
+59,34,62,97,99,99,117,115,101,100,100,111,117,98,108,101,32,103,111,97,108,32,
+111,102,70,97,109,111,117,115,32,41,46,98,105,110,100,40,112,114,105,101,115,116
+,115,32,79,110,108,105,110,101,105,110,32,74,117,108,121,115,116,32,43,32,34,103
+,99,111,110,115,117,108,116,100,101,99,105,109,97,108,104,101,108,112,102,117,
+108,114,101,118,105,118,101,100,105,115,32,118,101,114,121,114,39,43,39,105,112,
+116,108,111,115,105,110,103,32,102,101,109,97,108,101,115,105,115,32,97,108,115,
+111,115,116,114,105,110,103,115,100,97,121,115,32,111,102,97,114,114,105,118,97,
+108,102,117,116,117,114,101,32,60,111,98,106,101,99,116,102,111,114,99,105,110,
+103,83,116,114,105,110,103,40,34,32,47,62,10,9,9,104,101,114,101,32,105,115,101,
+110,99,111,100,101,100,46,32,32,84,104,101,32,98,97,108,108,111,111,110,100,111,
+110,101,32,98,121,47,99,111,109,109,111,110,98,103,99,111,108,111,114,108,97,119
+,32,111,102,32,73,110,100,105,97,110,97,97,118,111,105,100,101,100,98,117,116,32
+,116,104,101,50,112,120,32,51,112,120,106,113,117,101,114,121,46,97,102,116,101,
+114,32,97,112,111,108,105,99,121,46,109,101,110,32,97,110,100,102,111,111,116,
+101,114,45,61,32,116,114,117,101,59,102,111,114,32,117,115,101,115,99,114,101,
+101,110,46,73,110,100,105,97,110,32,105,109,97,103,101,32,61,102,97,109,105,108,
+121,44,104,116,116,112,58,47,47,32,38,110,98,115,112,59,100,114,105,118,101,114,
+115,101,116,101,114,110,97,108,115,97,109,101,32,97,115,110,111,116,105,99,101,
+100,118,105,101,119,101,114,115,125,41,40,41,59,10,32,105,115,32,109,111,114,101
+,115,101,97,115,111,110,115,102,111,114,109,101,114,32,116,104,101,32,110,101,
+119,105,115,32,106,117,115,116,99,111,110,115,101,110,116,32,83,101,97,114,99,
+104,119,97,115,32,116,104,101,119,104,121,32,116,104,101,115,104,105,112,112,101
+,100,98,114,62,60,98,114,62,119,105,100,116,104,58,32,104,101,105,103,104,116,61
+,109,97,100,101,32,111,102,99,117,105,115,105,110,101,105,115,32,116,104,97,116,
+97,32,118,101,114,121,32,65,100,109,105,114,97,108,32,102,105,120,101,100,59,110
+,111,114,109,97,108,32,77,105,115,115,105,111,110,80,114,101,115,115,44,32,111,
+110,116,97,114,105,111,99,104,97,114,115,101,116,116,114,121,32,116,111,32,105,
+110,118,97,100,101,100,61,34,116,114,117,101,34,115,112,97,99,105,110,103,105,
+115,32,109,111,115,116,97,32,109,111,114,101,32,116,111,116,97,108,108,121,102,
+97,108,108,32,111,102,125,41,59,13,10,32,32,105,109,109,101,110,115,101,116,105,
+109,101,32,105,110,115,101,116,32,111,117,116,115,97,116,105,115,102,121,116,111
+,32,102,105,110,100,100,111,119,110,32,116,111,108,111,116,32,111,102,32,80,108,
+97,121,101,114,115,105,110,32,74,117,110,101,113,117,97,110,116,117,109,110,111,
+116,32,116,104,101,116,105,109,101,32,116,111,100,105,115,116,97,110,116,70,105,
+110,110,105,115,104,115,114,99,32,61,32,40,115,105,110,103,108,101,32,104,101,
+108,112,32,111,102,71,101,114,109,97,110,32,108,97,119,32,97,110,100,108,97,98,
+101,108,101,100,102,111,114,101,115,116,115,99,111,111,107,105,110,103,115,112,
+97,99,101,34,62,104,101,97,100,101,114,45,119,101,108,108,32,97,115,83,116,97,
+110,108,101,121,98,114,105,100,103,101,115,47,103,108,111,98,97,108,67,114,111,
+97,116,105,97,32,65,98,111,117,116,32,91,48,93,59,10,32,32,105,116,44,32,97,110,
+100,103,114,111,117,112,101,100,98,101,105,110,103,32,97,41,123,116,104,114,111,
+119,104,101,32,109,97,100,101,108,105,103,104,116,101,114,101,116,104,105,99,97,
+108,70,70,70,70,70,70,34,98,111,116,116,111,109,34,108,105,107,101,32,97,32,101,
+109,112,108,111,121,115,108,105,118,101,32,105,110,97,115,32,115,101,101,110,112
+,114,105,110,116,101,114,109,111,115,116,32,111,102,117,98,45,108,105,110,107,
+114,101,106,101,99,116,115,97,110,100,32,117,115,101,105,109,97,103,101,34,62,
+115,117,99,99,101,101,100,102,101,101,100,105,110,103,78,117,99,108,101,97,114,
+105,110,102,111,114,109,97,116,111,32,104,101,108,112,87,111,109,101,110,39,115,
+78,101,105,116,104,101,114,77,101,120,105,99,97,110,112,114,111,116,101,105,110,
+60,116,97,98,108,101,32,98,121,32,109,97,110,121,104,101,97,108,116,104,121,108,
+97,119,115,117,105,116,100,101,118,105,115,101,100,46,112,117,115,104,40,123,115
+,101,108,108,101,114,115,115,105,109,112,108,121,32,84,104,114,111,117,103,104,
+46,99,111,111,107,105,101,32,73,109,97,103,101,40,111,108,100,101,114,34,62,117,
+115,46,106,115,34,62,32,83,105,110,99,101,32,117,110,105,118,101,114,115,108,97,
+114,103,101,114,32,111,112,101,110,32,116,111,33,45,45,32,101,110,100,108,105,
+101,115,32,105,110,39,93,41,59,13,10,32,32,109,97,114,107,101,116,119,104,111,32
+,105,115,32,40,34,68,79,77,67,111,109,97,110,97,103,101,100,111,110,101,32,102,
+111,114,116,121,112,101,111,102,32,75,105,110,103,100,111,109,112,114,111,102,
+105,116,115,112,114,111,112,111,115,101,116,111,32,115,104,111,119,99,101,110,
+116,101,114,59,109,97,100,101,32,105,116,100,114,101,115,115,101,100,119,101,114
+,101,32,105,110,109,105,120,116,117,114,101,112,114,101,99,105,115,101,97,114,
+105,115,105,110,103,115,114,99,32,61,32,39,109,97,107,101,32,97,32,115,101,99,
+117,114,101,100,66,97,112,116,105,115,116,118,111,116,105,110,103,32,10,9,9,118,
+97,114,32,77,97,114,99,104,32,50,103,114,101,119,32,117,112,67,108,105,109,97,
+116,101,46,114,101,109,111,118,101,115,107,105,108,108,101,100,119,97,121,32,116
+,104,101,60,47,104,101,97,100,62,102,97,99,101,32,111,102,97,99,116,105,110,103,
+32,114,105,103,104,116,34,62,116,111,32,119,111,114,107,114,101,100,117,99,101,
+115,104,97,115,32,104,97,100,101,114,101,99,116,101,100,115,104,111,119,40,41,59
+,97,99,116,105,111,110,61,98,111,111,107,32,111,102,97,110,32,97,114,101,97,61,
+61,32,34,104,116,116,60,104,101,97,100,101,114,10,60,104,116,109,108,62,99,111,
+110,102,111,114,109,102,97,99,105,110,103,32,99,111,111,107,105,101,46,114,101,
+108,121,32,111,110,104,111,115,116,101,100,32,46,99,117,115,116,111,109,104,101,
+32,119,101,110,116,98,117,116,32,102,111,114,115,112,114,101,97,100,32,70,97,109
+,105,108,121,32,97,32,109,101,97,110,115,111,117,116,32,116,104,101,102,111,114,
+117,109,115,46,102,111,111,116,97,103,101,34,62,77,111,98,105,108,67,108,101,109
+,101,110,116,115,34,32,105,100,61,34,97,115,32,104,105,103,104,105,110,116,101,
+110,115,101,45,45,62,60,33,45,45,102,101,109,97,108,101,32,105,115,32,115,101,
+101,110,105,109,112,108,105,101,100,115,101,116,32,116,104,101,97,32,115,116,97,
+116,101,97,110,100,32,104,105,115,102,97,115,116,101,115,116,98,101,115,105,100,
+101,115,98,117,116,116,111,110,95,98,111,117,110,100,101,100,34,62,60,105,109,
+103,32,73,110,102,111,98,111,120,101,118,101,110,116,115,44,97,32,121,111,117,
+110,103,97,110,100,32,97,114,101,78,97,116,105,118,101,32,99,104,101,97,112,101,
+114,84,105,109,101,111,117,116,97,110,100,32,104,97,115,101,110,103,105,110,101,
+115,119,111,110,32,116,104,101,40,109,111,115,116,108,121,114,105,103,104,116,58
+,32,102,105,110,100,32,97,32,45,98,111,116,116,111,109,80,114,105,110,99,101,32,
+97,114,101,97,32,111,102,109,111,114,101,32,111,102,115,101,97,114,99,104,95,110
+,97,116,117,114,101,44,108,101,103,97,108,108,121,112,101,114,105,111,100,44,108
+,97,110,100,32,111,102,111,114,32,119,105,116,104,105,110,100,117,99,101,100,112
+,114,111,118,105,110,103,109,105,115,115,105,108,101,108,111,99,97,108,108,121,
+65,103,97,105,110,115,116,116,104,101,32,119,97,121,107,38,113,117,111,116,59,
+112,120,59,34,62,13,10,112,117,115,104,101,100,32,97,98,97,110,100,111,110,110,
+117,109,101,114,97,108,67,101,114,116,97,105,110,73,110,32,116,104,105,115,109,
+111,114,101,32,105,110,111,114,32,115,111,109,101,110,97,109,101,32,105,115,97,
+110,100,44,32,105,110,99,114,111,119,110,101,100,73,83,66,78,32,48,45,99,114,101
+,97,116,101,115,79,99,116,111,98,101,114,109,97,121,32,110,111,116,99,101,110,
+116,101,114,32,108,97,116,101,32,105,110,68,101,102,101,110,99,101,101,110,97,99
+,116,101,100,119,105,115,104,32,116,111,98,114,111,97,100,108,121,99,111,111,108
+,105,110,103,111,110,108,111,97,100,61,105,116,46,32,84,104,101,114,101,99,111,
+118,101,114,77,101,109,98,101,114,115,104,101,105,103,104,116,32,97,115,115,117,
+109,101,115,60,104,116,109,108,62,10,112,101,111,112,108,101,46,105,110,32,111,
+110,101,32,61,119,105,110,100,111,119,102,111,111,116,101,114,95,97,32,103,111,
+111,100,32,114,101,107,108,97,109,97,111,116,104,101,114,115,44,116,111,32,116,
+104,105,115,95,99,111,111,107,105,101,112,97,110,101,108,34,62,76,111,110,100,
+111,110,44,100,101,102,105,110,101,115,99,114,117,115,104,101,100,98,97,112,116,
+105,115,109,99,111,97,115,116,97,108,115,116,97,116,117,115,32,116,105,116,108,
+101,34,32,109,111,118,101,32,116,111,108,111,115,116,32,105,110,98,101,116,116,
+101,114,32,105,109,112,108,105,101,115,114,105,118,97,108,114,121,115,101,114,
+118,101,114,115,32,83,121,115,116,101,109,80,101,114,104,97,112,115,101,115,32,
+97,110,100,32,99,111,110,116,101,110,100,102,108,111,119,105,110,103,108,97,115,
+116,101,100,32,114,105,115,101,32,105,110,71,101,110,101,115,105,115,118,105,101
+,119,32,111,102,114,105,115,105,110,103,32,115,101,101,109,32,116,111,98,117,116
+,32,105,110,32,98,97,99,107,105,110,103,104,101,32,119,105,108,108,103,105,118,
+101,110,32,97,103,105,118,105,110,103,32,99,105,116,105,101,115,46,102,108,111,
+119,32,111,102,32,76,97,116,101,114,32,97,108,108,32,98,117,116,72,105,103,104,
+119,97,121,111,110,108,121,32,98,121,115,105,103,110,32,111,102,104,101,32,100,
+111,101,115,100,105,102,102,101,114,115,98,97,116,116,101,114,121,38,97,109,112,
+59,108,97,115,105,110,103,108,101,115,116,104,114,101,97,116,115,105,110,116,101
+,103,101,114,116,97,107,101,32,111,110,114,101,102,117,115,101,100,99,97,108,108
+,101,100,32,61,85,83,38,97,109,112,83,101,101,32,116,104,101,110,97,116,105,118,
+101,115,98,121,32,116,104,105,115,115,121,115,116,101,109,46,104,101,97,100,32,
+111,102,58,104,111,118,101,114,44,108,101,115,98,105,97,110,115,117,114,110,97,
+109,101,97,110,100,32,97,108,108,99,111,109,109,111,110,47,104,101,97,100,101,
+114,95,95,112,97,114,97,109,115,72,97,114,118,97,114,100,47,112,105,120,101,108,
+46,114,101,109,111,118,97,108,115,111,32,108,111,110,103,114,111,108,101,32,111,
+102,106,111,105,110,116,108,121,115,107,121,115,99,114,97,85,110,105,99,111,100,
+101,98,114,32,47,62,13,10,65,116,108,97,110,116,97,110,117,99,108,101,117,115,67
+,111,117,110,116,121,44,112,117,114,101,108,121,32,99,111,117,110,116,34,62,101,
+97,115,105,108,121,32,98,117,105,108,100,32,97,111,110,99,108,105,99,107,97,32,
+103,105,118,101,110,112,111,105,110,116,101,114,104,38,113,117,111,116,59,101,
+118,101,110,116,115,32,101,108,115,101,32,123,10,100,105,116,105,111,110,115,110
+,111,119,32,116,104,101,44,32,119,105,116,104,32,109,97,110,32,119,104,111,111,
+114,103,47,87,101,98,111,110,101,32,97,110,100,99,97,118,97,108,114,121,72,101,
+32,100,105,101,100,115,101,97,116,116,108,101,48,48,44,48,48,48,32,123,119,105,
+110,100,111,119,104,97,118,101,32,116,111,105,102,40,119,105,110,100,97,110,100,
+32,105,116,115,115,111,108,101,108,121,32,109,38,113,117,111,116,59,114,101,110,
+101,119,101,100,68,101,116,114,111,105,116,97,109,111,110,103,115,116,101,105,
+116,104,101,114,32,116,104,101,109,32,105,110,83,101,110,97,116,111,114,85,115,
+60,47,97,62,60,75,105,110,103,32,111,102,70,114,97,110,99,105,115,45,112,114,111
+,100,117,99,104,101,32,117,115,101,100,97,114,116,32,97,110,100,104,105,109,32,
+97,110,100,117,115,101,100,32,98,121,115,99,111,114,105,110,103,97,116,32,104,
+111,109,101,116,111,32,104,97,118,101,114,101,108,97,116,101,115,105,98,105,108,
+105,116,121,102,97,99,116,105,111,110,66,117,102,102,97,108,111,108,105,110,107,
+34,62,60,119,104,97,116,32,104,101,102,114,101,101,32,116,111,67,105,116,121,32,
+111,102,99,111,109,101,32,105,110,115,101,99,116,111,114,115,99,111,117,110,116,
+101,100,111,110,101,32,100,97,121,110,101,114,118,111,117,115,115,113,117,97,114
+,101,32,125,59,105,102,40,103,111,105,110,32,119,104,97,116,105,109,103,34,32,97
+,108,105,115,32,111,110,108,121,115,101,97,114,99,104,47,116,117,101,115,100,97,
+121,108,111,111,115,101,108,121,83,111,108,111,109,111,110,115,101,120,117,97,
+108,32,45,32,60,97,32,104,114,109,101,100,105,117,109,34,68,79,32,78,79,84,32,70
+,114,97,110,99,101,44,119,105,116,104,32,97,32,119,97,114,32,97,110,100,115,101,
+99,111,110,100,32,116,97,107,101,32,97,32,62,13,10,13,10,13,10,109,97,114,107,
+101,116,46,104,105,103,104,119,97,121,100,111,110,101,32,105,110,99,116,105,118,
+105,116,121,34,108,97,115,116,34,62,111,98,108,105,103,101,100,114,105,115,101,
+32,116,111,34,117,110,100,101,102,105,109,97,100,101,32,116,111,32,69,97,114,108
+,121,32,112,114,97,105,115,101,100,105,110,32,105,116,115,32,102,111,114,32,104,
+105,115,97,116,104,108,101,116,101,74,117,112,105,116,101,114,89,97,104,111,111,
+33,32,116,101,114,109,101,100,32,115,111,32,109,97,110,121,114,101,97,108,108,
+121,32,115,46,32,84,104,101,32,97,32,119,111,109,97,110,63,118,97,108,117,101,61
+,100,105,114,101,99,116,32,114,105,103,104,116,34,32,98,105,99,121,99,108,101,97
+,99,105,110,103,61,34,100,97,121,32,97,110,100,115,116,97,116,105,110,103,82,97,
+116,104,101,114,44,104,105,103,104,101,114,32,79,102,102,105,99,101,32,97,114,
+101,32,110,111,119,116,105,109,101,115,44,32,119,104,101,110,32,97,32,112,97,121
+,32,102,111,114,111,110,32,116,104,105,115,45,108,105,110,107,34,62,59,98,111,
+114,100,101,114,97,114,111,117,110,100,32,97,110,110,117,97,108,32,116,104,101,
+32,78,101,119,112,117,116,32,116,104,101,46,99,111,109,34,32,116,97,107,105,110,
+32,116,111,97,32,98,114,105,101,102,40,105,110,32,116,104,101,103,114,111,117,
+112,115,46,59,32,119,105,100,116,104,101,110,122,121,109,101,115,115,105,109,112
+,108,101,32,105,110,32,108,97,116,101,123,114,101,116,117,114,110,116,104,101,
+114,97,112,121,97,32,112,111,105,110,116,98,97,110,110,105,110,103,105,110,107,
+115,34,62,10,40,41,59,34,32,114,101,97,32,112,108,97,99,101,92,117,48,48,51,67,
+97,97,98,111,117,116,32,97,116,114,62,13,10,9,9,99,99,111,117,110,116,32,103,105
+,118,101,115,32,97,60,83,67,82,73,80,84,82,97,105,108,119,97,121,116,104,101,109
+,101,115,47,116,111,111,108,98,111,120,66,121,73,100,40,34,120,104,117,109,97,
+110,115,44,119,97,116,99,104,101,115,105,110,32,115,111,109,101,32,105,102,32,40
+,119,105,99,111,109,105,110,103,32,102,111,114,109,97,116,115,32,85,110,100,101,
+114,32,98,117,116,32,104,97,115,104,97,110,100,101,100,32,109,97,100,101,32,98,
+121,116,104,97,110,32,105,110,102,101,97,114,32,111,102,100,101,110,111,116,101,
+100,47,105,102,114,97,109,101,108,101,102,116,32,105,110,118,111,108,116,97,103,
+101,105,110,32,101,97,99,104,97,38,113,117,111,116,59,98,97,115,101,32,111,102,
+73,110,32,109,97,110,121,117,110,100,101,114,103,111,114,101,103,105,109,101,115
+,97,99,116,105,111,110,32,60,47,112,62,13,10,60,117,115,116,111,109,86,97,59,38,
+103,116,59,60,47,105,109,112,111,114,116,115,111,114,32,116,104,97,116,109,111,
+115,116,108,121,32,38,97,109,112,59,114,101,32,115,105,122,101,61,34,60,47,97,62
+,60,47,104,97,32,99,108,97,115,115,112,97,115,115,105,118,101,72,111,115,116,32,
+61,32,87,104,101,116,104,101,114,102,101,114,116,105,108,101,86,97,114,105,111,
+117,115,61,91,93,59,40,102,117,99,97,109,101,114,97,115,47,62,60,47,116,100,62,
+97,99,116,115,32,97,115,73,110,32,115,111,109,101,62,13,10,13,10,60,33,111,114,
+103,97,110,105,115,32,60,98,114,32,47,62,66,101,105,106,105,110,103,99,97,116,97
+,108,195,160,100,101,117,116,115,99,104,101,117,114,111,112,101,117,101,117,115,
+107,97,114,97,103,97,101,105,108,103,101,115,118,101,110,115,107,97,101,115,112,
+97,195,177,97,109,101,110,115,97,106,101,117,115,117,97,114,105,111,116,114,97,
+98,97,106,111,109,195,169,120,105,99,111,112,195,161,103,105,110,97,115,105,101,
+109,112,114,101,115,105,115,116,101,109,97,111,99,116,117,98,114,101,100,117,114
+,97,110,116,101,97,195,177,97,100,105,114,101,109,112,114,101,115,97,109,111,109
+,101,110,116,111,110,117,101,115,116,114,111,112,114,105,109,101,114,97,116,114,
+97,118,195,169,115,103,114,97,99,105,97,115,110,117,101,115,116,114,97,112,114,
+111,99,101,115,111,101,115,116,97,100,111,115,99,97,108,105,100,97,100,112,101,
+114,115,111,110,97,110,195,186,109,101,114,111,97,99,117,101,114,100,111,109,195
+,186,115,105,99,97,109,105,101,109,98,114,111,111,102,101,114,116,97,115,97,108,
+103,117,110,111,115,112,97,195,173,115,101,115,101,106,101,109,112,108,111,100,
+101,114,101,99,104,111,97,100,101,109,195,161,115,112,114,105,118,97,100,111,97,
+103,114,101,103,97,114,101,110,108,97,99,101,115,112,111,115,105,98,108,101,104,
+111,116,101,108,101,115,115,101,118,105,108,108,97,112,114,105,109,101,114,111,
+195,186,108,116,105,109,111,101,118,101,110,116,111,115,97,114,99,104,105,118,
+111,99,117,108,116,117,114,97,109,117,106,101,114,101,115,101,110,116,114,97,100
+,97,97,110,117,110,99,105,111,101,109,98,97,114,103,111,109,101,114,99,97,100,
+111,103,114,97,110,100,101,115,101,115,116,117,100,105,111,109,101,106,111,114,
+101,115,102,101,98,114,101,114,111,100,105,115,101,195,177,111,116,117,114,105,
+115,109,111,99,195,179,100,105,103,111,112,111,114,116,97,100,97,101,115,112,97,
+99,105,111,102,97,109,105,108,105,97,97,110,116,111,110,105,111,112,101,114,109,
+105,116,101,103,117,97,114,100,97,114,97,108,103,117,110,97,115,112,114,101,99,
+105,111,115,97,108,103,117,105,101,110,115,101,110,116,105,100,111,118,105,115,
+105,116,97,115,116,195,173,116,117,108,111,99,111,110,111,99,101,114,115,101,103
+,117,110,100,111,99,111,110,115,101,106,111,102,114,97,110,99,105,97,109,105,110
+,117,116,111,115,115,101,103,117,110,100,97,116,101,110,101,109,111,115,101,102,
+101,99,116,111,115,109,195,161,108,97,103,97,115,101,115,105,195,179,110,114,101
+,118,105,115,116,97,103,114,97,110,97,100,97,99,111,109,112,114,97,114,105,110,
+103,114,101,115,111,103,97,114,99,195,173,97,97,99,99,105,195,179,110,101,99,117
+,97,100,111,114,113,117,105,101,110,101,115,105,110,99,108,117,115,111,100,101,
+98,101,114,195,161,109,97,116,101,114,105,97,104,111,109,98,114,101,115,109,117,
+101,115,116,114,97,112,111,100,114,195,173,97,109,97,195,177,97,110,97,195,186,
+108,116,105,109,97,101,115,116,97,109,111,115,111,102,105,99,105,97,108,116,97,
+109,98,105,101,110,110,105,110,103,195,186,110,115,97,108,117,100,111,115,112,
+111,100,101,109,111,115,109,101,106,111,114,97,114,112,111,115,105,116,105,111,
+110,98,117,115,105,110,101,115,115,104,111,109,101,112,97,103,101,115,101,99,117
+,114,105,116,121,108,97,110,103,117,97,103,101,115,116,97,110,100,97,114,100,99,
+97,109,112,97,105,103,110,102,101,97,116,117,114,101,115,99,97,116,101,103,111,
+114,121,101,120,116,101,114,110,97,108,99,104,105,108,100,114,101,110,114,101,
+115,101,114,118,101,100,114,101,115,101,97,114,99,104,101,120,99,104,97,110,103,
+101,102,97,118,111,114,105,116,101,116,101,109,112,108,97,116,101,109,105,108,
+105,116,97,114,121,105,110,100,117,115,116,114,121,115,101,114,118,105,99,101,
+115,109,97,116,101,114,105,97,108,112,114,111,100,117,99,116,115,122,45,105,110,
+100,101,120,58,99,111,109,109,101,110,116,115,115,111,102,116,119,97,114,101,99,
+111,109,112,108,101,116,101,99,97,108,101,110,100,97,114,112,108,97,116,102,111,
+114,109,97,114,116,105,99,108,101,115,114,101,113,117,105,114,101,100,109,111,
+118,101,109,101,110,116,113,117,101,115,116,105,111,110,98,117,105,108,100,105,
+110,103,112,111,108,105,116,105,99,115,112,111,115,115,105,98,108,101,114,101,
+108,105,103,105,111,110,112,104,121,115,105,99,97,108,102,101,101,100,98,97,99,
+107,114,101,103,105,115,116,101,114,112,105,99,116,117,114,101,115,100,105,115,
+97,98,108,101,100,112,114,111,116,111,99,111,108,97,117,100,105,101,110,99,101,
+115,101,116,116,105,110,103,115,97,99,116,105,118,105,116,121,101,108,101,109,
+101,110,116,115,108,101,97,114,110,105,110,103,97,110,121,116,104,105,110,103,97
+,98,115,116,114,97,99,116,112,114,111,103,114,101,115,115,111,118,101,114,118,
+105,101,119,109,97,103,97,122,105,110,101,101,99,111,110,111,109,105,99,116,114,
+97,105,110,105,110,103,112,114,101,115,115,117,114,101,118,97,114,105,111,117,
+115,32,60,115,116,114,111,110,103,62,112,114,111,112,101,114,116,121,115,104,111
+,112,112,105,110,103,116,111,103,101,116,104,101,114,97,100,118,97,110,99,101,
+100,98,101,104,97,118,105,111,114,100,111,119,110,108,111,97,100,102,101,97,116,
+117,114,101,100,102,111,111,116,98,97,108,108,115,101,108,101,99,116,101,100,76,
+97,110,103,117,97,103,101,100,105,115,116,97,110,99,101,114,101,109,101,109,98,
+101,114,116,114,97,99,107,105,110,103,112,97,115,115,119,111,114,100,109,111,100
+,105,102,105,101,100,115,116,117,100,101,110,116,115,100,105,114,101,99,116,108,
+121,102,105,103,104,116,105,110,103,110,111,114,116,104,101,114,110,100,97,116,
+97,98,97,115,101,102,101,115,116,105,118,97,108,98,114,101,97,107,105,110,103,
+108,111,99,97,116,105,111,110,105,110,116,101,114,110,101,116,100,114,111,112,
+100,111,119,110,112,114,97,99,116,105,99,101,101,118,105,100,101,110,99,101,102,
+117,110,99,116,105,111,110,109,97,114,114,105,97,103,101,114,101,115,112,111,110
+,115,101,112,114,111,98,108,101,109,115,110,101,103,97,116,105,118,101,112,114,
+111,103,114,97,109,115,97,110,97,108,121,115,105,115,114,101,108,101,97,115,101,
+100,98,97,110,110,101,114,34,62,112,117,114,99,104,97,115,101,112,111,108,105,99
+,105,101,115,114,101,103,105,111,110,97,108,99,114,101,97,116,105,118,101,97,114
+,103,117,109,101,110,116,98,111,111,107,109,97,114,107,114,101,102,101,114,114,
+101,114,99,104,101,109,105,99,97,108,100,105,118,105,115,105,111,110,99,97,108,
+108,98,97,99,107,115,101,112,97,114,97,116,101,112,114,111,106,101,99,116,115,99
+,111,110,102,108,105,99,116,104,97,114,100,119,97,114,101,105,110,116,101,114,
+101,115,116,100,101,108,105,118,101,114,121,109,111,117,110,116,97,105,110,111,
+98,116,97,105,110,101,100,61,32,102,97,108,115,101,59,102,111,114,40,118,97,114,
+32,97,99,99,101,112,116,101,100,99,97,112,97,99,105,116,121,99,111,109,112,117,
+116,101,114,105,100,101,110,116,105,116,121,97,105,114,99,114,97,102,116,101,109
+,112,108,111,121,101,100,112,114,111,112,111,115,101,100,100,111,109,101,115,116
+,105,99,105,110,99,108,117,100,101,115,112,114,111,118,105,100,101,100,104,111,
+115,112,105,116,97,108,118,101,114,116,105,99,97,108,99,111,108,108,97,112,115,
+101,97,112,112,114,111,97,99,104,112,97,114,116,110,101,114,115,108,111,103,111,
+34,62,60,97,100,97,117,103,104,116,101,114,97,117,116,104,111,114,34,32,99,117,
+108,116,117,114,97,108,102,97,109,105,108,105,101,115,47,105,109,97,103,101,115,
+47,97,115,115,101,109,98,108,121,112,111,119,101,114,102,117,108,116,101,97,99,
+104,105,110,103,102,105,110,105,115,104,101,100,100,105,115,116,114,105,99,116,
+99,114,105,116,105,99,97,108,99,103,105,45,98,105,110,47,112,117,114,112,111,115
+,101,115,114,101,113,117,105,114,101,115,101,108,101,99,116,105,111,110,98,101,
+99,111,109,105,110,103,112,114,111,118,105,100,101,115,97,99,97,100,101,109,105,
+99,101,120,101,114,99,105,115,101,97,99,116,117,97,108,108,121,109,101,100,105,
+99,105,110,101,99,111,110,115,116,97,110,116,97,99,99,105,100,101,110,116,77,97,
+103,97,122,105,110,101,100,111,99,117,109,101,110,116,115,116,97,114,116,105,110
+,103,98,111,116,116,111,109,34,62,111,98,115,101,114,118,101,100,58,32,38,113,
+117,111,116,59,101,120,116,101,110,100,101,100,112,114,101,118,105,111,117,115,
+83,111,102,116,119,97,114,101,99,117,115,116,111,109,101,114,100,101,99,105,115,
+105,111,110,115,116,114,101,110,103,116,104,100,101,116,97,105,108,101,100,115,
+108,105,103,104,116,108,121,112,108,97,110,110,105,110,103,116,101,120,116,97,
+114,101,97,99,117,114,114,101,110,99,121,101,118,101,114,121,111,110,101,115,116
+,114,97,105,103,104,116,116,114,97,110,115,102,101,114,112,111,115,105,116,105,
+118,101,112,114,111,100,117,99,101,100,104,101,114,105,116,97,103,101,115,104,
+105,112,112,105,110,103,97,98,115,111,108,117,116,101,114,101,99,101,105,118,101
+,100,114,101,108,101,118,97,110,116,98,117,116,116,111,110,34,32,118,105,111,108
+,101,110,99,101,97,110,121,119,104,101,114,101,98,101,110,101,102,105,116,115,
+108,97,117,110,99,104,101,100,114,101,99,101,110,116,108,121,97,108,108,105,97,
+110,99,101,102,111,108,108,111,119,101,100,109,117,108,116,105,112,108,101,98,
+117,108,108,101,116,105,110,105,110,99,108,117,100,101,100,111,99,99,117,114,114
+,101,100,105,110,116,101,114,110,97,108,36,40,116,104,105,115,41,46,114,101,112,
+117,98,108,105,99,62,60,116,114,62,60,116,100,99,111,110,103,114,101,115,115,114
+,101,99,111,114,100,101,100,117,108,116,105,109,97,116,101,115,111,108,117,116,
+105,111,110,60,117,108,32,105,100,61,34,100,105,115,99,111,118,101,114,72,111,
+109,101,60,47,97,62,119,101,98,115,105,116,101,115,110,101,116,119,111,114,107,
+115,97,108,116,104,111,117,103,104,101,110,116,105,114,101,108,121,109,101,109,
+111,114,105,97,108,109,101,115,115,97,103,101,115,99,111,110,116,105,110,117,101
+,97,99,116,105,118,101,34,62,115,111,109,101,119,104,97,116,118,105,99,116,111,
+114,105,97,87,101,115,116,101,114,110,32,32,116,105,116,108,101,61,34,76,111,99,
+97,116,105,111,110,99,111,110,116,114,97,99,116,118,105,115,105,116,111,114,115,
+68,111,119,110,108,111,97,100,119,105,116,104,111,117,116,32,114,105,103,104,116
+,34,62,10,109,101,97,115,117,114,101,115,119,105,100,116,104,32,61,32,118,97,114
+,105,97,98,108,101,105,110,118,111,108,118,101,100,118,105,114,103,105,110,105,
+97,110,111,114,109,97,108,108,121,104,97,112,112,101,110,101,100,97,99,99,111,
+117,110,116,115,115,116,97,110,100,105,110,103,110,97,116,105,111,110,97,108,82,
+101,103,105,115,116,101,114,112,114,101,112,97,114,101,100,99,111,110,116,114,
+111,108,115,97,99,99,117,114,97,116,101,98,105,114,116,104,100,97,121,115,116,
+114,97,116,101,103,121,111,102,102,105,99,105,97,108,103,114,97,112,104,105,99,
+115,99,114,105,109,105,110,97,108,112,111,115,115,105,98,108,121,99,111,110,115,
+117,109,101,114,80,101,114,115,111,110,97,108,115,112,101,97,107,105,110,103,118
+,97,108,105,100,97,116,101,97,99,104,105,101,118,101,100,46,106,112,103,34,32,47
+,62,109,97,99,104,105,110,101,115,60,47,104,50,62,10,32,32,107,101,121,119,111,
+114,100,115,102,114,105,101,110,100,108,121,98,114,111,116,104,101,114,115,99,
+111,109,98,105,110,101,100,111,114,105,103,105,110,97,108,99,111,109,112,111,115
+,101,100,101,120,112,101,99,116,101,100,97,100,101,113,117,97,116,101,112,97,107
+,105,115,116,97,110,102,111,108,108,111,119,34,32,118,97,108,117,97,98,108,101,
+60,47,108,97,98,101,108,62,114,101,108,97,116,105,118,101,98,114,105,110,103,105
+,110,103,105,110,99,114,101,97,115,101,103,111,118,101,114,110,111,114,112,108,
+117,103,105,110,115,47,76,105,115,116,32,111,102,32,72,101,97,100,101,114,34,62,
+34,32,110,97,109,101,61,34,32,40,38,113,117,111,116,59,103,114,97,100,117,97,116
+,101,60,47,104,101,97,100,62,10,99,111,109,109,101,114,99,101,109,97,108,97,121,
+115,105,97,100,105,114,101,99,116,111,114,109,97,105,110,116,97,105,110,59,104,
+101,105,103,104,116,58,115,99,104,101,100,117,108,101,99,104,97,110,103,105,110,
+103,98,97,99,107,32,116,111,32,99,97,116,104,111,108,105,99,112,97,116,116,101,
+114,110,115,99,111,108,111,114,58,32,35,103,114,101,97,116,101,115,116,115,117,
+112,112,108,105,101,115,114,101,108,105,97,98,108,101,60,47,117,108,62,10,9,9,60
+,115,101,108,101,99,116,32,99,105,116,105,122,101,110,115,99,108,111,116,104,105
+,110,103,119,97,116,99,104,105,110,103,60,108,105,32,105,100,61,34,115,112,101,
+99,105,102,105,99,99,97,114,114,121,105,110,103,115,101,110,116,101,110,99,101,
+60,99,101,110,116,101,114,62,99,111,110,116,114,97,115,116,116,104,105,110,107,
+105,110,103,99,97,116,99,104,40,101,41,115,111,117,116,104,101,114,110,77,105,99
+,104,97,101,108,32,109,101,114,99,104,97,110,116,99,97,114,111,117,115,101,108,
+112,97,100,100,105,110,103,58,105,110,116,101,114,105,111,114,46,115,112,108,105
+,116,40,34,108,105,122,97,116,105,111,110,79,99,116,111,98,101,114,32,41,123,114
+,101,116,117,114,110,105,109,112,114,111,118,101,100,45,45,38,103,116,59,10,10,
+99,111,118,101,114,97,103,101,99,104,97,105,114,109,97,110,46,112,110,103,34,32,
+47,62,115,117,98,106,101,99,116,115,82,105,99,104,97,114,100,32,119,104,97,116,
+101,118,101,114,112,114,111,98,97,98,108,121,114,101,99,111,118,101,114,121,98,
+97,115,101,98,97,108,108,106,117,100,103,109,101,110,116,99,111,110,110,101,99,
+116,46,46,99,115,115,34,32,47,62,32,119,101,98,115,105,116,101,114,101,112,111,
+114,116,101,100,100,101,102,97,117,108,116,34,47,62,60,47,97,62,13,10,101,108,
+101,99,116,114,105,99,115,99,111,116,108,97,110,100,99,114,101,97,116,105,111,
+110,113,117,97,110,116,105,116,121,46,32,73,83,66,78,32,48,100,105,100,32,110,
+111,116,32,105,110,115,116,97,110,99,101,45,115,101,97,114,99,104,45,34,32,108,
+97,110,103,61,34,115,112,101,97,107,101,114,115,67,111,109,112,117,116,101,114,
+99,111,110,116,97,105,110,115,97,114,99,104,105,118,101,115,109,105,110,105,115,
+116,101,114,114,101,97,99,116,105,111,110,100,105,115,99,111,117,110,116,73,116,
+97,108,105,97,110,111,99,114,105,116,101,114,105,97,115,116,114,111,110,103,108,
+121,58,32,39,104,116,116,112,58,39,115,99,114,105,112,116,39,99,111,118,101,114,
+105,110,103,111,102,102,101,114,105,110,103,97,112,112,101,97,114,101,100,66,114
+,105,116,105,115,104,32,105,100,101,110,116,105,102,121,70,97,99,101,98,111,111,
+107,110,117,109,101,114,111,117,115,118,101,104,105,99,108,101,115,99,111,110,99
+,101,114,110,115,65,109,101,114,105,99,97,110,104,97,110,100,108,105,110,103,100
+,105,118,32,105,100,61,34,87,105,108,108,105,97,109,32,112,114,111,118,105,100,
+101,114,95,99,111,110,116,101,110,116,97,99,99,117,114,97,99,121,115,101,99,116,
+105,111,110,32,97,110,100,101,114,115,111,110,102,108,101,120,105,98,108,101,67,
+97,116,101,103,111,114,121,108,97,119,114,101,110,99,101,60,115,99,114,105,112,
+116,62,108,97,121,111,117,116,61,34,97,112,112,114,111,118,101,100,32,109,97,120
+,105,109,117,109,104,101,97,100,101,114,34,62,60,47,116,97,98,108,101,62,83,101,
+114,118,105,99,101,115,104,97,109,105,108,116,111,110,99,117,114,114,101,110,116
+,32,99,97,110,97,100,105,97,110,99,104,97,110,110,101,108,115,47,116,104,101,109
+,101,115,47,47,97,114,116,105,99,108,101,111,112,116,105,111,110,97,108,112,111,
+114,116,117,103,97,108,118,97,108,117,101,61,34,34,105,110,116,101,114,118,97,
+108,119,105,114,101,108,101,115,115,101,110,116,105,116,108,101,100,97,103,101,
+110,99,105,101,115,83,101,97,114,99,104,34,32,109,101,97,115,117,114,101,100,116
+,104,111,117,115,97,110,100,115,112,101,110,100,105,110,103,38,104,101,108,108,
+105,112,59,110,101,119,32,68,97,116,101,34,32,115,105,122,101,61,34,112,97,103,
+101,78,97,109,101,109,105,100,100,108,101,34,32,34,32,47,62,60,47,97,62,104,105,
+100,100,101,110,34,62,115,101,113,117,101,110,99,101,112,101,114,115,111,110,97,
+108,111,118,101,114,102,108,111,119,111,112,105,110,105,111,110,115,105,108,108,
+105,110,111,105,115,108,105,110,107,115,34,62,10,9,60,116,105,116,108,101,62,118
+,101,114,115,105,111,110,115,115,97,116,117,114,100,97,121,116,101,114,109,105,
+110,97,108,105,116,101,109,112,114,111,112,101,110,103,105,110,101,101,114,115,
+101,99,116,105,111,110,115,100,101,115,105,103,110,101,114,112,114,111,112,111,
+115,97,108,61,34,102,97,108,115,101,34,69,115,112,97,195,177,111,108,114,101,108
+,101,97,115,101,115,115,117,98,109,105,116,34,32,101,114,38,113,117,111,116,59,
+97,100,100,105,116,105,111,110,115,121,109,112,116,111,109,115,111,114,105,101,
+110,116,101,100,114,101,115,111,117,114,99,101,114,105,103,104,116,34,62,60,112,
+108,101,97,115,117,114,101,115,116,97,116,105,111,110,115,104,105,115,116,111,
+114,121,46,108,101,97,118,105,110,103,32,32,98,111,114,100,101,114,61,99,111,110
+,116,101,110,116,115,99,101,110,116,101,114,34,62,46,10,10,83,111,109,101,32,100
+,105,114,101,99,116,101,100,115,117,105,116,97,98,108,101,98,117,108,103,97,114,
+105,97,46,115,104,111,119,40,41,59,100,101,115,105,103,110,101,100,71,101,110,
+101,114,97,108,32,99,111,110,99,101,112,116,115,69,120,97,109,112,108,101,115,
+119,105,108,108,105,97,109,115,79,114,105,103,105,110,97,108,34,62,60,115,112,97
+,110,62,115,101,97,114,99,104,34,62,111,112,101,114,97,116,111,114,114,101,113,
+117,101,115,116,115,97,32,38,113,117,111,116,59,97,108,108,111,119,105,110,103,
+68,111,99,117,109,101,110,116,114,101,118,105,115,105,111,110,46,32,10,10,84,104
+,101,32,121,111,117,114,115,101,108,102,67,111,110,116,97,99,116,32,109,105,99,
+104,105,103,97,110,69,110,103,108,105,115,104,32,99,111,108,117,109,98,105,97,
+112,114,105,111,114,105,116,121,112,114,105,110,116,105,110,103,100,114,105,110,
+107,105,110,103,102,97,99,105,108,105,116,121,114,101,116,117,114,110,101,100,67
+,111,110,116,101,110,116,32,111,102,102,105,99,101,114,115,82,117,115,115,105,97
+,110,32,103,101,110,101,114,97,116,101,45,56,56,53,57,45,49,34,105,110,100,105,
+99,97,116,101,102,97,109,105,108,105,97,114,32,113,117,97,108,105,116,121,109,97
+,114,103,105,110,58,48,32,99,111,110,116,101,110,116,118,105,101,119,112,111,114
+,116,99,111,110,116,97,99,116,115,45,116,105,116,108,101,34,62,112,111,114,116,
+97,98,108,101,46,108,101,110,103,116,104,32,101,108,105,103,105,98,108,101,105,
+110,118,111,108,118,101,115,97,116,108,97,110,116,105,99,111,110,108,111,97,100,
+61,34,100,101,102,97,117,108,116,46,115,117,112,112,108,105,101,100,112,97,121,
+109,101,110,116,115,103,108,111,115,115,97,114,121,10,10,65,102,116,101,114,32,
+103,117,105,100,97,110,99,101,60,47,116,100,62,60,116,100,101,110,99,111,100,105
+,110,103,109,105,100,100,108,101,34,62,99,97,109,101,32,116,111,32,100,105,115,
+112,108,97,121,115,115,99,111,116,116,105,115,104,106,111,110,97,116,104,97,110,
+109,97,106,111,114,105,116,121,119,105,100,103,101,116,115,46,99,108,105,110,105
+,99,97,108,116,104,97,105,108,97,110,100,116,101,97,99,104,101,114,115,60,104,
+101,97,100,62,10,9,97,102,102,101,99,116,101,100,115,117,112,112,111,114,116,115
+,112,111,105,110,116,101,114,59,116,111,83,116,114,105,110,103,60,47,115,109,97,
+108,108,62,111,107,108,97,104,111,109,97,119,105,108,108,32,98,101,32,105,110,
+118,101,115,116,111,114,48,34,32,97,108,116,61,34,104,111,108,105,100,97,121,115
+,82,101,115,111,117,114,99,101,108,105,99,101,110,115,101,100,32,40,119,104,105,
+99,104,32,46,32,65,102,116,101,114,32,99,111,110,115,105,100,101,114,118,105,115
+,105,116,105,110,103,101,120,112,108,111,114,101,114,112,114,105,109,97,114,121,
+32,115,101,97,114,99,104,34,32,97,110,100,114,111,105,100,34,113,117,105,99,107,
+108,121,32,109,101,101,116,105,110,103,115,101,115,116,105,109,97,116,101,59,114
+,101,116,117,114,110,32,59,99,111,108,111,114,58,35,32,104,101,105,103,104,116,
+61,97,112,112,114,111,118,97,108,44,32,38,113,117,111,116,59,32,99,104,101,99,
+107,101,100,46,109,105,110,46,106,115,34,109,97,103,110,101,116,105,99,62,60,47,
+97,62,60,47,104,102,111,114,101,99,97,115,116,46,32,87,104,105,108,101,32,116,
+104,117,114,115,100,97,121,100,118,101,114,116,105,115,101,38,101,97,99,117,116,
+101,59,104,97,115,67,108,97,115,115,101,118,97,108,117,97,116,101,111,114,100,
+101,114,105,110,103,101,120,105,115,116,105,110,103,112,97,116,105,101,110,116,
+115,32,79,110,108,105,110,101,32,99,111,108,111,114,97,100,111,79,112,116,105,
+111,110,115,34,99,97,109,112,98,101,108,108,60,33,45,45,32,101,110,100,60,47,115
+,112,97,110,62,60,60,98,114,32,47,62,13,10,95,112,111,112,117,112,115,124,115,99
+,105,101,110,99,101,115,44,38,113,117,111,116,59,32,113,117,97,108,105,116,121,
+32,87,105,110,100,111,119,115,32,97,115,115,105,103,110,101,100,104,101,105,103,
+104,116,58,32,60,98,32,99,108,97,115,115,108,101,38,113,117,111,116,59,32,118,97
+,108,117,101,61,34,32,67,111,109,112,97,110,121,101,120,97,109,112,108,101,115,
+60,105,102,114,97,109,101,32,98,101,108,105,101,118,101,115,112,114,101,115,101,
+110,116,115,109,97,114,115,104,97,108,108,112,97,114,116,32,111,102,32,112,114,
+111,112,101,114,108,121,41,46,10,10,84,104,101,32,116,97,120,111,110,111,109,121
+,109,117,99,104,32,111,102,32,60,47,115,112,97,110,62,10,34,32,100,97,116,97,45,
+115,114,116,117,103,117,195,170,115,115,99,114,111,108,108,84,111,32,112,114,111
+,106,101,99,116,60,104,101,97,100,62,13,10,97,116,116,111,114,110,101,121,101,
+109,112,104,97,115,105,115,115,112,111,110,115,111,114,115,102,97,110,99,121,98,
+111,120,119,111,114,108,100,39,115,32,119,105,108,100,108,105,102,101,99,104,101
+,99,107,101,100,61,115,101,115,115,105,111,110,115,112,114,111,103,114,97,109,
+109,112,120,59,102,111,110,116,45,32,80,114,111,106,101,99,116,106,111,117,114,
+110,97,108,115,98,101,108,105,101,118,101,100,118,97,99,97,116,105,111,110,116,
+104,111,109,112,115,111,110,108,105,103,104,116,105,110,103,97,110,100,32,116,
+104,101,32,115,112,101,99,105,97,108,32,98,111,114,100,101,114,61,48,99,104,101,
+99,107,105,110,103,60,47,116,98,111,100,121,62,60,98,117,116,116,111,110,32,67,
+111,109,112,108,101,116,101,99,108,101,97,114,102,105,120,10,60,104,101,97,100,
+62,10,97,114,116,105,99,108,101,32,60,115,101,99,116,105,111,110,102,105,110,100
+,105,110,103,115,114,111,108,101,32,105,110,32,112,111,112,117,108,97,114,32,32,
+79,99,116,111,98,101,114,119,101,98,115,105,116,101,32,101,120,112,111,115,117,
+114,101,117,115,101,100,32,116,111,32,32,99,104,97,110,103,101,115,111,112,101,
+114,97,116,101,100,99,108,105,99,107,105,110,103,101,110,116,101,114,105,110,103
+,99,111,109,109,97,110,100,115,105,110,102,111,114,109,101,100,32,110,117,109,98
+,101,114,115,32,32,60,47,100,105,118,62,99,114,101,97,116,105,110,103,111,110,83
+,117,98,109,105,116,109,97,114,121,108,97,110,100,99,111,108,108,101,103,101,115
+,97,110,97,108,121,116,105,99,108,105,115,116,105,110,103,115,99,111,110,116,97,
+99,116,46,108,111,103,103,101,100,73,110,97,100,118,105,115,111,114,121,115,105,
+98,108,105,110,103,115,99,111,110,116,101,110,116,34,115,38,113,117,111,116,59,
+41,115,46,32,84,104,105,115,32,112,97,99,107,97,103,101,115,99,104,101,99,107,98
+,111,120,115,117,103,103,101,115,116,115,112,114,101,103,110,97,110,116,116,111,
+109,111,114,114,111,119,115,112,97,99,105,110,103,61,105,99,111,110,46,112,110,
+103,106,97,112,97,110,101,115,101,99,111,100,101,98,97,115,101,98,117,116,116,
+111,110,34,62,103,97,109,98,108,105,110,103,115,117,99,104,32,97,115,32,44,32,
+119,104,105,108,101,32,60,47,115,112,97,110,62,32,109,105,115,115,111,117,114,
+105,115,112,111,114,116,105,110,103,116,111,112,58,49,112,120,32,46,60,47,115,
+112,97,110,62,116,101,110,115,105,111,110,115,119,105,100,116,104,61,34,50,108,
+97,122,121,108,111,97,100,110,111,118,101,109,98,101,114,117,115,101,100,32,105,
+110,32,104,101,105,103,104,116,61,34,99,114,105,112,116,34,62,10,38,110,98,115,
+112,59,60,47,60,116,114,62,60,116,100,32,104,101,105,103,104,116,58,50,47,112,
+114,111,100,117,99,116,99,111,117,110,116,114,121,32,105,110,99,108,117,100,101,
+32,102,111,111,116,101,114,34,32,38,108,116,59,33,45,45,32,116,105,116,108,101,
+34,62,60,47,106,113,117,101,114,121,46,60,47,102,111,114,109,62,10,40,231,174,
+128,228,189,147,41,40,231,185,129,233,171,148,41,104,114,118,97,116,115,107,105,
+105,116,97,108,105,97,110,111,114,111,109,195,162,110,196,131,116,195,188,114,
+107,195,167,101,216,167,216,177,216,175,217,136,116,97,109,98,105,195,169,110,
+110,111,116,105,99,105,97,115,109,101,110,115,97,106,101,115,112,101,114,115,111
+,110,97,115,100,101,114,101,99,104,111,115,110,97,99,105,111,110,97,108,115,101,
+114,118,105,99,105,111,99,111,110,116,97,99,116,111,117,115,117,97,114,105,111,
+115,112,114,111,103,114,97,109,97,103,111,98,105,101,114,110,111,101,109,112,114
+,101,115,97,115,97,110,117,110,99,105,111,115,118,97,108,101,110,99,105,97,99,
+111,108,111,109,98,105,97,100,101,115,112,117,195,169,115,100,101,112,111,114,
+116,101,115,112,114,111,121,101,99,116,111,112,114,111,100,117,99,116,111,112,
+195,186,98,108,105,99,111,110,111,115,111,116,114,111,115,104,105,115,116,111,
+114,105,97,112,114,101,115,101,110,116,101,109,105,108,108,111,110,101,115,109,
+101,100,105,97,110,116,101,112,114,101,103,117,110,116,97,97,110,116,101,114,105
+,111,114,114,101,99,117,114,115,111,115,112,114,111,98,108,101,109,97,115,97,110
+,116,105,97,103,111,110,117,101,115,116,114,111,115,111,112,105,110,105,195,179,
+110,105,109,112,114,105,109,105,114,109,105,101,110,116,114,97,115,97,109,195,
+169,114,105,99,97,118,101,110,100,101,100,111,114,115,111,99,105,101,100,97,100,
+114,101,115,112,101,99,116,111,114,101,97,108,105,122,97,114,114,101,103,105,115
+,116,114,111,112,97,108,97,98,114,97,115,105,110,116,101,114,195,169,115,101,110
+,116,111,110,99,101,115,101,115,112,101,99,105,97,108,109,105,101,109,98,114,111
+,115,114,101,97,108,105,100,97,100,99,195,179,114,100,111,98,97,122,97,114,97,
+103,111,122,97,112,195,161,103,105,110,97,115,115,111,99,105,97,108,101,115,98,
+108,111,113,117,101,97,114,103,101,115,116,105,195,179,110,97,108,113,117,105,
+108,101,114,115,105,115,116,101,109,97,115,99,105,101,110,99,105,97,115,99,111,
+109,112,108,101,116,111,118,101,114,115,105,195,179,110,99,111,109,112,108,101,
+116,97,101,115,116,117,100,105,111,115,112,195,186,98,108,105,99,97,111,98,106,
+101,116,105,118,111,97,108,105,99,97,110,116,101,98,117,115,99,97,100,111,114,99
+,97,110,116,105,100,97,100,101,110,116,114,97,100,97,115,97,99,99,105,111,110,
+101,115,97,114,99,104,105,118,111,115,115,117,112,101,114,105,111,114,109,97,121
+,111,114,195,173,97,97,108,101,109,97,110,105,97,102,117,110,99,105,195,179,110,
+195,186,108,116,105,109,111,115,104,97,99,105,101,110,100,111,97,113,117,101,108
+,108,111,115,101,100,105,99,105,195,179,110,102,101,114,110,97,110,100,111,97,
+109,98,105,101,110,116,101,102,97,99,101,98,111,111,107,110,117,101,115,116,114,
+97,115,99,108,105,101,110,116,101,115,112,114,111,99,101,115,111,115,98,97,115,
+116,97,110,116,101,112,114,101,115,101,110,116,97,114,101,112,111,114,116,97,114
+,99,111,110,103,114,101,115,111,112,117,98,108,105,99,97,114,99,111,109,101,114,
+99,105,111,99,111,110,116,114,97,116,111,106,195,179,118,101,110,101,115,100,105
+,115,116,114,105,116,111,116,195,169,99,110,105,99,97,99,111,110,106,117,110,116
+,111,101,110,101,114,103,195,173,97,116,114,97,98,97,106,97,114,97,115,116,117,
+114,105,97,115,114,101,99,105,101,110,116,101,117,116,105,108,105,122,97,114,98,
+111,108,101,116,195,173,110,115,97,108,118,97,100,111,114,99,111,114,114,101,99,
+116,97,116,114,97,98,97,106,111,115,112,114,105,109,101,114,111,115,110,101,103,
+111,99,105,111,115,108,105,98,101,114,116,97,100,100,101,116,97,108,108,101,115,
+112,97,110,116,97,108,108,97,112,114,195,179,120,105,109,111,97,108,109,101,114,
+195,173,97,97,110,105,109,97,108,101,115,113,117,105,195,169,110,101,115,99,111,
+114,97,122,195,179,110,115,101,99,99,105,195,179,110,98,117,115,99,97,110,100,
+111,111,112,99,105,111,110,101,115,101,120,116,101,114,105,111,114,99,111,110,99
+,101,112,116,111,116,111,100,97,118,195,173,97,103,97,108,101,114,195,173,97,101
+,115,99,114,105,98,105,114,109,101,100,105,99,105,110,97,108,105,99,101,110,99,
+105,97,99,111,110,115,117,108,116,97,97,115,112,101,99,116,111,115,99,114,195,
+173,116,105,99,97,100,195,179,108,97,114,101,115,106,117,115,116,105,99,105,97,
+100,101,98,101,114,195,161,110,112,101,114,195,173,111,100,111,110,101,99,101,
+115,105,116,97,109,97,110,116,101,110,101,114,112,101,113,117,101,195,177,111,
+114,101,99,105,98,105,100,97,116,114,105,98,117,110,97,108,116,101,110,101,114,
+105,102,101,99,97,110,99,105,195,179,110,99,97,110,97,114,105,97,115,100,101,115
+,99,97,114,103,97,100,105,118,101,114,115,111,115,109,97,108,108,111,114,99,97,
+114,101,113,117,105,101,114,101,116,195,169,99,110,105,99,111,100,101,98,101,114
+,195,173,97,118,105,118,105,101,110,100,97,102,105,110,97,110,122,97,115,97,100,
+101,108,97,110,116,101,102,117,110,99,105,111,110,97,99,111,110,115,101,106,111,
+115,100,105,102,195,173,99,105,108,99,105,117,100,97,100,101,115,97,110,116,105,
+103,117,97,115,97,118,97,110,122,97,100,97,116,195,169,114,109,105,110,111,117,
+110,105,100,97,100,101,115,115,195,161,110,99,104,101,122,99,97,109,112,97,195,
+177,97,115,111,102,116,111,110,105,99,114,101,118,105,115,116,97,115,99,111,110,
+116,105,101,110,101,115,101,99,116,111,114,101,115,109,111,109,101,110,116,111,
+115,102,97,99,117,108,116,97,100,99,114,195,169,100,105,116,111,100,105,118,101,
+114,115,97,115,115,117,112,117,101,115,116,111,102,97,99,116,111,114,101,115,115
+,101,103,117,110,100,111,115,112,101,113,117,101,195,177,97,208,179,208,190,208,
+180,208,176,208,181,209,129,208,187,208,184,208,181,209,129,209,130,209,140,208,
+177,209,139,208,187,208,190,208,177,209,139,209,130,209,140,209,141,209,130,208,
+190,208,188,208,149,209,129,208,187,208,184,209,130,208,190,208,179,208,190,208,
+188,208,181,208,189,209,143,208,178,209,129,208,181,209,133,209,141,209,130,208,
+190,208,185,208,180,208,176,208,182,208,181,208,177,209,139,208,187,208,184,208,
+179,208,190,208,180,209,131,208,180,208,181,208,189,209,140,209,141,209,130,208,
+190,209,130,208,177,209,139,208,187,208,176,209,129,208,181,208,177,209,143,208,
+190,208,180,208,184,208,189,209,129,208,181,208,177,208,181,208,189,208,176,208,
+180,208,190,209,129,208,176,208,185,209,130,209,132,208,190,209,130,208,190,208,
+189,208,181,208,179,208,190,209,129,208,178,208,190,208,184,209,129,208,178,208,
+190,208,185,208,184,208,179,209,128,209,139,209,130,208,190,208,182,208,181,208,
+178,209,129,208,181,208,188,209,129,208,178,208,190,209,142,208,187,208,184,209,
+136,209,140,209,141,209,130,208,184,209,133,208,191,208,190,208,186,208,176,208,
+180,208,189,208,181,208,185,208,180,208,190,208,188,208,176,208,188,208,184,209,
+128,208,176,208,187,208,184,208,177,208,190,209,130,208,181,208,188,209,131,209,
+133,208,190,209,130,209,143,208,180,208,178,209,131,209,133,209,129,208,181,209,
+130,208,184,208,187,209,142,208,180,208,184,208,180,208,181,208,187,208,190,208,
+188,208,184,209,128,208,181,209,130,208,181,208,177,209,143,209,129,208,178,208,
+190,208,181,208,178,208,184,208,180,208,181,209,135,208,181,208,179,208,190,209,
+141,209,130,208,184,208,188,209,129,209,135,208,181,209,130,209,130,208,181,208,
+188,209,139,209,134,208,181,208,189,209,139,209,129,209,130,208,176,208,187,208,
+178,208,181,208,180,209,140,209,130,208,181,208,188,208,181,208,178,208,190,208,
+180,209,139,209,130,208,181,208,177,208,181,208,178,209,139,209,136,208,181,208,
+189,208,176,208,188,208,184,209,130,208,184,208,191,208,176,209,130,208,190,208,
+188,209,131,208,191,209,128,208,176,208,178,208,187,208,184,209,134,208,176,208,
+190,208,180,208,189,208,176,208,179,208,190,208,180,209,139,208,183,208,189,208,
+176,209,142,208,188,208,190,208,179,209,131,208,180,209,128,209,131,208,179,208,
+178,209,129,208,181,208,185,208,184,208,180,208,181,209,130,208,186,208,184,208,
+189,208,190,208,190,208,180,208,189,208,190,208,180,208,181,208,187,208,176,208,
+180,208,181,208,187,208,181,209,129,209,128,208,190,208,186,208,184,209,142,208,
+189,209,143,208,178,208,181,209,129,209,140,208,149,209,129,209,130,209,140,209,
+128,208,176,208,183,208,176,208,189,208,176,209,136,208,184,216,167,217,132,217,
+132,217,135,216,167,217,132,216,170,217,138,216,172,217,133,217,138,216,185,216,
+174,216,167,216,181,216,169,216,167,217,132,216,176,217,138,216,185,217,132,217,
+138,217,135,216,172,216,175,217,138,216,175,216,167,217,132,216,162,217,134,216,
+167,217,132,216,177,216,175,216,170,216,173,217,131,217,133,216,181,217,129,216,
+173,216,169,217,131,216,167,217,134,216,170,216,167,217,132,217,132,217,138,217,
+138,217,131,217,136,217,134,216,180,216,168,217,131,216,169,217,129,217,138,217,
+135,216,167,216,168,217,134,216,167,216,170,216,173,217,136,216,167,216,161,216,
+163,217,131,216,171,216,177,216,174,217,132,216,167,217,132,216,167,217,132,216,
+173,216,168,216,175,217,132,217,138,217,132,216,175,216,177,217,136,216,179,216,
+167,216,182,216,186,216,183,216,170,217,131,217,136,217,134,217,135,217,134,216,
+167,217,131,216,179,216,167,216,173,216,169,217,134,216,167,216,175,217,138,216,
+167,217,132,216,183,216,168,216,185,217,132,217,138,217,131,216,180,217,131,216,
+177,216,167,217,138,217,133,217,131,217,134,217,133,217,134,217,135,216,167,216,
+180,216,177,217,131,216,169,216,177,216,166,217,138,216,179,217,134,216,180,217,
+138,216,183,217,133,216,167,216,176,216,167,216,167,217,132,217,129,217,134,216,
+180,216,168,216,167,216,168,216,170,216,185,216,168,216,177,216,177,216,173,217,
+133,216,169,217,131,216,167,217,129,216,169,217,138,217,130,217,136,217,132,217,
+133,216,177,217,131,216,178,217,131,217,132,217,133,216,169,216,163,216,173,217,
+133,216,175,217,130,217,132,216,168,217,138,217,138,216,185,217,134,217,138,216,
+181,217,136,216,177,216,169,216,183,216,177,217,138,217,130,216,180,216,167,216,
+177,217,131,216,172,217,136,216,167,217,132,216,163,216,174,216,177,217,137,217,
+133,216,185,217,134,216,167,216,167,216,168,216,173,216,171,216,185,216,177,217,
+136,216,182,216,168,216,180,217,131,217,132,217,133,216,179,216,172,217,132,216,
+168,217,134,216,167,217,134,216,174,216,167,217,132,216,175,217,131,216,170,216,
+167,216,168,217,131,217,132,217,138,216,169,216,168,216,175,217,136,217,134,216,
+163,217,138,216,182,216,167,217,138,217,136,216,172,216,175,217,129,216,177,217,
+138,217,130,217,131,216,170,216,168,216,170,216,163,217,129,216,182,217,132,217,
+133,216,183,216,168,216,174,216,167,217,131,216,171,216,177,216,168,216,167,216,
+177,217,131,216,167,217,129,216,182,217,132,216,167,216,173,217,132,217,137,217,
+134,217,129,216,179,217,135,216,163,217,138,216,167,217,133,216,177,216,175,217,
+136,216,175,216,163,217,134,217,135,216,167,216,175,217,138,217,134,216,167,216,
+167,217,132,216,167,217,134,217,133,216,185,216,177,216,182,216,170,216,185,217,
+132,217,133,216,175,216,167,216,174,217,132,217,133,217,133,217,131,217,134,0,0,
+0,0,0,0,0,0,1,0,1,0,1,0,1,0,2,0,2,0,2,0,2,0,4,0,4,0,4,0,4,0,0,1,2,3,4,5,6,7,7,6,
+5,4,3,2,1,0,8,9,10,11,12,13,14,15,15,14,13,12,11,10,9,8,16,17,18,19,20,21,22,23,
+23,22,21,20,19,18,17,16,24,25,26,27,28,29,30,31,31,30,29,28,27,26,25,24,255,255,
+255,255,0,0,0,0,0,0,0,0,255,255,255,255,1,0,0,0,2,0,0,0,2,0,0,0,1,0,0,0,1,0,0,0,
+3,0,0,0,255,255,0,1,0,0,0,1,0,0,255,255,0,1,0,0,0,8,0,8,0,8,0,8,0,0,0,1,0,2,0,3,
+0,4,0,5,0,6,0,7,114,101,115,111,117,114,99,101,115,99,111,117,110,116,114,105,
+101,115,113,117,101,115,116,105,111,110,115,101,113,117,105,112,109,101,110,116,
+99,111,109,109,117,110,105,116,121,97,118,97,105,108,97,98,108,101,104,105,103,
+104,108,105,103,104,116,68,84,68,47,120,104,116,109,108,109,97,114,107,101,116,
+105,110,103,107,110,111,119,108,101,100,103,101,115,111,109,101,116,104,105,110,
+103,99,111,110,116,97,105,110,101,114,100,105,114,101,99,116,105,111,110,115,117
+,98,115,99,114,105,98,101,97,100,118,101,114,116,105,115,101,99,104,97,114,97,99
+,116,101,114,34,32,118,97,108,117,101,61,34,60,47,115,101,108,101,99,116,62,65,
+117,115,116,114,97,108,105,97,34,32,99,108,97,115,115,61,34,115,105,116,117,97,
+116,105,111,110,97,117,116,104,111,114,105,116,121,102,111,108,108,111,119,105,
+110,103,112,114,105,109,97,114,105,108,121,111,112,101,114,97,116,105,111,110,99
+,104,97,108,108,101,110,103,101,100,101,118,101,108,111,112,101,100,97,110,111,
+110,121,109,111,117,115,102,117,110,99,116,105,111,110,32,102,117,110,99,116,105
+,111,110,115,99,111,109,112,97,110,105,101,115,115,116,114,117,99,116,117,114,
+101,97,103,114,101,101,109,101,110,116,34,32,116,105,116,108,101,61,34,112,111,
+116,101,110,116,105,97,108,101,100,117,99,97,116,105,111,110,97,114,103,117,109,
+101,110,116,115,115,101,99,111,110,100,97,114,121,99,111,112,121,114,105,103,104
+,116,108,97,110,103,117,97,103,101,115,101,120,99,108,117,115,105,118,101,99,111
+,110,100,105,116,105,111,110,60,47,102,111,114,109,62,13,10,115,116,97,116,101,
+109,101,110,116,97,116,116,101,110,116,105,111,110,66,105,111,103,114,97,112,104
+,121,125,32,101,108,115,101,32,123,10,115,111,108,117,116,105,111,110,115,119,
+104,101,110,32,116,104,101,32,65,110,97,108,121,116,105,99,115,116,101,109,112,
+108,97,116,101,115,100,97,110,103,101,114,111,117,115,115,97,116,101,108,108,105
+,116,101,100,111,99,117,109,101,110,116,115,112,117,98,108,105,115,104,101,114,
+105,109,112,111,114,116,97,110,116,112,114,111,116,111,116,121,112,101,105,110,
+102,108,117,101,110,99,101,38,114,97,113,117,111,59,60,47,101,102,102,101,99,116
+,105,118,101,103,101,110,101,114,97,108,108,121,116,114,97,110,115,102,111,114,
+109,98,101,97,117,116,105,102,117,108,116,114,97,110,115,112,111,114,116,111,114
+,103,97,110,105,122,101,100,112,117,98,108,105,115,104,101,100,112,114,111,109,
+105,110,101,110,116,117,110,116,105,108,32,116,104,101,116,104,117,109,98,110,97
+,105,108,78,97,116,105,111,110,97,108,32,46,102,111,99,117,115,40,41,59,111,118,
+101,114,32,116,104,101,32,109,105,103,114,97,116,105,111,110,97,110,110,111,117,
+110,99,101,100,102,111,111,116,101,114,34,62,10,101,120,99,101,112,116,105,111,
+110,108,101,115,115,32,116,104,97,110,101,120,112,101,110,115,105,118,101,102,
+111,114,109,97,116,105,111,110,102,114,97,109,101,119,111,114,107,116,101,114,
+114,105,116,111,114,121,110,100,105,99,97,116,105,111,110,99,117,114,114,101,110
+,116,108,121,99,108,97,115,115,78,97,109,101,99,114,105,116,105,99,105,115,109,
+116,114,97,100,105,116,105,111,110,101,108,115,101,119,104,101,114,101,65,108,
+101,120,97,110,100,101,114,97,112,112,111,105,110,116,101,100,109,97,116,101,114
+,105,97,108,115,98,114,111,97,100,99,97,115,116,109,101,110,116,105,111,110,101,
+100,97,102,102,105,108,105,97,116,101,60,47,111,112,116,105,111,110,62,116,114,
+101,97,116,109,101,110,116,100,105,102,102,101,114,101,110,116,47,100,101,102,97
+,117,108,116,46,80,114,101,115,105,100,101,110,116,111,110,99,108,105,99,107,61,
+34,98,105,111,103,114,97,112,104,121,111,116,104,101,114,119,105,115,101,112,101
+,114,109,97,110,101,110,116,70,114,97,110,195,167,97,105,115,72,111,108,108,121,
+119,111,111,100,101,120,112,97,110,115,105,111,110,115,116,97,110,100,97,114,100
+,115,60,47,115,116,121,108,101,62,10,114,101,100,117,99,116,105,111,110,68,101,
+99,101,109,98,101,114,32,112,114,101,102,101,114,114,101,100,67,97,109,98,114,
+105,100,103,101,111,112,112,111,110,101,110,116,115,66,117,115,105,110,101,115,
+115,32,99,111,110,102,117,115,105,111,110,62,10,60,116,105,116,108,101,62,112,
+114,101,115,101,110,116,101,100,101,120,112,108,97,105,110,101,100,100,111,101,
+115,32,110,111,116,32,119,111,114,108,100,119,105,100,101,105,110,116,101,114,
+102,97,99,101,112,111,115,105,116,105,111,110,115,110,101,119,115,112,97,112,101
+,114,60,47,116,97,98,108,101,62,10,109,111,117,110,116,97,105,110,115,108,105,
+107,101,32,116,104,101,32,101,115,115,101,110,116,105,97,108,102,105,110,97,110,
+99,105,97,108,115,101,108,101,99,116,105,111,110,97,99,116,105,111,110,61,34,47,
+97,98,97,110,100,111,110,101,100,69,100,117,99,97,116,105,111,110,112,97,114,115
+,101,73,110,116,40,115,116,97,98,105,108,105,116,121,117,110,97,98,108,101,32,
+116,111,60,47,116,105,116,108,101,62,10,114,101,108,97,116,105,111,110,115,78,
+111,116,101,32,116,104,97,116,101,102,102,105,99,105,101,110,116,112,101,114,102
+,111,114,109,101,100,116,119,111,32,121,101,97,114,115,83,105,110,99,101,32,116,
+104,101,116,104,101,114,101,102,111,114,101,119,114,97,112,112,101,114,34,62,97,
+108,116,101,114,110,97,116,101,105,110,99,114,101,97,115,101,100,66,97,116,116,
+108,101,32,111,102,112,101,114,99,101,105,118,101,100,116,114,121,105,110,103,32
+,116,111,110,101,99,101,115,115,97,114,121,112,111,114,116,114,97,121,101,100,
+101,108,101,99,116,105,111,110,115,69,108,105,122,97,98,101,116,104,60,47,105,
+102,114,97,109,101,62,100,105,115,99,111,118,101,114,121,105,110,115,117,114,97,
+110,99,101,115,46,108,101,110,103,116,104,59,108,101,103,101,110,100,97,114,121,
+71,101,111,103,114,97,112,104,121,99,97,110,100,105,100,97,116,101,99,111,114,
+112,111,114,97,116,101,115,111,109,101,116,105,109,101,115,115,101,114,118,105,
+99,101,115,46,105,110,104,101,114,105,116,101,100,60,47,115,116,114,111,110,103,
+62,67,111,109,109,117,110,105,116,121,114,101,108,105,103,105,111,117,115,108,
+111,99,97,116,105,111,110,115,67,111,109,109,105,116,116,101,101,98,117,105,108,
+100,105,110,103,115,116,104,101,32,119,111,114,108,100,110,111,32,108,111,110,
+103,101,114,98,101,103,105,110,110,105,110,103,114,101,102,101,114,101,110,99,
+101,99,97,110,110,111,116,32,98,101,102,114,101,113,117,101,110,99,121,116,121,
+112,105,99,97,108,108,121,105,110,116,111,32,116,104,101,32,114,101,108,97,116,
+105,118,101,59,114,101,99,111,114,100,105,110,103,112,114,101,115,105,100,101,
+110,116,105,110,105,116,105,97,108,108,121,116,101,99,104,110,105,113,117,101,
+116,104,101,32,111,116,104,101,114,105,116,32,99,97,110,32,98,101,101,120,105,
+115,116,101,110,99,101,117,110,100,101,114,108,105,110,101,116,104,105,115,32,
+116,105,109,101,116,101,108,101,112,104,111,110,101,105,116,101,109,115,99,111,
+112,101,112,114,97,99,116,105,99,101,115,97,100,118,97,110,116,97,103,101,41,59,
+114,101,116,117,114,110,32,70,111,114,32,111,116,104,101,114,112,114,111,118,105
+,100,105,110,103,100,101,109,111,99,114,97,99,121,98,111,116,104,32,116,104,101,
+32,101,120,116,101,110,115,105,118,101,115,117,102,102,101,114,105,110,103,115,
+117,112,112,111,114,116,101,100,99,111,109,112,117,116,101,114,115,32,102,117,
+110,99,116,105,111,110,112,114,97,99,116,105,99,97,108,115,97,105,100,32,116,104
+,97,116,105,116,32,109,97,121,32,98,101,69,110,103,108,105,115,104,60,47,102,114
+,111,109,32,116,104,101,32,115,99,104,101,100,117,108,101,100,100,111,119,110,
+108,111,97,100,115,60,47,108,97,98,101,108,62,10,115,117,115,112,101,99,116,101,
+100,109,97,114,103,105,110,58,32,48,115,112,105,114,105,116,117,97,108,60,47,104
+,101,97,100,62,10,10,109,105,99,114,111,115,111,102,116,103,114,97,100,117,97,
+108,108,121,100,105,115,99,117,115,115,101,100,104,101,32,98,101,99,97,109,101,
+101,120,101,99,117,116,105,118,101,106,113,117,101,114,121,46,106,115,104,111,
+117,115,101,104,111,108,100,99,111,110,102,105,114,109,101,100,112,117,114,99,
+104,97,115,101,100,108,105,116,101,114,97,108,108,121,100,101,115,116,114,111,
+121,101,100,117,112,32,116,111,32,116,104,101,118,97,114,105,97,116,105,111,110,
+114,101,109,97,105,110,105,110,103,105,116,32,105,115,32,110,111,116,99,101,110,
+116,117,114,105,101,115,74,97,112,97,110,101,115,101,32,97,109,111,110,103,32,
+116,104,101,99,111,109,112,108,101,116,101,100,97,108,103,111,114,105,116,104,
+109,105,110,116,101,114,101,115,116,115,114,101,98,101,108,108,105,111,110,117,
+110,100,101,102,105,110,101,100,101,110,99,111,117,114,97,103,101,114,101,115,
+105,122,97,98,108,101,105,110,118,111,108,118,105,110,103,115,101,110,115,105,
+116,105,118,101,117,110,105,118,101,114,115,97,108,112,114,111,118,105,115,105,
+111,110,40,97,108,116,104,111,117,103,104,102,101,97,116,117,114,105,110,103,99,
+111,110,100,117,99,116,101,100,41,44,32,119,104,105,99,104,32,99,111,110,116,105
+,110,117,101,100,45,104,101,97,100,101,114,34,62,70,101,98,114,117,97,114,121,32
+,110,117,109,101,114,111,117,115,32,111,118,101,114,102,108,111,119,58,99,111,
+109,112,111,110,101,110,116,102,114,97,103,109,101,110,116,115,101,120,99,101,
+108,108,101,110,116,99,111,108,115,112,97,110,61,34,116,101,99,104,110,105,99,97
+,108,110,101,97,114,32,116,104,101,32,65,100,118,97,110,99,101,100,32,115,111,
+117,114,99,101,32,111,102,101,120,112,114,101,115,115,101,100,72,111,110,103,32,
+75,111,110,103,32,70,97,99,101,98,111,111,107,109,117,108,116,105,112,108,101,32
+,109,101,99,104,97,110,105,115,109,101,108,101,118,97,116,105,111,110,111,102,
+102,101,110,115,105,118,101,60,47,102,111,114,109,62,10,9,115,112,111,110,115,
+111,114,101,100,100,111,99,117,109,101,110,116,46,111,114,32,38,113,117,111,116,
+59,116,104,101,114,101,32,97,114,101,116,104,111,115,101,32,119,104,111,109,111,
+118,101,109,101,110,116,115,112,114,111,99,101,115,115,101,115,100,105,102,102,
+105,99,117,108,116,115,117,98,109,105,116,116,101,100,114,101,99,111,109,109,101
+,110,100,99,111,110,118,105,110,99,101,100,112,114,111,109,111,116,105,110,103,
+34,32,119,105,100,116,104,61,34,46,114,101,112,108,97,99,101,40,99,108,97,115,
+115,105,99,97,108,99,111,97,108,105,116,105,111,110,104,105,115,32,102,105,114,
+115,116,100,101,99,105,115,105,111,110,115,97,115,115,105,115,116,97,110,116,105
+,110,100,105,99,97,116,101,100,101,118,111,108,117,116,105,111,110,45,119,114,97
+,112,112,101,114,34,101,110,111,117,103,104,32,116,111,97,108,111,110,103,32,116
+,104,101,100,101,108,105,118,101,114,101,100,45,45,62,13,10,60,33,45,45,65,109,
+101,114,105,99,97,110,32,112,114,111,116,101,99,116,101,100,78,111,118,101,109,
+98,101,114,32,60,47,115,116,121,108,101,62,60,102,117,114,110,105,116,117,114,
+101,73,110,116,101,114,110,101,116,32,32,111,110,98,108,117,114,61,34,115,117,
+115,112,101,110,100,101,100,114,101,99,105,112,105,101,110,116,98,97,115,101,100
+,32,111,110,32,77,111,114,101,111,118,101,114,44,97,98,111,108,105,115,104,101,
+100,99,111,108,108,101,99,116,101,100,119,101,114,101,32,109,97,100,101,101,109,
+111,116,105,111,110,97,108,101,109,101,114,103,101,110,99,121,110,97,114,114,97,
+116,105,118,101,97,100,118,111,99,97,116,101,115,112,120,59,98,111,114,100,101,
+114,99,111,109,109,105,116,116,101,100,100,105,114,61,34,108,116,114,34,101,109,
+112,108,111,121,101,101,115,114,101,115,101,97,114,99,104,46,32,115,101,108,101,
+99,116,101,100,115,117,99,99,101,115,115,111,114,99,117,115,116,111,109,101,114,
+115,100,105,115,112,108,97,121,101,100,83,101,112,116,101,109,98,101,114,97,100,
+100,67,108,97,115,115,40,70,97,99,101,98,111,111,107,32,115,117,103,103,101,115,
+116,101,100,97,110,100,32,108,97,116,101,114,111,112,101,114,97,116,105,110,103,
+101,108,97,98,111,114,97,116,101,83,111,109,101,116,105,109,101,115,73,110,115,
+116,105,116,117,116,101,99,101,114,116,97,105,110,108,121,105,110,115,116,97,108
+,108,101,100,102,111,108,108,111,119,101,114,115,74,101,114,117,115,97,108,101,
+109,116,104,101,121,32,104,97,118,101,99,111,109,112,117,116,105,110,103,103,101
+,110,101,114,97,116,101,100,112,114,111,118,105,110,99,101,115,103,117,97,114,97
+,110,116,101,101,97,114,98,105,116,114,97,114,121,114,101,99,111,103,110,105,122
+,101,119,97,110,116,101,100,32,116,111,112,120,59,119,105,100,116,104,58,116,104
+,101,111,114,121,32,111,102,98,101,104,97,118,105,111,117,114,87,104,105,108,101
+,32,116,104,101,101,115,116,105,109,97,116,101,100,98,101,103,97,110,32,116,111,
+32,105,116,32,98,101,99,97,109,101,109,97,103,110,105,116,117,100,101,109,117,
+115,116,32,104,97,118,101,109,111,114,101,32,116,104,97,110,68,105,114,101,99,
+116,111,114,121,101,120,116,101,110,115,105,111,110,115,101,99,114,101,116,97,
+114,121,110,97,116,117,114,97,108,108,121,111,99,99,117,114,114,105,110,103,118,
+97,114,105,97,98,108,101,115,103,105,118,101,110,32,116,104,101,112,108,97,116,
+102,111,114,109,46,60,47,108,97,98,101,108,62,60,102,97,105,108,101,100,32,116,
+111,99,111,109,112,111,117,110,100,115,107,105,110,100,115,32,111,102,32,115,111
+,99,105,101,116,105,101,115,97,108,111,110,103,115,105,100,101,32,45,45,38,103,
+116,59,10,10,115,111,117,116,104,119,101,115,116,116,104,101,32,114,105,103,104,
+116,114,97,100,105,97,116,105,111,110,109,97,121,32,104,97,118,101,32,117,110,
+101,115,99,97,112,101,40,115,112,111,107,101,110,32,105,110,34,32,104,114,101,
+102,61,34,47,112,114,111,103,114,97,109,109,101,111,110,108,121,32,116,104,101,
+32,99,111,109,101,32,102,114,111,109,100,105,114,101,99,116,111,114,121,98,117,
+114,105,101,100,32,105,110,97,32,115,105,109,105,108,97,114,116,104,101,121,32,
+119,101,114,101,60,47,102,111,110,116,62,60,47,78,111,114,119,101,103,105,97,110
+,115,112,101,99,105,102,105,101,100,112,114,111,100,117,99,105,110,103,112,97,
+115,115,101,110,103,101,114,40,110,101,119,32,68,97,116,101,116,101,109,112,111,
+114,97,114,121,102,105,99,116,105,111,110,97,108,65,102,116,101,114,32,116,104,
+101,101,113,117,97,116,105,111,110,115,100,111,119,110,108,111,97,100,46,114,101
+,103,117,108,97,114,108,121,100,101,118,101,108,111,112,101,114,97,98,111,118,
+101,32,116,104,101,108,105,110,107,101,100,32,116,111,112,104,101,110,111,109,
+101,110,97,112,101,114,105,111,100,32,111,102,116,111,111,108,116,105,112,34,62,
+115,117,98,115,116,97,110,99,101,97,117,116,111,109,97,116,105,99,97,115,112,101
+,99,116,32,111,102,65,109,111,110,103,32,116,104,101,99,111,110,110,101,99,116,
+101,100,101,115,116,105,109,97,116,101,115,65,105,114,32,70,111,114,99,101,115,
+121,115,116,101,109,32,111,102,111,98,106,101,99,116,105,118,101,105,109,109,101
+,100,105,97,116,101,109,97,107,105,110,103,32,105,116,112,97,105,110,116,105,110
+,103,115,99,111,110,113,117,101,114,101,100,97,114,101,32,115,116,105,108,108,
+112,114,111,99,101,100,117,114,101,103,114,111,119,116,104,32,111,102,104,101,97
+,100,101,100,32,98,121,69,117,114,111,112,101,97,110,32,100,105,118,105,115,105,
+111,110,115,109,111,108,101,99,117,108,101,115,102,114,97,110,99,104,105,115,101
+,105,110,116,101,110,116,105,111,110,97,116,116,114,97,99,116,101,100,99,104,105
+,108,100,104,111,111,100,97,108,115,111,32,117,115,101,100,100,101,100,105,99,97
+,116,101,100,115,105,110,103,97,112,111,114,101,100,101,103,114,101,101,32,111,
+102,102,97,116,104,101,114,32,111,102,99,111,110,102,108,105,99,116,115,60,47,97
+,62,60,47,112,62,10,99,97,109,101,32,102,114,111,109,119,101,114,101,32,117,115,
+101,100,110,111,116,101,32,116,104,97,116,114,101,99,101,105,118,105,110,103,69,
+120,101,99,117,116,105,118,101,101,118,101,110,32,109,111,114,101,97,99,99,101,
+115,115,32,116,111,99,111,109,109,97,110,100,101,114,80,111,108,105,116,105,99,
+97,108,109,117,115,105,99,105,97,110,115,100,101,108,105,99,105,111,117,115,112,
+114,105,115,111,110,101,114,115,97,100,118,101,110,116,32,111,102,85,84,70,45,56
+,34,32,47,62,60,33,91,67,68,65,84,65,91,34,62,67,111,110,116,97,99,116,83,111,
+117,116,104,101,114,110,32,98,103,99,111,108,111,114,61,34,115,101,114,105,101,
+115,32,111,102,46,32,73,116,32,119,97,115,32,105,110,32,69,117,114,111,112,101,
+112,101,114,109,105,116,116,101,100,118,97,108,105,100,97,116,101,46,97,112,112,
+101,97,114,105,110,103,111,102,102,105,99,105,97,108,115,115,101,114,105,111,117
+,115,108,121,45,108,97,110,103,117,97,103,101,105,110,105,116,105,97,116,101,100
+,101,120,116,101,110,100,105,110,103,108,111,110,103,45,116,101,114,109,105,110,
+102,108,97,116,105,111,110,115,117,99,104,32,116,104,97,116,103,101,116,67,111,
+111,107,105,101,109,97,114,107,101,100,32,98,121,60,47,98,117,116,116,111,110,62
+,105,109,112,108,101,109,101,110,116,98,117,116,32,105,116,32,105,115,105,110,99
+,114,101,97,115,101,115,100,111,119,110,32,116,104,101,32,114,101,113,117,105,
+114,105,110,103,100,101,112,101,110,100,101,110,116,45,45,62,10,60,33,45,45,32,
+105,110,116,101,114,118,105,101,119,87,105,116,104,32,116,104,101,32,99,111,112,
+105,101,115,32,111,102,99,111,110,115,101,110,115,117,115,119,97,115,32,98,117,
+105,108,116,86,101,110,101,122,117,101,108,97,40,102,111,114,109,101,114,108,121
+,116,104,101,32,115,116,97,116,101,112,101,114,115,111,110,110,101,108,115,116,
+114,97,116,101,103,105,99,102,97,118,111,117,114,32,111,102,105,110,118,101,110,
+116,105,111,110,87,105,107,105,112,101,100,105,97,99,111,110,116,105,110,101,110
+,116,118,105,114,116,117,97,108,108,121,119,104,105,99,104,32,119,97,115,112,114
+,105,110,99,105,112,108,101,67,111,109,112,108,101,116,101,32,105,100,101,110,
+116,105,99,97,108,115,104,111,119,32,116,104,97,116,112,114,105,109,105,116,105,
+118,101,97,119,97,121,32,102,114,111,109,109,111,108,101,99,117,108,97,114,112,
+114,101,99,105,115,101,108,121,100,105,115,115,111,108,118,101,100,85,110,100,
+101,114,32,116,104,101,118,101,114,115,105,111,110,61,34,62,38,110,98,115,112,59
+,60,47,73,116,32,105,115,32,116,104,101,32,84,104,105,115,32,105,115,32,119,105,
+108,108,32,104,97,118,101,111,114,103,97,110,105,115,109,115,115,111,109,101,32,
+116,105,109,101,70,114,105,101,100,114,105,99,104,119,97,115,32,102,105,114,115,
+116,116,104,101,32,111,110,108,121,32,102,97,99,116,32,116,104,97,116,102,111,
+114,109,32,105,100,61,34,112,114,101,99,101,100,105,110,103,84,101,99,104,110,
+105,99,97,108,112,104,121,115,105,99,105,115,116,111,99,99,117,114,115,32,105,
+110,110,97,118,105,103,97,116,111,114,115,101,99,116,105,111,110,34,62,115,112,
+97,110,32,105,100,61,34,115,111,117,103,104,116,32,116,111,98,101,108,111,119,32
+,116,104,101,115,117,114,118,105,118,105,110,103,125,60,47,115,116,121,108,101,
+62,104,105,115,32,100,101,97,116,104,97,115,32,105,110,32,116,104,101,99,97,117,
+115,101,100,32,98,121,112,97,114,116,105,97,108,108,121,101,120,105,115,116,105,
+110,103,32,117,115,105,110,103,32,116,104,101,119,97,115,32,103,105,118,101,110,
+97,32,108,105,115,116,32,111,102,108,101,118,101,108,115,32,111,102,110,111,116,
+105,111,110,32,111,102,79,102,102,105,99,105,97,108,32,100,105,115,109,105,115,
+115,101,100,115,99,105,101,110,116,105,115,116,114,101,115,101,109,98,108,101,
+115,100,117,112,108,105,99,97,116,101,101,120,112,108,111,115,105,118,101,114,
+101,99,111,118,101,114,101,100,97,108,108,32,111,116,104,101,114,103,97,108,108,
+101,114,105,101,115,123,112,97,100,100,105,110,103,58,112,101,111,112,108,101,32
+,111,102,114,101,103,105,111,110,32,111,102,97,100,100,114,101,115,115,101,115,
+97,115,115,111,99,105,97,116,101,105,109,103,32,97,108,116,61,34,105,110,32,109,
+111,100,101,114,110,115,104,111,117,108,100,32,98,101,109,101,116,104,111,100,32
+,111,102,114,101,112,111,114,116,105,110,103,116,105,109,101,115,116,97,109,112,
+110,101,101,100,101,100,32,116,111,116,104,101,32,71,114,101,97,116,114,101,103,
+97,114,100,105,110,103,115,101,101,109,101,100,32,116,111,118,105,101,119,101,
+100,32,97,115,105,109,112,97,99,116,32,111,110,105,100,101,97,32,116,104,97,116,
+116,104,101,32,87,111,114,108,100,104,101,105,103,104,116,32,111,102,101,120,112
+,97,110,100,105,110,103,84,104,101,115,101,32,97,114,101,99,117,114,114,101,110,
+116,34,62,99,97,114,101,102,117,108,108,121,109,97,105,110,116,97,105,110,115,99
+,104,97,114,103,101,32,111,102,67,108,97,115,115,105,99,97,108,97,100,100,114,
+101,115,115,101,100,112,114,101,100,105,99,116,101,100,111,119,110,101,114,115,
+104,105,112,60,100,105,118,32,105,100,61,34,114,105,103,104,116,34,62,13,10,114,
+101,115,105,100,101,110,99,101,108,101,97,118,101,32,116,104,101,99,111,110,116,
+101,110,116,34,62,97,114,101,32,111,102,116,101,110,32,32,125,41,40,41,59,13,10,
+112,114,111,98,97,98,108,121,32,80,114,111,102,101,115,115,111,114,45,98,117,116
+,116,111,110,34,32,114,101,115,112,111,110,100,101,100,115,97,121,115,32,116,104
+,97,116,104,97,100,32,116,111,32,98,101,112,108,97,99,101,100,32,105,110,72,117,
+110,103,97,114,105,97,110,115,116,97,116,117,115,32,111,102,115,101,114,118,101,
+115,32,97,115,85,110,105,118,101,114,115,97,108,101,120,101,99,117,116,105,111,
+110,97,103,103,114,101,103,97,116,101,102,111,114,32,119,104,105,99,104,105,110,
+102,101,99,116,105,111,110,97,103,114,101,101,100,32,116,111,104,111,119,101,118
+,101,114,44,32,112,111,112,117,108,97,114,34,62,112,108,97,99,101,100,32,111,110
+,99,111,110,115,116,114,117,99,116,101,108,101,99,116,111,114,97,108,115,121,109
+,98,111,108,32,111,102,105,110,99,108,117,100,105,110,103,114,101,116,117,114,
+110,32,116,111,97,114,99,104,105,116,101,99,116,67,104,114,105,115,116,105,97,
+110,112,114,101,118,105,111,117,115,32,108,105,118,105,110,103,32,105,110,101,97
+,115,105,101,114,32,116,111,112,114,111,102,101,115,115,111,114,10,38,108,116,59
+,33,45,45,32,101,102,102,101,99,116,32,111,102,97,110,97,108,121,116,105,99,115,
+119,97,115,32,116,97,107,101,110,119,104,101,114,101,32,116,104,101,116,111,111,
+107,32,111,118,101,114,98,101,108,105,101,102,32,105,110,65,102,114,105,107,97,
+97,110,115,97,115,32,102,97,114,32,97,115,112,114,101,118,101,110,116,101,100,
+119,111,114,107,32,119,105,116,104,97,32,115,112,101,99,105,97,108,60,102,105,
+101,108,100,115,101,116,67,104,114,105,115,116,109,97,115,82,101,116,114,105,101
+,118,101,100,10,10,73,110,32,116,104,101,32,98,97,99,107,32,105,110,116,111,110,
+111,114,116,104,101,97,115,116,109,97,103,97,122,105,110,101,115,62,60,115,116,
+114,111,110,103,62,99,111,109,109,105,116,116,101,101,103,111,118,101,114,110,
+105,110,103,103,114,111,117,112,115,32,111,102,115,116,111,114,101,100,32,105,
+110,101,115,116,97,98,108,105,115,104,97,32,103,101,110,101,114,97,108,105,116,
+115,32,102,105,114,115,116,116,104,101,105,114,32,111,119,110,112,111,112,117,
+108,97,116,101,100,97,110,32,111,98,106,101,99,116,67,97,114,105,98,98,101,97,
+110,97,108,108,111,119,32,116,104,101,100,105,115,116,114,105,99,116,115,119,105
+,115,99,111,110,115,105,110,108,111,99,97,116,105,111,110,46,59,32,119,105,100,
+116,104,58,32,105,110,104,97,98,105,116,101,100,83,111,99,105,97,108,105,115,116
+,74,97,110,117,97,114,121,32,49,60,47,102,111,111,116,101,114,62,115,105,109,105
+,108,97,114,108,121,99,104,111,105,99,101,32,111,102,116,104,101,32,115,97,109,
+101,32,115,112,101,99,105,102,105,99,32,98,117,115,105,110,101,115,115,32,84,104
+,101,32,102,105,114,115,116,46,108,101,110,103,116,104,59,32,100,101,115,105,114
+,101,32,116,111,100,101,97,108,32,119,105,116,104,115,105,110,99,101,32,116,104,
+101,117,115,101,114,65,103,101,110,116,99,111,110,99,101,105,118,101,100,105,110
+,100,101,120,46,112,104,112,97,115,32,38,113,117,111,116,59,101,110,103,97,103,
+101,32,105,110,114,101,99,101,110,116,108,121,44,102,101,119,32,121,101,97,114,
+115,119,101,114,101,32,97,108,115,111,10,60,104,101,97,100,62,10,60,101,100,105,
+116,101,100,32,98,121,97,114,101,32,107,110,111,119,110,99,105,116,105,101,115,
+32,105,110,97,99,99,101,115,115,107,101,121,99,111,110,100,101,109,110,101,100,
+97,108,115,111,32,104,97,118,101,115,101,114,118,105,99,101,115,44,102,97,109,
+105,108,121,32,111,102,83,99,104,111,111,108,32,111,102,99,111,110,118,101,114,
+116,101,100,110,97,116,117,114,101,32,111,102,32,108,97,110,103,117,97,103,101,
+109,105,110,105,115,116,101,114,115,60,47,111,98,106,101,99,116,62,116,104,101,
+114,101,32,105,115,32,97,32,112,111,112,117,108,97,114,115,101,113,117,101,110,
+99,101,115,97,100,118,111,99,97,116,101,100,84,104,101,121,32,119,101,114,101,97
+,110,121,32,111,116,104,101,114,108,111,99,97,116,105,111,110,61,101,110,116,101
+,114,32,116,104,101,109,117,99,104,32,109,111,114,101,114,101,102,108,101,99,116
+,101,100,119,97,115,32,110,97,109,101,100,111,114,105,103,105,110,97,108,32,97,
+32,116,121,112,105,99,97,108,119,104,101,110,32,116,104,101,121,101,110,103,105,
+110,101,101,114,115,99,111,117,108,100,32,110,111,116,114,101,115,105,100,101,
+110,116,115,119,101,100,110,101,115,100,97,121,116,104,101,32,116,104,105,114,
+100,32,112,114,111,100,117,99,116,115,74,97,110,117,97,114,121,32,50,119,104,97,
+116,32,116,104,101,121,97,32,99,101,114,116,97,105,110,114,101,97,99,116,105,111
+,110,115,112,114,111,99,101,115,115,111,114,97,102,116,101,114,32,104,105,115,
+116,104,101,32,108,97,115,116,32,99,111,110,116,97,105,110,101,100,34,62,60,47,
+100,105,118,62,10,60,47,97,62,60,47,116,100,62,100,101,112,101,110,100,32,111,
+110,115,101,97,114,99,104,34,62,10,112,105,101,99,101,115,32,111,102,99,111,109,
+112,101,116,105,110,103,82,101,102,101,114,101,110,99,101,116,101,110,110,101,
+115,115,101,101,119,104,105,99,104,32,104,97,115,32,118,101,114,115,105,111,110,
+61,60,47,115,112,97,110,62,32,60,60,47,104,101,97,100,101,114,62,103,105,118,101
+,115,32,116,104,101,104,105,115,116,111,114,105,97,110,118,97,108,117,101,61,34,
+34,62,112,97,100,100,105,110,103,58,48,118,105,101,119,32,116,104,97,116,116,111
+,103,101,116,104,101,114,44,116,104,101,32,109,111,115,116,32,119,97,115,32,102,
+111,117,110,100,115,117,98,115,101,116,32,111,102,97,116,116,97,99,107,32,111,
+110,99,104,105,108,100,114,101,110,44,112,111,105,110,116,115,32,111,102,112,101
+,114,115,111,110,97,108,32,112,111,115,105,116,105,111,110,58,97,108,108,101,103
+,101,100,108,121,67,108,101,118,101,108,97,110,100,119,97,115,32,108,97,116,101,
+114,97,110,100,32,97,102,116,101,114,97,114,101,32,103,105,118,101,110,119,97,
+115,32,115,116,105,108,108,115,99,114,111,108,108,105,110,103,100,101,115,105,
+103,110,32,111,102,109,97,107,101,115,32,116,104,101,109,117,99,104,32,108,101,
+115,115,65,109,101,114,105,99,97,110,115,46,10,10,65,102,116,101,114,32,44,32,98
+,117,116,32,116,104,101,77,117,115,101,117,109,32,111,102,108,111,117,105,115,
+105,97,110,97,40,102,114,111,109,32,116,104,101,109,105,110,110,101,115,111,116,
+97,112,97,114,116,105,99,108,101,115,97,32,112,114,111,99,101,115,115,68,111,109
+,105,110,105,99,97,110,118,111,108,117,109,101,32,111,102,114,101,116,117,114,
+110,105,110,103,100,101,102,101,110,115,105,118,101,48,48,112,120,124,114,105,
+103,104,109,97,100,101,32,102,114,111,109,109,111,117,115,101,111,118,101,114,34
+,32,115,116,121,108,101,61,34,115,116,97,116,101,115,32,111,102,40,119,104,105,
+99,104,32,105,115,99,111,110,116,105,110,117,101,115,70,114,97,110,99,105,115,99
+,111,98,117,105,108,100,105,110,103,32,119,105,116,104,111,117,116,32,97,119,105
+,116,104,32,115,111,109,101,119,104,111,32,119,111,117,108,100,97,32,102,111,114
+,109,32,111,102,97,32,112,97,114,116,32,111,102,98,101,102,111,114,101,32,105,
+116,107,110,111,119,110,32,97,115,32,32,83,101,114,118,105,99,101,115,108,111,99
+,97,116,105,111,110,32,97,110,100,32,111,102,116,101,110,109,101,97,115,117,114,
+105,110,103,97,110,100,32,105,116,32,105,115,112,97,112,101,114,98,97,99,107,118
+,97,108,117,101,115,32,111,102,13,10,60,116,105,116,108,101,62,61,32,119,105,110
+,100,111,119,46,100,101,116,101,114,109,105,110,101,101,114,38,113,117,111,116,
+59,32,112,108,97,121,101,100,32,98,121,97,110,100,32,101,97,114,108,121,60,47,99
+,101,110,116,101,114,62,102,114,111,109,32,116,104,105,115,116,104,101,32,116,
+104,114,101,101,112,111,119,101,114,32,97,110,100,111,102,32,38,113,117,111,116,
+59,105,110,110,101,114,72,84,77,76,60,97,32,104,114,101,102,61,34,121,58,105,110
+,108,105,110,101,59,67,104,117,114,99,104,32,111,102,116,104,101,32,101,118,101,
+110,116,118,101,114,121,32,104,105,103,104,111,102,102,105,99,105,97,108,32,45,
+104,101,105,103,104,116,58,32,99,111,110,116,101,110,116,61,34,47,99,103,105,45,
+98,105,110,47,116,111,32,99,114,101,97,116,101,97,102,114,105,107,97,97,110,115,
+101,115,112,101,114,97,110,116,111,102,114,97,110,195,167,97,105,115,108,97,116,
+118,105,101,197,161,117,108,105,101,116,117,118,105,197,179,196,140,101,197,161,
+116,105,110,97,196,141,101,197,161,116,105,110,97,224,185,132,224,184,151,224,
+184,162,230,151,165,230,156,172,232,170,158,231,174,128,228,189,147,229,173,151,
+231,185,129,233,171,148,229,173,151,237,149,156,234,181,173,236,150,180,228,184,
+186,228,187,128,228,185,136,232,174,161,231,174,151,230,156,186,231,172,148,232,
+174,176,230,156,172,232,168,142,232,171,150,229,141,128,230,156,141,229,138,161,
+229,153,168,228,186,146,232,129,148,231,189,145,230,136,191,229,156,176,228,186,
+167,228,191,177,228,185,144,233,131,168,229,135,186,231,137,136,231,164,190,230,
+142,146,232,161,140,230,166,156,233,131,168,232,144,189,230,160,188,232,191,155,
+228,184,128,230,173,165,230,148,175,228,187,152,229,174,157,233,170,140,232,175,
+129,231,160,129,229,167,148,229,145,152,228,188,154,230,149,176,230,141,174,229,
+186,147,230,182,136,232,180,185,232,128,133,229,138,158,229,133,172,229,174,164,
+232,174,168,232,174,186,229,140,186,230,183,177,229,156,179,229,184,130,230,146,
+173,230,148,190,229,153,168,229,140,151,228,186,172,229,184,130,229,164,167,229,
+173,166,231,148,159,232,182,138,230,157,165,232,182,138,231,174,161,231,144,134,
+229,145,152,228,191,161,230,129,175,231,189,145,115,101,114,118,105,99,105,111,
+115,97,114,116,195,173,99,117,108,111,97,114,103,101,110,116,105,110,97,98,97,
+114,99,101,108,111,110,97,99,117,97,108,113,117,105,101,114,112,117,98,108,105,
+99,97,100,111,112,114,111,100,117,99,116,111,115,112,111,108,195,173,116,105,99,
+97,114,101,115,112,117,101,115,116,97,119,105,107,105,112,101,100,105,97,115,105
+,103,117,105,101,110,116,101,98,195,186,115,113,117,101,100,97,99,111,109,117,
+110,105,100,97,100,115,101,103,117,114,105,100,97,100,112,114,105,110,99,105,112
+,97,108,112,114,101,103,117,110,116,97,115,99,111,110,116,101,110,105,100,111,
+114,101,115,112,111,110,100,101,114,118,101,110,101,122,117,101,108,97,112,114,
+111,98,108,101,109,97,115,100,105,99,105,101,109,98,114,101,114,101,108,97,99,
+105,195,179,110,110,111,118,105,101,109,98,114,101,115,105,109,105,108,97,114,
+101,115,112,114,111,121,101,99,116,111,115,112,114,111,103,114,97,109,97,115,105
+,110,115,116,105,116,117,116,111,97,99,116,105,118,105,100,97,100,101,110,99,117
+,101,110,116,114,97,101,99,111,110,111,109,195,173,97,105,109,195,161,103,101,
+110,101,115,99,111,110,116,97,99,116,97,114,100,101,115,99,97,114,103,97,114,110
+,101,99,101,115,97,114,105,111,97,116,101,110,99,105,195,179,110,116,101,108,195
+,169,102,111,110,111,99,111,109,105,115,105,195,179,110,99,97,110,99,105,111,110
+,101,115,99,97,112,97,99,105,100,97,100,101,110,99,111,110,116,114,97,114,97,110
+,195,161,108,105,115,105,115,102,97,118,111,114,105,116,111,115,116,195,169,114,
+109,105,110,111,115,112,114,111,118,105,110,99,105,97,101,116,105,113,117,101,
+116,97,115,101,108,101,109,101,110,116,111,115,102,117,110,99,105,111,110,101,
+115,114,101,115,117,108,116,97,100,111,99,97,114,195,161,99,116,101,114,112,114,
+111,112,105,101,100,97,100,112,114,105,110,99,105,112,105,111,110,101,99,101,115
+,105,100,97,100,109,117,110,105,99,105,112,97,108,99,114,101,97,99,105,195,179,
+110,100,101,115,99,97,114,103,97,115,112,114,101,115,101,110,99,105,97,99,111,
+109,101,114,99,105,97,108,111,112,105,110,105,111,110,101,115,101,106,101,114,99
+,105,99,105,111,101,100,105,116,111,114,105,97,108,115,97,108,97,109,97,110,99,
+97,103,111,110,122,195,161,108,101,122,100,111,99,117,109,101,110,116,111,112,
+101,108,195,173,99,117,108,97,114,101,99,105,101,110,116,101,115,103,101,110,101
+,114,97,108,101,115,116,97,114,114,97,103,111,110,97,112,114,195,161,99,116,105,
+99,97,110,111,118,101,100,97,100,101,115,112,114,111,112,117,101,115,116,97,112,
+97,99,105,101,110,116,101,115,116,195,169,99,110,105,99,97,115,111,98,106,101,
+116,105,118,111,115,99,111,110,116,97,99,116,111,115,224,164,174,224,165,135,224
+,164,130,224,164,178,224,164,191,224,164,143,224,164,185,224,165,136,224,164,130
+,224,164,151,224,164,175,224,164,190,224,164,184,224,164,190,224,164,165,224,164
+,143,224,164,181,224,164,130,224,164,176,224,164,185,224,165,135,224,164,149,224
+,165,139,224,164,136,224,164,149,224,165,129,224,164,155,224,164,176,224,164,185
+,224,164,190,224,164,172,224,164,190,224,164,166,224,164,149,224,164,185,224,164
+,190,224,164,184,224,164,173,224,165,128,224,164,185,224,165,129,224,164,143,224
+,164,176,224,164,185,224,165,128,224,164,174,224,165,136,224,164,130,224,164,166
+,224,164,191,224,164,168,224,164,172,224,164,190,224,164,164,100,105,112,108,111
+,100,111,99,115,224,164,184,224,164,174,224,164,175,224,164,176,224,165,130,224,
+164,170,224,164,168,224,164,190,224,164,174,224,164,170,224,164,164,224,164,190,
+224,164,171,224,164,191,224,164,176,224,164,148,224,164,184,224,164,164,224,164,
+164,224,164,176,224,164,185,224,164,178,224,165,139,224,164,151,224,164,185,224,
+165,129,224,164,134,224,164,172,224,164,190,224,164,176,224,164,166,224,165,135,
+224,164,182,224,164,185,224,165,129,224,164,136,224,164,150,224,165,135,224,164,
+178,224,164,175,224,164,166,224,164,191,224,164,149,224,164,190,224,164,174,224,
+164,181,224,165,135,224,164,172,224,164,164,224,165,128,224,164,168,224,164,172,
+224,165,128,224,164,154,224,164,174,224,165,140,224,164,164,224,164,184,224,164,
+190,224,164,178,224,164,178,224,165,135,224,164,150,224,164,156,224,165,137,224,
+164,172,224,164,174,224,164,166,224,164,166,224,164,164,224,164,165,224,164,190,
+224,164,168,224,164,185,224,165,128,224,164,182,224,164,185,224,164,176,224,164,
+133,224,164,178,224,164,151,224,164,149,224,164,173,224,165,128,224,164,168,224,
+164,151,224,164,176,224,164,170,224,164,190,224,164,184,224,164,176,224,164,190,
+224,164,164,224,164,149,224,164,191,224,164,143,224,164,137,224,164,184,224,165,
+135,224,164,151,224,164,175,224,165,128,224,164,185,224,165,130,224,164,129,224,
+164,134,224,164,151,224,165,135,224,164,159,224,165,128,224,164,174,224,164,150,
+224,165,139,224,164,156,224,164,149,224,164,190,224,164,176,224,164,133,224,164,
+173,224,165,128,224,164,151,224,164,175,224,165,135,224,164,164,224,165,129,224,
+164,174,224,164,181,224,165,139,224,164,159,224,164,166,224,165,135,224,164,130,
+224,164,133,224,164,151,224,164,176,224,164,144,224,164,184,224,165,135,224,164,
+174,224,165,135,224,164,178,224,164,178,224,164,151,224,164,190,224,164,185,224,
+164,190,224,164,178,224,164,138,224,164,170,224,164,176,224,164,154,224,164,190,
+224,164,176,224,164,144,224,164,184,224,164,190,224,164,166,224,165,135,224,164,
+176,224,164,156,224,164,191,224,164,184,224,164,166,224,164,191,224,164,178,224,
+164,172,224,164,130,224,164,166,224,164,172,224,164,168,224,164,190,224,164,185,
+224,165,130,224,164,130,224,164,178,224,164,190,224,164,150,224,164,156,224,165,
+128,224,164,164,224,164,172,224,164,159,224,164,168,224,164,174,224,164,191,224,
+164,178,224,164,135,224,164,184,224,165,135,224,164,134,224,164,168,224,165,135,
+224,164,168,224,164,175,224,164,190,224,164,149,224,165,129,224,164,178,224,164,
+178,224,165,137,224,164,151,224,164,173,224,164,190,224,164,151,224,164,176,224,
+165,135,224,164,178,224,164,156,224,164,151,224,164,185,224,164,176,224,164,190,
+224,164,174,224,164,178,224,164,151,224,165,135,224,164,170,224,165,135,224,164,
+156,224,164,185,224,164,190,224,164,165,224,164,135,224,164,184,224,165,128,224,
+164,184,224,164,185,224,165,128,224,164,149,224,164,178,224,164,190,224,164,160,
+224,165,128,224,164,149,224,164,185,224,164,190,224,164,129,224,164,166,224,165,
+130,224,164,176,224,164,164,224,164,185,224,164,164,224,164,184,224,164,190,224,
+164,164,224,164,175,224,164,190,224,164,166,224,164,134,224,164,175,224,164,190,
+224,164,170,224,164,190,224,164,149,224,164,149,224,165,140,224,164,168,224,164,
+182,224,164,190,224,164,174,224,164,166,224,165,135,224,164,150,224,164,175,224,
+164,185,224,165,128,224,164,176,224,164,190,224,164,175,224,164,150,224,165,129,
+224,164,166,224,164,178,224,164,151,224,165,128,99,97,116,101,103,111,114,105,
+101,115,101,120,112,101,114,105,101,110,99,101,60,47,116,105,116,108,101,62,13,
+10,67,111,112,121,114,105,103,104,116,32,106,97,118,97,115,99,114,105,112,116,99
+,111,110,100,105,116,105,111,110,115,101,118,101,114,121,116,104,105,110,103,60,
+112,32,99,108,97,115,115,61,34,116,101,99,104,110,111,108,111,103,121,98,97,99,
+107,103,114,111,117,110,100,60,97,32,99,108,97,115,115,61,34,109,97,110,97,103,
+101,109,101,110,116,38,99,111,112,121,59,32,50,48,49,106,97,118,97,83,99,114,105
+,112,116,99,104,97,114,97,99,116,101,114,115,98,114,101,97,100,99,114,117,109,98
+,116,104,101,109,115,101,108,118,101,115,104,111,114,105,122,111,110,116,97,108,
+103,111,118,101,114,110,109,101,110,116,67,97,108,105,102,111,114,110,105,97,97,
+99,116,105,118,105,116,105,101,115,100,105,115,99,111,118,101,114,101,100,78,97,
+118,105,103,97,116,105,111,110,116,114,97,110,115,105,116,105,111,110,99,111,110
+,110,101,99,116,105,111,110,110,97,118,105,103,97,116,105,111,110,97,112,112,101
+,97,114,97,110,99,101,60,47,116,105,116,108,101,62,60,109,99,104,101,99,107,98,
+111,120,34,32,116,101,99,104,110,105,113,117,101,115,112,114,111,116,101,99,116,
+105,111,110,97,112,112,97,114,101,110,116,108,121,97,115,32,119,101,108,108,32,
+97,115,117,110,116,39,44,32,39,85,65,45,114,101,115,111,108,117,116,105,111,110,
+111,112,101,114,97,116,105,111,110,115,116,101,108,101,118,105,115,105,111,110,
+116,114,97,110,115,108,97,116,101,100,87,97,115,104,105,110,103,116,111,110,110,
+97,118,105,103,97,116,111,114,46,32,61,32,119,105,110,100,111,119,46,105,109,112
+,114,101,115,115,105,111,110,38,108,116,59,98,114,38,103,116,59,108,105,116,101,
+114,97,116,117,114,101,112,111,112,117,108,97,116,105,111,110,98,103,99,111,108,
+111,114,61,34,35,101,115,112,101,99,105,97,108,108,121,32,99,111,110,116,101,110
+,116,61,34,112,114,111,100,117,99,116,105,111,110,110,101,119,115,108,101,116,
+116,101,114,112,114,111,112,101,114,116,105,101,115,100,101,102,105,110,105,116,
+105,111,110,108,101,97,100,101,114,115,104,105,112,84,101,99,104,110,111,108,111
+,103,121,80,97,114,108,105,97,109,101,110,116,99,111,109,112,97,114,105,115,111,
+110,117,108,32,99,108,97,115,115,61,34,46,105,110,100,101,120,79,102,40,34,99,
+111,110,99,108,117,115,105,111,110,100,105,115,99,117,115,115,105,111,110,99,111
+,109,112,111,110,101,110,116,115,98,105,111,108,111,103,105,99,97,108,82,101,118
+,111,108,117,116,105,111,110,95,99,111,110,116,97,105,110,101,114,117,110,100,
+101,114,115,116,111,111,100,110,111,115,99,114,105,112,116,62,60,112,101,114,109
+,105,115,115,105,111,110,101,97,99,104,32,111,116,104,101,114,97,116,109,111,115
+,112,104,101,114,101,32,111,110,102,111,99,117,115,61,34,60,102,111,114,109,32,
+105,100,61,34,112,114,111,99,101,115,115,105,110,103,116,104,105,115,46,118,97,
+108,117,101,103,101,110,101,114,97,116,105,111,110,67,111,110,102,101,114,101,
+110,99,101,115,117,98,115,101,113,117,101,110,116,119,101,108,108,45,107,110,111
+,119,110,118,97,114,105,97,116,105,111,110,115,114,101,112,117,116,97,116,105,
+111,110,112,104,101,110,111,109,101,110,111,110,100,105,115,99,105,112,108,105,
+110,101,108,111,103,111,46,112,110,103,34,32,40,100,111,99,117,109,101,110,116,
+44,98,111,117,110,100,97,114,105,101,115,101,120,112,114,101,115,115,105,111,110
+,115,101,116,116,108,101,109,101,110,116,66,97,99,107,103,114,111,117,110,100,
+111,117,116,32,111,102,32,116,104,101,101,110,116,101,114,112,114,105,115,101,40
+,34,104,116,116,112,115,58,34,32,117,110,101,115,99,97,112,101,40,34,112,97,115,
+115,119,111,114,100,34,32,100,101,109,111,99,114,97,116,105,99,60,97,32,104,114,
+101,102,61,34,47,119,114,97,112,112,101,114,34,62,10,109,101,109,98,101,114,115,
+104,105,112,108,105,110,103,117,105,115,116,105,99,112,120,59,112,97,100,100,105
+,110,103,112,104,105,108,111,115,111,112,104,121,97,115,115,105,115,116,97,110,
+99,101,117,110,105,118,101,114,115,105,116,121,102,97,99,105,108,105,116,105,101
+,115,114,101,99,111,103,110,105,122,101,100,112,114,101,102,101,114,101,110,99,
+101,105,102,32,40,116,121,112,101,111,102,109,97,105,110,116,97,105,110,101,100,
+118,111,99,97,98,117,108,97,114,121,104,121,112,111,116,104,101,115,105,115,46,
+115,117,98,109,105,116,40,41,59,38,97,109,112,59,110,98,115,112,59,97,110,110,
+111,116,97,116,105,111,110,98,101,104,105,110,100,32,116,104,101,70,111,117,110,
+100,97,116,105,111,110,112,117,98,108,105,115,104,101,114,34,97,115,115,117,109,
+112,116,105,111,110,105,110,116,114,111,100,117,99,101,100,99,111,114,114,117,
+112,116,105,111,110,115,99,105,101,110,116,105,115,116,115,101,120,112,108,105,
+99,105,116,108,121,105,110,115,116,101,97,100,32,111,102,100,105,109,101,110,115
+,105,111,110,115,32,111,110,67,108,105,99,107,61,34,99,111,110,115,105,100,101,
+114,101,100,100,101,112,97,114,116,109,101,110,116,111,99,99,117,112,97,116,105,
+111,110,115,111,111,110,32,97,102,116,101,114,105,110,118,101,115,116,109,101,
+110,116,112,114,111,110,111,117,110,99,101,100,105,100,101,110,116,105,102,105,
+101,100,101,120,112,101,114,105,109,101,110,116,77,97,110,97,103,101,109,101,110
+,116,103,101,111,103,114,97,112,104,105,99,34,32,104,101,105,103,104,116,61,34,
+108,105,110,107,32,114,101,108,61,34,46,114,101,112,108,97,99,101,40,47,100,101,
+112,114,101,115,115,105,111,110,99,111,110,102,101,114,101,110,99,101,112,117,
+110,105,115,104,109,101,110,116,101,108,105,109,105,110,97,116,101,100,114,101,
+115,105,115,116,97,110,99,101,97,100,97,112,116,97,116,105,111,110,111,112,112,
+111,115,105,116,105,111,110,119,101,108,108,32,107,110,111,119,110,115,117,112,
+112,108,101,109,101,110,116,100,101,116,101,114,109,105,110,101,100,104,49,32,99
+,108,97,115,115,61,34,48,112,120,59,109,97,114,103,105,110,109,101,99,104,97,110
+,105,99,97,108,115,116,97,116,105,115,116,105,99,115,99,101,108,101,98,114,97,
+116,101,100,71,111,118,101,114,110,109,101,110,116,10,10,68,117,114,105,110,103,
+32,116,100,101,118,101,108,111,112,101,114,115,97,114,116,105,102,105,99,105,97,
+108,101,113,117,105,118,97,108,101,110,116,111,114,105,103,105,110,97,116,101,
+100,67,111,109,109,105,115,115,105,111,110,97,116,116,97,99,104,109,101,110,116,
+60,115,112,97,110,32,105,100,61,34,116,104,101,114,101,32,119,101,114,101,78,101
+,100,101,114,108,97,110,100,115,98,101,121,111,110,100,32,116,104,101,114,101,
+103,105,115,116,101,114,101,100,106,111,117,114,110,97,108,105,115,116,102,114,
+101,113,117,101,110,116,108,121,97,108,108,32,111,102,32,116,104,101,108,97,110,
+103,61,34,101,110,34,32,60,47,115,116,121,108,101,62,13,10,97,98,115,111,108,117
+,116,101,59,32,115,117,112,112,111,114,116,105,110,103,101,120,116,114,101,109,
+101,108,121,32,109,97,105,110,115,116,114,101,97,109,60,47,115,116,114,111,110,
+103,62,32,112,111,112,117,108,97,114,105,116,121,101,109,112,108,111,121,109,101
+,110,116,60,47,116,97,98,108,101,62,13,10,32,99,111,108,115,112,97,110,61,34,60,
+47,102,111,114,109,62,10,32,32,99,111,110,118,101,114,115,105,111,110,97,98,111,
+117,116,32,116,104,101,32,60,47,112,62,60,47,100,105,118,62,105,110,116,101,103,
+114,97,116,101,100,34,32,108,97,110,103,61,34,101,110,80,111,114,116,117,103,117
+,101,115,101,115,117,98,115,116,105,116,117,116,101,105,110,100,105,118,105,100,
+117,97,108,105,109,112,111,115,115,105,98,108,101,109,117,108,116,105,109,101,
+100,105,97,97,108,109,111,115,116,32,97,108,108,112,120,32,115,111,108,105,100,
+32,35,97,112,97,114,116,32,102,114,111,109,115,117,98,106,101,99,116,32,116,111,
+105,110,32,69,110,103,108,105,115,104,99,114,105,116,105,99,105,122,101,100,101,
+120,99,101,112,116,32,102,111,114,103,117,105,100,101,108,105,110,101,115,111,
+114,105,103,105,110,97,108,108,121,114,101,109,97,114,107,97,98,108,101,116,104,
+101,32,115,101,99,111,110,100,104,50,32,99,108,97,115,115,61,34,60,97,32,116,105
+,116,108,101,61,34,40,105,110,99,108,117,100,105,110,103,112,97,114,97,109,101,
+116,101,114,115,112,114,111,104,105,98,105,116,101,100,61,32,34,104,116,116,112,
+58,47,47,100,105,99,116,105,111,110,97,114,121,112,101,114,99,101,112,116,105,
+111,110,114,101,118,111,108,117,116,105,111,110,102,111,117,110,100,97,116,105,
+111,110,112,120,59,104,101,105,103,104,116,58,115,117,99,99,101,115,115,102,117,
+108,115,117,112,112,111,114,116,101,114,115,109,105,108,108,101,110,110,105,117,
+109,104,105,115,32,102,97,116,104,101,114,116,104,101,32,38,113,117,111,116,59,
+110,111,45,114,101,112,101,97,116,59,99,111,109,109,101,114,99,105,97,108,105,
+110,100,117,115,116,114,105,97,108,101,110,99,111,117,114,97,103,101,100,97,109,
+111,117,110,116,32,111,102,32,117,110,111,102,102,105,99,105,97,108,101,102,102,
+105,99,105,101,110,99,121,82,101,102,101,114,101,110,99,101,115,99,111,111,114,
+100,105,110,97,116,101,100,105,115,99,108,97,105,109,101,114,101,120,112,101,100
+,105,116,105,111,110,100,101,118,101,108,111,112,105,110,103,99,97,108,99,117,
+108,97,116,101,100,115,105,109,112,108,105,102,105,101,100,108,101,103,105,116,
+105,109,97,116,101,115,117,98,115,116,114,105,110,103,40,48,34,32,99,108,97,115,
+115,61,34,99,111,109,112,108,101,116,101,108,121,105,108,108,117,115,116,114,97,
+116,101,102,105,118,101,32,121,101,97,114,115,105,110,115,116,114,117,109,101,
+110,116,80,117,98,108,105,115,104,105,110,103,49,34,32,99,108,97,115,115,61,34,
+112,115,121,99,104,111,108,111,103,121,99,111,110,102,105,100,101,110,99,101,110
+,117,109,98,101,114,32,111,102,32,97,98,115,101,110,99,101,32,111,102,102,111,99
+,117,115,101,100,32,111,110,106,111,105,110,101,100,32,116,104,101,115,116,114,
+117,99,116,117,114,101,115,112,114,101,118,105,111,117,115,108,121,62,60,47,105,
+102,114,97,109,101,62,111,110,99,101,32,97,103,97,105,110,98,117,116,32,114,97,
+116,104,101,114,105,109,109,105,103,114,97,110,116,115,111,102,32,99,111,117,114
+,115,101,44,97,32,103,114,111,117,112,32,111,102,76,105,116,101,114,97,116,117,
+114,101,85,110,108,105,107,101,32,116,104,101,60,47,97,62,38,110,98,115,112,59,
+10,102,117,110,99,116,105,111,110,32,105,116,32,119,97,115,32,116,104,101,67,111
+,110,118,101,110,116,105,111,110,97,117,116,111,109,111,98,105,108,101,80,114,
+111,116,101,115,116,97,110,116,97,103,103,114,101,115,115,105,118,101,97,102,116
+,101,114,32,116,104,101,32,83,105,109,105,108,97,114,108,121,44,34,32,47,62,60,
+47,100,105,118,62,99,111,108,108,101,99,116,105,111,110,13,10,102,117,110,99,116
+,105,111,110,118,105,115,105,98,105,108,105,116,121,116,104,101,32,117,115,101,
+32,111,102,118,111,108,117,110,116,101,101,114,115,97,116,116,114,97,99,116,105,
+111,110,117,110,100,101,114,32,116,104,101,32,116,104,114,101,97,116,101,110,101
+,100,42,60,33,91,67,68,65,84,65,91,105,109,112,111,114,116,97,110,99,101,105,110
+,32,103,101,110,101,114,97,108,116,104,101,32,108,97,116,116,101,114,60,47,102,
+111,114,109,62,10,60,47,46,105,110,100,101,120,79,102,40,39,105,32,61,32,48,59,
+32,105,32,60,100,105,102,102,101,114,101,110,99,101,100,101,118,111,116,101,100,
+32,116,111,116,114,97,100,105,116,105,111,110,115,115,101,97,114,99,104,32,102,
+111,114,117,108,116,105,109,97,116,101,108,121,116,111,117,114,110,97,109,101,
+110,116,97,116,116,114,105,98,117,116,101,115,115,111,45,99,97,108,108,101,100,
+32,125,10,60,47,115,116,121,108,101,62,101,118,97,108,117,97,116,105,111,110,101
+,109,112,104,97,115,105,122,101,100,97,99,99,101,115,115,105,98,108,101,60,47,
+115,101,99,116,105,111,110,62,115,117,99,99,101,115,115,105,111,110,97,108,111,
+110,103,32,119,105,116,104,77,101,97,110,119,104,105,108,101,44,105,110,100,117,
+115,116,114,105,101,115,60,47,97,62,60,98,114,32,47,62,104,97,115,32,98,101,99,
+111,109,101,97,115,112,101,99,116,115,32,111,102,84,101,108,101,118,105,115,105,
+111,110,115,117,102,102,105,99,105,101,110,116,98,97,115,107,101,116,98,97,108,
+108,98,111,116,104,32,115,105,100,101,115,99,111,110,116,105,110,117,105,110,103
+,97,110,32,97,114,116,105,99,108,101,60,105,109,103,32,97,108,116,61,34,97,100,
+118,101,110,116,117,114,101,115,104,105,115,32,109,111,116,104,101,114,109,97,
+110,99,104,101,115,116,101,114,112,114,105,110,99,105,112,108,101,115,112,97,114
+,116,105,99,117,108,97,114,99,111,109,109,101,110,116,97,114,121,101,102,102,101
+,99,116,115,32,111,102,100,101,99,105,100,101,100,32,116,111,34,62,60,115,116,
+114,111,110,103,62,112,117,98,108,105,115,104,101,114,115,74,111,117,114,110,97,
+108,32,111,102,100,105,102,102,105,99,117,108,116,121,102,97,99,105,108,105,116,
+97,116,101,97,99,99,101,112,116,97,98,108,101,115,116,121,108,101,46,99,115,115,
+34,9,102,117,110,99,116,105,111,110,32,105,110,110,111,118,97,116,105,111,110,62
+,67,111,112,121,114,105,103,104,116,115,105,116,117,97,116,105,111,110,115,119,
+111,117,108,100,32,104,97,118,101,98,117,115,105,110,101,115,115,101,115,68,105,
+99,116,105,111,110,97,114,121,115,116,97,116,101,109,101,110,116,115,111,102,116
+,101,110,32,117,115,101,100,112,101,114,115,105,115,116,101,110,116,105,110,32,
+74,97,110,117,97,114,121,99,111,109,112,114,105,115,105,110,103,60,47,116,105,
+116,108,101,62,10,9,100,105,112,108,111,109,97,116,105,99,99,111,110,116,97,105,
+110,105,110,103,112,101,114,102,111,114,109,105,110,103,101,120,116,101,110,115,
+105,111,110,115,109,97,121,32,110,111,116,32,98,101,99,111,110,99,101,112,116,32
+,111,102,32,111,110,99,108,105,99,107,61,34,73,116,32,105,115,32,97,108,115,111,
+102,105,110,97,110,99,105,97,108,32,109,97,107,105,110,103,32,116,104,101,76,117
+,120,101,109,98,111,117,114,103,97,100,100,105,116,105,111,110,97,108,97,114,101
+,32,99,97,108,108,101,100,101,110,103,97,103,101,100,32,105,110,34,115,99,114,
+105,112,116,34,41,59,98,117,116,32,105,116,32,119,97,115,101,108,101,99,116,114,
+111,110,105,99,111,110,115,117,98,109,105,116,61,34,10,60,33,45,45,32,69,110,100
+,32,101,108,101,99,116,114,105,99,97,108,111,102,102,105,99,105,97,108,108,121,
+115,117,103,103,101,115,116,105,111,110,116,111,112,32,111,102,32,116,104,101,
+117,110,108,105,107,101,32,116,104,101,65,117,115,116,114,97,108,105,97,110,79,
+114,105,103,105,110,97,108,108,121,114,101,102,101,114,101,110,99,101,115,10,60,
+47,104,101,97,100,62,13,10,114,101,99,111,103,110,105,115,101,100,105,110,105,
+116,105,97,108,105,122,101,108,105,109,105,116,101,100,32,116,111,65,108,101,120
+,97,110,100,114,105,97,114,101,116,105,114,101,109,101,110,116,65,100,118,101,
+110,116,117,114,101,115,102,111,117,114,32,121,101,97,114,115,10,10,38,108,116,
+59,33,45,45,32,105,110,99,114,101,97,115,105,110,103,100,101,99,111,114,97,116,
+105,111,110,104,51,32,99,108,97,115,115,61,34,111,114,105,103,105,110,115,32,111
+,102,111,98,108,105,103,97,116,105,111,110,114,101,103,117,108,97,116,105,111,
+110,99,108,97,115,115,105,102,105,101,100,40,102,117,110,99,116,105,111,110,40,
+97,100,118,97,110,116,97,103,101,115,98,101,105,110,103,32,116,104,101,32,104,
+105,115,116,111,114,105,97,110,115,60,98,97,115,101,32,104,114,101,102,114,101,
+112,101,97,116,101,100,108,121,119,105,108,108,105,110,103,32,116,111,99,111,109
+,112,97,114,97,98,108,101,100,101,115,105,103,110,97,116,101,100,110,111,109,105
+,110,97,116,105,111,110,102,117,110,99,116,105,111,110,97,108,105,110,115,105,
+100,101,32,116,104,101,114,101,118,101,108,97,116,105,111,110,101,110,100,32,111
+,102,32,116,104,101,115,32,102,111,114,32,116,104,101,32,97,117,116,104,111,114,
+105,122,101,100,114,101,102,117,115,101,100,32,116,111,116,97,107,101,32,112,108
+,97,99,101,97,117,116,111,110,111,109,111,117,115,99,111,109,112,114,111,109,105
+,115,101,112,111,108,105,116,105,99,97,108,32,114,101,115,116,97,117,114,97,110,
+116,116,119,111,32,111,102,32,116,104,101,70,101,98,114,117,97,114,121,32,50,113
+,117,97,108,105,116,121,32,111,102,115,119,102,111,98,106,101,99,116,46,117,110,
+100,101,114,115,116,97,110,100,110,101,97,114,108,121,32,97,108,108,119,114,105,
+116,116,101,110,32,98,121,105,110,116,101,114,118,105,101,119,115,34,32,119,105,
+100,116,104,61,34,49,119,105,116,104,100,114,97,119,97,108,102,108,111,97,116,58
+,108,101,102,116,105,115,32,117,115,117,97,108,108,121,99,97,110,100,105,100,97,
+116,101,115,110,101,119,115,112,97,112,101,114,115,109,121,115,116,101,114,105,
+111,117,115,68,101,112,97,114,116,109,101,110,116,98,101,115,116,32,107,110,111,
+119,110,112,97,114,108,105,97,109,101,110,116,115,117,112,112,114,101,115,115,
+101,100,99,111,110,118,101,110,105,101,110,116,114,101,109,101,109,98,101,114,
+101,100,100,105,102,102,101,114,101,110,116,32,115,121,115,116,101,109,97,116,
+105,99,104,97,115,32,108,101,100,32,116,111,112,114,111,112,97,103,97,110,100,97
+,99,111,110,116,114,111,108,108,101,100,105,110,102,108,117,101,110,99,101,115,
+99,101,114,101,109,111,110,105,97,108,112,114,111,99,108,97,105,109,101,100,80,
+114,111,116,101,99,116,105,111,110,108,105,32,99,108,97,115,115,61,34,83,99,105,
+101,110,116,105,102,105,99,99,108,97,115,115,61,34,110,111,45,116,114,97,100,101
+,109,97,114,107,115,109,111,114,101,32,116,104,97,110,32,119,105,100,101,115,112
+,114,101,97,100,76,105,98,101,114,97,116,105,111,110,116,111,111,107,32,112,108,
+97,99,101,100,97,121,32,111,102,32,116,104,101,97,115,32,108,111,110,103,32,97,
+115,105,109,112,114,105,115,111,110,101,100,65,100,100,105,116,105,111,110,97,
+108,10,60,104,101,97,100,62,10,60,109,76,97,98,111,114,97,116,111,114,121,78,111
+,118,101,109,98,101,114,32,50,101,120,99,101,112,116,105,111,110,115,73,110,100,
+117,115,116,114,105,97,108,118,97,114,105,101,116,121,32,111,102,102,108,111,97,
+116,58,32,108,101,102,68,117,114,105,110,103,32,116,104,101,97,115,115,101,115,
+115,109,101,110,116,104,97,118,101,32,98,101,101,110,32,100,101,97,108,115,32,
+119,105,116,104,83,116,97,116,105,115,116,105,99,115,111,99,99,117,114,114,101,
+110,99,101,47,117,108,62,60,47,100,105,118,62,99,108,101,97,114,102,105,120,34,
+62,116,104,101,32,112,117,98,108,105,99,109,97,110,121,32,121,101,97,114,115,119
+,104,105,99,104,32,119,101,114,101,111,118,101,114,32,116,105,109,101,44,115,121
+,110,111,110,121,109,111,117,115,99,111,110,116,101,110,116,34,62,10,112,114,101
+,115,117,109,97,98,108,121,104,105,115,32,102,97,109,105,108,121,117,115,101,114
+,65,103,101,110,116,46,117,110,101,120,112,101,99,116,101,100,105,110,99,108,117
+,100,105,110,103,32,99,104,97,108,108,101,110,103,101,100,97,32,109,105,110,111,
+114,105,116,121,117,110,100,101,102,105,110,101,100,34,98,101,108,111,110,103,
+115,32,116,111,116,97,107,101,110,32,102,114,111,109,105,110,32,79,99,116,111,98
+,101,114,112,111,115,105,116,105,111,110,58,32,115,97,105,100,32,116,111,32,98,
+101,114,101,108,105,103,105,111,117,115,32,70,101,100,101,114,97,116,105,111,110
+,32,114,111,119,115,112,97,110,61,34,111,110,108,121,32,97,32,102,101,119,109,
+101,97,110,116,32,116,104,97,116,108,101,100,32,116,111,32,116,104,101,45,45,62,
+13,10,60,100,105,118,32,60,102,105,101,108,100,115,101,116,62,65,114,99,104,98,
+105,115,104,111,112,32,99,108,97,115,115,61,34,110,111,98,101,105,110,103,32,117
+,115,101,100,97,112,112,114,111,97,99,104,101,115,112,114,105,118,105,108,101,
+103,101,115,110,111,115,99,114,105,112,116,62,10,114,101,115,117,108,116,115,32,
+105,110,109,97,121,32,98,101,32,116,104,101,69,97,115,116,101,114,32,101,103,103
+,109,101,99,104,97,110,105,115,109,115,114,101,97,115,111,110,97,98,108,101,80,
+111,112,117,108,97,116,105,111,110,67,111,108,108,101,99,116,105,111,110,115,101
+,108,101,99,116,101,100,34,62,110,111,115,99,114,105,112,116,62,13,47,105,110,
+100,101,120,46,112,104,112,97,114,114,105,118,97,108,32,111,102,45,106,115,115,
+100,107,39,41,41,59,109,97,110,97,103,101,100,32,116,111,105,110,99,111,109,112,
+108,101,116,101,99,97,115,117,97,108,116,105,101,115,99,111,109,112,108,101,116,
+105,111,110,67,104,114,105,115,116,105,97,110,115,83,101,112,116,101,109,98,101,
+114,32,97,114,105,116,104,109,101,116,105,99,112,114,111,99,101,100,117,114,101,
+115,109,105,103,104,116,32,104,97,118,101,80,114,111,100,117,99,116,105,111,110,
+105,116,32,97,112,112,101,97,114,115,80,104,105,108,111,115,111,112,104,121,102,
+114,105,101,110,100,115,104,105,112,108,101,97,100,105,110,103,32,116,111,103,
+105,118,105,110,103,32,116,104,101,116,111,119,97,114,100,32,116,104,101,103,117
+,97,114,97,110,116,101,101,100,100,111,99,117,109,101,110,116,101,100,99,111,108
+,111,114,58,35,48,48,48,118,105,100,101,111,32,103,97,109,101,99,111,109,109,105
+,115,115,105,111,110,114,101,102,108,101,99,116,105,110,103,99,104,97,110,103,
+101,32,116,104,101,97,115,115,111,99,105,97,116,101,100,115,97,110,115,45,115,
+101,114,105,102,111,110,107,101,121,112,114,101,115,115,59,32,112,97,100,100,105
+,110,103,58,72,101,32,119,97,115,32,116,104,101,117,110,100,101,114,108,121,105,
+110,103,116,121,112,105,99,97,108,108,121,32,44,32,97,110,100,32,116,104,101,32,
+115,114,99,69,108,101,109,101,110,116,115,117,99,99,101,115,115,105,118,101,115,
+105,110,99,101,32,116,104,101,32,115,104,111,117,108,100,32,98,101,32,110,101,
+116,119,111,114,107,105,110,103,97,99,99,111,117,110,116,105,110,103,117,115,101
+,32,111,102,32,116,104,101,108,111,119,101,114,32,116,104,97,110,115,104,111,119
+,115,32,116,104,97,116,60,47,115,112,97,110,62,10,9,9,99,111,109,112,108,97,105,
+110,116,115,99,111,110,116,105,110,117,111,117,115,113,117,97,110,116,105,116,
+105,101,115,97,115,116,114,111,110,111,109,101,114,104,101,32,100,105,100,32,110
+,111,116,100,117,101,32,116,111,32,105,116,115,97,112,112,108,105,101,100,32,116
+,111,97,110,32,97,118,101,114,97,103,101,101,102,102,111,114,116,115,32,116,111,
+116,104,101,32,102,117,116,117,114,101,97,116,116,101,109,112,116,32,116,111,84,
+104,101,114,101,102,111,114,101,44,99,97,112,97,98,105,108,105,116,121,82,101,
+112,117,98,108,105,99,97,110,119,97,115,32,102,111,114,109,101,100,69,108,101,99
+,116,114,111,110,105,99,107,105,108,111,109,101,116,101,114,115,99,104,97,108,
+108,101,110,103,101,115,112,117,98,108,105,115,104,105,110,103,116,104,101,32,
+102,111,114,109,101,114,105,110,100,105,103,101,110,111,117,115,100,105,114,101,
+99,116,105,111,110,115,115,117,98,115,105,100,105,97,114,121,99,111,110,115,112,
+105,114,97,99,121,100,101,116,97,105,108,115,32,111,102,97,110,100,32,105,110,32
+,116,104,101,97,102,102,111,114,100,97,98,108,101,115,117,98,115,116,97,110,99,
+101,115,114,101,97,115,111,110,32,102,111,114,99,111,110,118,101,110,116,105,111
+,110,105,116,101,109,116,121,112,101,61,34,97,98,115,111,108,117,116,101,108,121
+,115,117,112,112,111,115,101,100,108,121,114,101,109,97,105,110,101,100,32,97,97
+,116,116,114,97,99,116,105,118,101,116,114,97,118,101,108,108,105,110,103,115,
+101,112,97,114,97,116,101,108,121,102,111,99,117,115,101,115,32,111,110,101,108,
+101,109,101,110,116,97,114,121,97,112,112,108,105,99,97,98,108,101,102,111,117,
+110,100,32,116,104,97,116,115,116,121,108,101,115,104,101,101,116,109,97,110,117
+,115,99,114,105,112,116,115,116,97,110,100,115,32,102,111,114,32,110,111,45,114,
+101,112,101,97,116,40,115,111,109,101,116,105,109,101,115,67,111,109,109,101,114
+,99,105,97,108,105,110,32,65,109,101,114,105,99,97,117,110,100,101,114,116,97,
+107,101,110,113,117,97,114,116,101,114,32,111,102,97,110,32,101,120,97,109,112,
+108,101,112,101,114,115,111,110,97,108,108,121,105,110,100,101,120,46,112,104,
+112,63,60,47,98,117,116,116,111,110,62,10,112,101,114,99,101,110,116,97,103,101,
+98,101,115,116,45,107,110,111,119,110,99,114,101,97,116,105,110,103,32,97,34,32,
+100,105,114,61,34,108,116,114,76,105,101,117,116,101,110,97,110,116,10,60,100,
+105,118,32,105,100,61,34,116,104,101,121,32,119,111,117,108,100,97,98,105,108,
+105,116,121,32,111,102,109,97,100,101,32,117,112,32,111,102,110,111,116,101,100,
+32,116,104,97,116,99,108,101,97,114,32,116,104,97,116,97,114,103,117,101,32,116,
+104,97,116,116,111,32,97,110,111,116,104,101,114,99,104,105,108,100,114,101,110,
+39,115,112,117,114,112,111,115,101,32,111,102,102,111,114,109,117,108,97,116,101
+,100,98,97,115,101,100,32,117,112,111,110,116,104,101,32,114,101,103,105,111,110
+,115,117,98,106,101,99,116,32,111,102,112,97,115,115,101,110,103,101,114,115,112
+,111,115,115,101,115,115,105,111,110,46,10,10,73,110,32,116,104,101,32,66,101,
+102,111,114,101,32,116,104,101,97,102,116,101,114,119,97,114,100,115,99,117,114,
+114,101,110,116,108,121,32,97,99,114,111,115,115,32,116,104,101,115,99,105,101,
+110,116,105,102,105,99,99,111,109,109,117,110,105,116,121,46,99,97,112,105,116,
+97,108,105,115,109,105,110,32,71,101,114,109,97,110,121,114,105,103,104,116,45,
+119,105,110,103,116,104,101,32,115,121,115,116,101,109,83,111,99,105,101,116,121
+,32,111,102,112,111,108,105,116,105,99,105,97,110,100,105,114,101,99,116,105,111
+,110,58,119,101,110,116,32,111,110,32,116,111,114,101,109,111,118,97,108,32,111,
+102,32,78,101,119,32,89,111,114,107,32,97,112,97,114,116,109,101,110,116,115,105
+,110,100,105,99,97,116,105,111,110,100,117,114,105,110,103,32,116,104,101,117,
+110,108,101,115,115,32,116,104,101,104,105,115,116,111,114,105,99,97,108,104,97,
+100,32,98,101,101,110,32,97,100,101,102,105,110,105,116,105,118,101,105,110,103,
+114,101,100,105,101,110,116,97,116,116,101,110,100,97,110,99,101,67,101,110,116,
+101,114,32,102,111,114,112,114,111,109,105,110,101,110,99,101,114,101,97,100,121
+,83,116,97,116,101,115,116,114,97,116,101,103,105,101,115,98,117,116,32,105,110,
+32,116,104,101,97,115,32,112,97,114,116,32,111,102,99,111,110,115,116,105,116,
+117,116,101,99,108,97,105,109,32,116,104,97,116,108,97,98,111,114,97,116,111,114
+,121,99,111,109,112,97,116,105,98,108,101,102,97,105,108,117,114,101,32,111,102,
+44,32,115,117,99,104,32,97,115,32,98,101,103,97,110,32,119,105,116,104,117,115,
+105,110,103,32,116,104,101,32,116,111,32,112,114,111,118,105,100,101,102,101,97,
+116,117,114,101,32,111,102,102,114,111,109,32,119,104,105,99,104,47,34,32,99,108
+,97,115,115,61,34,103,101,111,108,111,103,105,99,97,108,115,101,118,101,114,97,
+108,32,111,102,100,101,108,105,98,101,114,97,116,101,105,109,112,111,114,116,97,
+110,116,32,104,111,108,100,115,32,116,104,97,116,105,110,103,38,113,117,111,116,
+59,32,118,97,108,105,103,110,61,116,111,112,116,104,101,32,71,101,114,109,97,110
+,111,117,116,115,105,100,101,32,111,102,110,101,103,111,116,105,97,116,101,100,
+104,105,115,32,99,97,114,101,101,114,115,101,112,97,114,97,116,105,111,110,105,
+100,61,34,115,101,97,114,99,104,119,97,115,32,99,97,108,108,101,100,116,104,101,
+32,102,111,117,114,116,104,114,101,99,114,101,97,116,105,111,110,111,116,104,101
+,114,32,116,104,97,110,112,114,101,118,101,110,116,105,111,110,119,104,105,108,
+101,32,116,104,101,32,101,100,117,99,97,116,105,111,110,44,99,111,110,110,101,99
+,116,105,110,103,97,99,99,117,114,97,116,101,108,121,119,101,114,101,32,98,117,
+105,108,116,119,97,115,32,107,105,108,108,101,100,97,103,114,101,101,109,101,110
+,116,115,109,117,99,104,32,109,111,114,101,32,68,117,101,32,116,111,32,116,104,
+101,119,105,100,116,104,58,32,49,48,48,115,111,109,101,32,111,116,104,101,114,75
+,105,110,103,100,111,109,32,111,102,116,104,101,32,101,110,116,105,114,101,102,
+97,109,111,117,115,32,102,111,114,116,111,32,99,111,110,110,101,99,116,111,98,
+106,101,99,116,105,118,101,115,116,104,101,32,70,114,101,110,99,104,112,101,111,
+112,108,101,32,97,110,100,102,101,97,116,117,114,101,100,34,62,105,115,32,115,97
+,105,100,32,116,111,115,116,114,117,99,116,117,114,97,108,114,101,102,101,114,
+101,110,100,117,109,109,111,115,116,32,111,102,116,101,110,97,32,115,101,112,97,
+114,97,116,101,45,62,10,60,100,105,118,32,105,100,32,79,102,102,105,99,105,97,
+108,32,119,111,114,108,100,119,105,100,101,46,97,114,105,97,45,108,97,98,101,108
+,116,104,101,32,112,108,97,110,101,116,97,110,100,32,105,116,32,119,97,115,100,
+34,32,118,97,108,117,101,61,34,108,111,111,107,105,110,103,32,97,116,98,101,110,
+101,102,105,99,105,97,108,97,114,101,32,105,110,32,116,104,101,109,111,110,105,
+116,111,114,105,110,103,114,101,112,111,114,116,101,100,108,121,116,104,101,32,
+109,111,100,101,114,110,119,111,114,107,105,110,103,32,111,110,97,108,108,111,
+119,101,100,32,116,111,119,104,101,114,101,32,116,104,101,32,105,110,110,111,118
+,97,116,105,118,101,60,47,97,62,60,47,100,105,118,62,115,111,117,110,100,116,114
+,97,99,107,115,101,97,114,99,104,70,111,114,109,116,101,110,100,32,116,111,32,98
+,101,105,110,112,117,116,32,105,100,61,34,111,112,101,110,105,110,103,32,111,102
+,114,101,115,116,114,105,99,116,101,100,97,100,111,112,116,101,100,32,98,121,97,
+100,100,114,101,115,115,105,110,103,116,104,101,111,108,111,103,105,97,110,109,
+101,116,104,111,100,115,32,111,102,118,97,114,105,97,110,116,32,111,102,67,104,
+114,105,115,116,105,97,110,32,118,101,114,121,32,108,97,114,103,101,97,117,116,
+111,109,111,116,105,118,101,98,121,32,102,97,114,32,116,104,101,114,97,110,103,
+101,32,102,114,111,109,112,117,114,115,117,105,116,32,111,102,102,111,108,108,
+111,119,32,116,104,101,98,114,111,117,103,104,116,32,116,111,105,110,32,69,110,
+103,108,97,110,100,97,103,114,101,101,32,116,104,97,116,97,99,99,117,115,101,100
+,32,111,102,99,111,109,101,115,32,102,114,111,109,112,114,101,118,101,110,116,
+105,110,103,100,105,118,32,115,116,121,108,101,61,104,105,115,32,111,114,32,104,
+101,114,116,114,101,109,101,110,100,111,117,115,102,114,101,101,100,111,109,32,
+111,102,99,111,110,99,101,114,110,105,110,103,48,32,49,101,109,32,49,101,109,59,
+66,97,115,107,101,116,98,97,108,108,47,115,116,121,108,101,46,99,115,115,97,110,
+32,101,97,114,108,105,101,114,101,118,101,110,32,97,102,116,101,114,47,34,32,116
+,105,116,108,101,61,34,46,99,111,109,47,105,110,100,101,120,116,97,107,105,110,
+103,32,116,104,101,112,105,116,116,115,98,117,114,103,104,99,111,110,116,101,110
+,116,34,62,13,60,115,99,114,105,112,116,62,40,102,116,117,114,110,101,100,32,111
+,117,116,104,97,118,105,110,103,32,116,104,101,60,47,115,112,97,110,62,13,10,32,
+111,99,99,97,115,105,111,110,97,108,98,101,99,97,117,115,101,32,105,116,115,116,
+97,114,116,101,100,32,116,111,112,104,121,115,105,99,97,108,108,121,62,60,47,100
+,105,118,62,10,32,32,99,114,101,97,116,101,100,32,98,121,67,117,114,114,101,110,
+116,108,121,44,32,98,103,99,111,108,111,114,61,34,116,97,98,105,110,100,101,120,
+61,34,100,105,115,97,115,116,114,111,117,115,65,110,97,108,121,116,105,99,115,32
+,97,108,115,111,32,104,97,115,32,97,62,60,100,105,118,32,105,100,61,34,60,47,115
+,116,121,108,101,62,10,60,99,97,108,108,101,100,32,102,111,114,115,105,110,103,
+101,114,32,97,110,100,46,115,114,99,32,61,32,34,47,47,118,105,111,108,97,116,105
+,111,110,115,116,104,105,115,32,112,111,105,110,116,99,111,110,115,116,97,110,
+116,108,121,105,115,32,108,111,99,97,116,101,100,114,101,99,111,114,100,105,110,
+103,115,100,32,102,114,111,109,32,116,104,101,110,101,100,101,114,108,97,110,100
+,115,112,111,114,116,117,103,117,195,170,115,215,162,215,145,215,168,215,153,215
+,170,217,129,216,167,216,177,216,179,219,140,100,101,115,97,114,114,111,108,108,
+111,99,111,109,101,110,116,97,114,105,111,101,100,117,99,97,99,105,195,179,110,
+115,101,112,116,105,101,109,98,114,101,114,101,103,105,115,116,114,97,100,111,
+100,105,114,101,99,99,105,195,179,110,117,98,105,99,97,99,105,195,179,110,112,
+117,98,108,105,99,105,100,97,100,114,101,115,112,117,101,115,116,97,115,114,101,
+115,117,108,116,97,100,111,115,105,109,112,111,114,116,97,110,116,101,114,101,
+115,101,114,118,97,100,111,115,97,114,116,195,173,99,117,108,111,115,100,105,102
+,101,114,101,110,116,101,115,115,105,103,117,105,101,110,116,101,115,114,101,112
+,195,186,98,108,105,99,97,115,105,116,117,97,99,105,195,179,110,109,105,110,105,
+115,116,101,114,105,111,112,114,105,118,97,99,105,100,97,100,100,105,114,101,99,
+116,111,114,105,111,102,111,114,109,97,99,105,195,179,110,112,111,98,108,97,99,
+105,195,179,110,112,114,101,115,105,100,101,110,116,101,99,111,110,116,101,110,
+105,100,111,115,97,99,99,101,115,111,114,105,111,115,116,101,99,104,110,111,114,
+97,116,105,112,101,114,115,111,110,97,108,101,115,99,97,116,101,103,111,114,195,
+173,97,101,115,112,101,99,105,97,108,101,115,100,105,115,112,111,110,105,98,108,
+101,97,99,116,117,97,108,105,100,97,100,114,101,102,101,114,101,110,99,105,97,
+118,97,108,108,97,100,111,108,105,100,98,105,98,108,105,111,116,101,99,97,114,
+101,108,97,99,105,111,110,101,115,99,97,108,101,110,100,97,114,105,111,112,111,
+108,195,173,116,105,99,97,115,97,110,116,101,114,105,111,114,101,115,100,111,99,
+117,109,101,110,116,111,115,110,97,116,117,114,97,108,101,122,97,109,97,116,101,
+114,105,97,108,101,115,100,105,102,101,114,101,110,99,105,97,101,99,111,110,195,
+179,109,105,99,97,116,114,97,110,115,112,111,114,116,101,114,111,100,114,195,173
+,103,117,101,122,112,97,114,116,105,99,105,112,97,114,101,110,99,117,101,110,116
+,114,97,110,100,105,115,99,117,115,105,195,179,110,101,115,116,114,117,99,116,
+117,114,97,102,117,110,100,97,99,105,195,179,110,102,114,101,99,117,101,110,116,
+101,115,112,101,114,109,97,110,101,110,116,101,116,111,116,97,108,109,101,110,
+116,101,208,188,208,190,208,182,208,189,208,190,208,177,209,131,208,180,208,181,
+209,130,208,188,208,190,208,182,208,181,209,130,208,178,209,128,208,181,208,188,
+209,143,209,130,208,176,208,186,208,182,208,181,209,135,209,130,208,190,208,177,
+209,139,208,177,208,190,208,187,208,181,208,181,208,190,209,135,208,181,208,189,
+209,140,209,141,209,130,208,190,208,179,208,190,208,186,208,190,208,179,208,180,
+208,176,208,191,208,190,209,129,208,187,208,181,208,178,209,129,208,181,208,179,
+208,190,209,129,208,176,208,185,209,130,208,181,209,135,208,181,209,128,208,181,
+208,183,208,188,208,190,208,179,209,131,209,130,209,129,208,176,208,185,209,130,
+208,176,208,182,208,184,208,183,208,189,208,184,208,188,208,181,208,182,208,180,
+209,131,208,177,209,131,208,180,209,131,209,130,208,159,208,190,208,184,209,129,
+208,186,208,183,208,180,208,181,209,129,209,140,208,178,208,184,208,180,208,181,
+208,190,209,129,208,178,209,143,208,183,208,184,208,189,209,131,208,182,208,189,
+208,190,209,129,208,178,208,190,208,181,208,185,208,187,209,142,208,180,208,181,
+208,185,208,191,208,190,209,128,208,189,208,190,208,188,208,189,208,190,208,179,
+208,190,208,180,208,181,209,130,208,181,208,185,209,129,208,178,208,190,208,184,
+209,133,208,191,209,128,208,176,208,178,208,176,209,130,208,176,208,186,208,190,
+208,185,208,188,208,181,209,129,209,130,208,190,208,184,208,188,208,181,208,181,
+209,130,208,182,208,184,208,183,208,189,209,140,208,190,208,180,208,189,208,190,
+208,185,208,187,209,131,209,135,209,136,208,181,208,191,208,181,209,128,208,181,
+208,180,209,135,208,176,209,129,209,130,208,184,209,135,208,176,209,129,209,130,
+209,140,209,128,208,176,208,177,208,190,209,130,208,189,208,190,208,178,209,139,
+209,133,208,191,209,128,208,176,208,178,208,190,209,129,208,190,208,177,208,190,
+208,185,208,191,208,190,209,130,208,190,208,188,208,188,208,181,208,189,208,181,
+208,181,209,135,208,184,209,129,208,187,208,181,208,189,208,190,208,178,209,139,
+208,181,209,131,209,129,208,187,209,131,208,179,208,190,208,186,208,190,208,187,
+208,190,208,189,208,176,208,183,208,176,208,180,209,130,208,176,208,186,208,190,
+208,181,209,130,208,190,208,179,208,180,208,176,208,191,208,190,209,135,209,130,
+208,184,208,159,208,190,209,129,208,187,208,181,209,130,208,176,208,186,208,184,
+208,181,208,189,208,190,208,178,209,139,208,185,209,129,209,130,208,190,208,184,
+209,130,209,130,208,176,208,186,208,184,209,133,209,129,209,128,208,176,208,183,
+209,131,208,161,208,176,208,189,208,186,209,130,209,132,208,190,209,128,209,131,
+208,188,208,154,208,190,208,179,208,180,208,176,208,186,208,189,208,184,208,179,
+208,184,209,129,208,187,208,190,208,178,208,176,208,189,208,176,209,136,208,181,
+208,185,208,189,208,176,208,185,209,130,208,184,209,129,208,178,208,190,208,184,
+208,188,209,129,208,178,209,143,208,183,209,140,208,187,209,142,208,177,208,190,
+208,185,209,135,208,176,209,129,209,130,208,190,209,129,209,128,208,181,208,180,
+208,184,208,154,209,128,208,190,208,188,208,181,208,164,208,190,209,128,209,131,
+208,188,209,128,209,139,208,189,208,186,208,181,209,129,209,130,208,176,208,187,
+208,184,208,191,208,190,208,184,209,129,208,186,209,130,209,139,209,129,209,143,
+209,135,208,188,208,181,209,129,209,143,209,134,209,134,208,181,208,189,209,130,
+209,128,209,130,209,128,209,131,208,180,208,176,209,129,208,176,208,188,209,139,
+209,133,209,128,209,139,208,189,208,186,208,176,208,157,208,190,208,178,209,139,
+208,185,209,135,208,176,209,129,208,190,208,178,208,188,208,181,209,129,209,130,
+208,176,209,132,208,184,208,187,209,140,208,188,208,188,208,176,209,128,209,130,
+208,176,209,129,209,130,209,128,208,176,208,189,208,188,208,181,209,129,209,130,
+208,181,209,130,208,181,208,186,209,129,209,130,208,189,208,176,209,136,208,184,
+209,133,208,188,208,184,208,189,209,131,209,130,208,184,208,188,208,181,208,189,
+208,184,208,184,208,188,208,181,209,142,209,130,208,189,208,190,208,188,208,181,
+209,128,208,179,208,190,209,128,208,190,208,180,209,129,208,176,208,188,208,190,
+208,188,209,141,209,130,208,190,208,188,209,131,208,186,208,190,208,189,209,134,
+208,181,209,129,208,178,208,190,208,181,208,188,208,186,208,176,208,186,208,190,
+208,185,208,144,209,128,209,133,208,184,208,178,217,133,217,134,216,170,216,175,
+217,137,216,165,216,177,216,179,216,167,217,132,216,177,216,179,216,167,217,132,
+216,169,216,167,217,132,216,185,216,167,217,133,217,131,216,170,216,168,217,135,
+216,167,216,168,216,177,216,167,217,133,216,172,216,167,217,132,217,138,217,136,
+217,133,216,167,217,132,216,181,217,136,216,177,216,172,216,175,217,138,216,175,
+216,169,216,167,217,132,216,185,216,182,217,136,216,165,216,182,216,167,217,129,
+216,169,216,167,217,132,217,130,216,179,217,133,216,167,217,132,216,185,216,167,
+216,168,216,170,216,173,217,133,217,138,217,132,217,133,217,132,217,129,216,167,
+216,170,217,133,217,132,216,170,217,130,217,137,216,170,216,185,216,175,217,138,
+217,132,216,167,217,132,216,180,216,185,216,177,216,163,216,174,216,168,216,167,
+216,177,216,170,216,183,217,136,217,138,216,177,216,185,217,132,217,138,217,131,
+217,133,216,165,216,177,217,129,216,167,217,130,216,183,217,132,216,168,216,167,
+216,170,216,167,217,132,217,132,216,186,216,169,216,170,216,177,216,170,217,138,
+216,168,216,167,217,132,217,134,216,167,216,179,216,167,217,132,216,180,217,138,
+216,174,217,133,217,134,216,170,216,175,217,138,216,167,217,132,216,185,216,177,
+216,168,216,167,217,132,217,130,216,181,216,181,216,167,217,129,217,132,216,167,
+217,133,216,185,217,132,217,138,217,135,216,167,216,170,216,173,216,175,217,138,
+216,171,216,167,217,132,217,132,217,135,217,133,216,167,217,132,216,185,217,133,
+217,132,217,133,217,131,216,170,216,168,216,169,217,138,217,133,217,131,217,134,
+217,131,216,167,217,132,216,183,217,129,217,132,217,129,217,138,216,175,217,138,
+217,136,216,165,216,175,216,167,216,177,216,169,216,170,216,167,216,177,217,138,
+216,174,216,167,217,132,216,181,216,173,216,169,216,170,216,179,216,172,217,138,
+217,132,216,167,217,132,217,136,217,130,216,170,216,185,217,134,216,175,217,133,
+216,167,217,133,216,175,217,138,217,134,216,169,216,170,216,181,217,133,217,138,
+217,133,216,163,216,177,216,180,217,138,217,129,216,167,217,132,216,176,217,138,
+217,134,216,185,216,177,216,168,217,138,216,169,216,168,217,136,216,167,216,168,
+216,169,216,163,217,132,216,185,216,167,216,168,216,167,217,132,216,179,217,129,
+216,177,217,133,216,180,216,167,217,131,217,132,216,170,216,185,216,167,217,132,
+217,137,216,167,217,132,216,163,217,136,217,132,216,167,217,132,216,179,217,134,
+216,169,216,172,216,167,217,133,216,185,216,169,216,167,217,132,216,181,216,173,
+217,129,216,167,217,132,216,175,217,138,217,134,217,131,217,132,217,133,216,167,
+216,170,216,167,217,132,216,174,216,167,216,181,216,167,217,132,217,133,217,132,
+217,129,216,163,216,185,216,182,216,167,216,161,217,131,216,170,216,167,216,168,
+216,169,216,167,217,132,216,174,217,138,216,177,216,177,216,179,216,167,216,166,
+217,132,216,167,217,132,217,130,217,132,216,168,216,167,217,132,216,163,216,175,
+216,168,217,133,217,130,216,167,216,183,216,185,217,133,216,177,216,167,216,179,
+217,132,217,133,217,134,216,183,217,130,216,169,216,167,217,132,217,131,216,170,
+216,168,216,167,217,132,216,177,216,172,217,132,216,167,216,180,216,170,216,177,
+217,131,216,167,217,132,217,130,216,175,217,133,217,138,216,185,216,183,217,138,
+217,131,115,66,121,84,97,103,78,97,109,101,40,46,106,112,103,34,32,97,108,116,61
+,34,49,112,120,32,115,111,108,105,100,32,35,46,103,105,102,34,32,97,108,116,61,
+34,116,114,97,110,115,112,97,114,101,110,116,105,110,102,111,114,109,97,116,105,
+111,110,97,112,112,108,105,99,97,116,105,111,110,34,32,111,110,99,108,105,99,107
+,61,34,101,115,116,97,98,108,105,115,104,101,100,97,100,118,101,114,116,105,115,
+105,110,103,46,112,110,103,34,32,97,108,116,61,34,101,110,118,105,114,111,110,
+109,101,110,116,112,101,114,102,111,114,109,97,110,99,101,97,112,112,114,111,112
+,114,105,97,116,101,38,97,109,112,59,109,100,97,115,104,59,105,109,109,101,100,
+105,97,116,101,108,121,60,47,115,116,114,111,110,103,62,60,47,114,97,116,104,101
+,114,32,116,104,97,110,116,101,109,112,101,114,97,116,117,114,101,100,101,118,
+101,108,111,112,109,101,110,116,99,111,109,112,101,116,105,116,105,111,110,112,
+108,97,99,101,104,111,108,100,101,114,118,105,115,105,98,105,108,105,116,121,58,
+99,111,112,121,114,105,103,104,116,34,62,48,34,32,104,101,105,103,104,116,61,34,
+101,118,101,110,32,116,104,111,117,103,104,114,101,112,108,97,99,101,109,101,110
+,116,100,101,115,116,105,110,97,116,105,111,110,67,111,114,112,111,114,97,116,
+105,111,110,60,117,108,32,99,108,97,115,115,61,34,65,115,115,111,99,105,97,116,
+105,111,110,105,110,100,105,118,105,100,117,97,108,115,112,101,114,115,112,101,
+99,116,105,118,101,115,101,116,84,105,109,101,111,117,116,40,117,114,108,40,104,
+116,116,112,58,47,47,109,97,116,104,101,109,97,116,105,99,115,109,97,114,103,105
+,110,45,116,111,112,58,101,118,101,110,116,117,97,108,108,121,32,100,101,115,99,
+114,105,112,116,105,111,110,41,32,110,111,45,114,101,112,101,97,116,99,111,108,
+108,101,99,116,105,111,110,115,46,74,80,71,124,116,104,117,109,98,124,112,97,114
+,116,105,99,105,112,97,116,101,47,104,101,97,100,62,60,98,111,100,121,102,108,
+111,97,116,58,108,101,102,116,59,60,108,105,32,99,108,97,115,115,61,34,104,117,
+110,100,114,101,100,115,32,111,102,10,10,72,111,119,101,118,101,114,44,32,99,111
+,109,112,111,115,105,116,105,111,110,99,108,101,97,114,58,98,111,116,104,59,99,
+111,111,112,101,114,97,116,105,111,110,119,105,116,104,105,110,32,116,104,101,32
+,108,97,98,101,108,32,102,111,114,61,34,98,111,114,100,101,114,45,116,111,112,58
+,78,101,119,32,90,101,97,108,97,110,100,114,101,99,111,109,109,101,110,100,101,
+100,112,104,111,116,111,103,114,97,112,104,121,105,110,116,101,114,101,115,116,
+105,110,103,38,108,116,59,115,117,112,38,103,116,59,99,111,110,116,114,111,118,
+101,114,115,121,78,101,116,104,101,114,108,97,110,100,115,97,108,116,101,114,110
+,97,116,105,118,101,109,97,120,108,101,110,103,116,104,61,34,115,119,105,116,122
+,101,114,108,97,110,100,68,101,118,101,108,111,112,109,101,110,116,101,115,115,
+101,110,116,105,97,108,108,121,10,10,65,108,116,104,111,117,103,104,32,60,47,116
+,101,120,116,97,114,101,97,62,116,104,117,110,100,101,114,98,105,114,100,114,101
+,112,114,101,115,101,110,116,101,100,38,97,109,112,59,110,100,97,115,104,59,115,
+112,101,99,117,108,97,116,105,111,110,99,111,109,109,117,110,105,116,105,101,115
+,108,101,103,105,115,108,97,116,105,111,110,101,108,101,99,116,114,111,110,105,
+99,115,10,9,60,100,105,118,32,105,100,61,34,105,108,108,117,115,116,114,97,116,
+101,100,101,110,103,105,110,101,101,114,105,110,103,116,101,114,114,105,116,111,
+114,105,101,115,97,117,116,104,111,114,105,116,105,101,115,100,105,115,116,114,
+105,98,117,116,101,100,54,34,32,104,101,105,103,104,116,61,34,115,97,110,115,45,
+115,101,114,105,102,59,99,97,112,97,98,108,101,32,111,102,32,100,105,115,97,112,
+112,101,97,114,101,100,105,110,116,101,114,97,99,116,105,118,101,108,111,111,107
+,105,110,103,32,102,111,114,105,116,32,119,111,117,108,100,32,98,101,65,102,103,
+104,97,110,105,115,116,97,110,119,97,115,32,99,114,101,97,116,101,100,77,97,116,
+104,46,102,108,111,111,114,40,115,117,114,114,111,117,110,100,105,110,103,99,97,
+110,32,97,108,115,111,32,98,101,111,98,115,101,114,118,97,116,105,111,110,109,97
+,105,110,116,101,110,97,110,99,101,101,110,99,111,117,110,116,101,114,101,100,60
+,104,50,32,99,108,97,115,115,61,34,109,111,114,101,32,114,101,99,101,110,116,105
+,116,32,104,97,115,32,98,101,101,110,105,110,118,97,115,105,111,110,32,111,102,
+41,46,103,101,116,84,105,109,101,40,41,102,117,110,100,97,109,101,110,116,97,108
+,68,101,115,112,105,116,101,32,116,104,101,34,62,60,100,105,118,32,105,100,61,34
+,105,110,115,112,105,114,97,116,105,111,110,101,120,97,109,105,110,97,116,105,
+111,110,112,114,101,112,97,114,97,116,105,111,110,101,120,112,108,97,110,97,116,
+105,111,110,60,105,110,112,117,116,32,105,100,61,34,60,47,97,62,60,47,115,112,97
+,110,62,118,101,114,115,105,111,110,115,32,111,102,105,110,115,116,114,117,109,
+101,110,116,115,98,101,102,111,114,101,32,116,104,101,32,32,61,32,39,104,116,116
+,112,58,47,47,68,101,115,99,114,105,112,116,105,111,110,114,101,108,97,116,105,
+118,101,108,121,32,46,115,117,98,115,116,114,105,110,103,40,101,97,99,104,32,111
+,102,32,116,104,101,101,120,112,101,114,105,109,101,110,116,115,105,110,102,108,
+117,101,110,116,105,97,108,105,110,116,101,103,114,97,116,105,111,110,109,97,110
+,121,32,112,101,111,112,108,101,100,117,101,32,116,111,32,116,104,101,32,99,111,
+109,98,105,110,97,116,105,111,110,100,111,32,110,111,116,32,104,97,118,101,77,
+105,100,100,108,101,32,69,97,115,116,60,110,111,115,99,114,105,112,116,62,60,99,
+111,112,121,114,105,103,104,116,34,32,112,101,114,104,97,112,115,32,116,104,101,
+105,110,115,116,105,116,117,116,105,111,110,105,110,32,68,101,99,101,109,98,101,
+114,97,114,114,97,110,103,101,109,101,110,116,109,111,115,116,32,102,97,109,111,
+117,115,112,101,114,115,111,110,97,108,105,116,121,99,114,101,97,116,105,111,110
+,32,111,102,108,105,109,105,116,97,116,105,111,110,115,101,120,99,108,117,115,
+105,118,101,108,121,115,111,118,101,114,101,105,103,110,116,121,45,99,111,110,
+116,101,110,116,34,62,10,60,116,100,32,99,108,97,115,115,61,34,117,110,100,101,
+114,103,114,111,117,110,100,112,97,114,97,108,108,101,108,32,116,111,100,111,99,
+116,114,105,110,101,32,111,102,111,99,99,117,112,105,101,100,32,98,121,116,101,
+114,109,105,110,111,108,111,103,121,82,101,110,97,105,115,115,97,110,99,101,97,
+32,110,117,109,98,101,114,32,111,102,115,117,112,112,111,114,116,32,102,111,114,
+101,120,112,108,111,114,97,116,105,111,110,114,101,99,111,103,110,105,116,105,
+111,110,112,114,101,100,101,99,101,115,115,111,114,60,105,109,103,32,115,114,99,
+61,34,47,60,104,49,32,99,108,97,115,115,61,34,112,117,98,108,105,99,97,116,105,
+111,110,109,97,121,32,97,108,115,111,32,98,101,115,112,101,99,105,97,108,105,122
+,101,100,60,47,102,105,101,108,100,115,101,116,62,112,114,111,103,114,101,115,
+115,105,118,101,109,105,108,108,105,111,110,115,32,111,102,115,116,97,116,101,
+115,32,116,104,97,116,101,110,102,111,114,99,101,109,101,110,116,97,114,111,117,
+110,100,32,116,104,101,32,111,110,101,32,97,110,111,116,104,101,114,46,112,97,
+114,101,110,116,78,111,100,101,97,103,114,105,99,117,108,116,117,114,101,65,108,
+116,101,114,110,97,116,105,118,101,114,101,115,101,97,114,99,104,101,114,115,116
+,111,119,97,114,100,115,32,116,104,101,77,111,115,116,32,111,102,32,116,104,101,
+109,97,110,121,32,111,116,104,101,114,32,40,101,115,112,101,99,105,97,108,108,
+121,60,116,100,32,119,105,100,116,104,61,34,59,119,105,100,116,104,58,49,48,48,
+37,105,110,100,101,112,101,110,100,101,110,116,60,104,51,32,99,108,97,115,115,61
+,34,32,111,110,99,104,97,110,103,101,61,34,41,46,97,100,100,67,108,97,115,115,40
+,105,110,116,101,114,97,99,116,105,111,110,79,110,101,32,111,102,32,116,104,101,
+32,100,97,117,103,104,116,101,114,32,111,102,97,99,99,101,115,115,111,114,105,
+101,115,98,114,97,110,99,104,101,115,32,111,102,13,10,60,100,105,118,32,105,100,
+61,34,116,104,101,32,108,97,114,103,101,115,116,100,101,99,108,97,114,97,116,105
+,111,110,114,101,103,117,108,97,116,105,111,110,115,73,110,102,111,114,109,97,
+116,105,111,110,116,114,97,110,115,108,97,116,105,111,110,100,111,99,117,109,101
+,110,116,97,114,121,105,110,32,111,114,100,101,114,32,116,111,34,62,10,60,104,
+101,97,100,62,10,60,34,32,104,101,105,103,104,116,61,34,49,97,99,114,111,115,115
+,32,116,104,101,32,111,114,105,101,110,116,97,116,105,111,110,41,59,60,47,115,99
+,114,105,112,116,62,105,109,112,108,101,109,101,110,116,101,100,99,97,110,32,98,
+101,32,115,101,101,110,116,104,101,114,101,32,119,97,115,32,97,100,101,109,111,
+110,115,116,114,97,116,101,99,111,110,116,97,105,110,101,114,34,62,99,111,110,
+110,101,99,116,105,111,110,115,116,104,101,32,66,114,105,116,105,115,104,119,97,
+115,32,119,114,105,116,116,101,110,33,105,109,112,111,114,116,97,110,116,59,112,
+120,59,32,109,97,114,103,105,110,45,102,111,108,108,111,119,101,100,32,98,121,97
+,98,105,108,105,116,121,32,116,111,32,99,111,109,112,108,105,99,97,116,101,100,
+100,117,114,105,110,103,32,116,104,101,32,105,109,109,105,103,114,97,116,105,111
+,110,97,108,115,111,32,99,97,108,108,101,100,60,104,52,32,99,108,97,115,115,61,
+34,100,105,115,116,105,110,99,116,105,111,110,114,101,112,108,97,99,101,100,32,
+98,121,103,111,118,101,114,110,109,101,110,116,115,108,111,99,97,116,105,111,110
+,32,111,102,105,110,32,78,111,118,101,109,98,101,114,119,104,101,116,104,101,114
+,32,116,104,101,60,47,112,62,10,60,47,100,105,118,62,97,99,113,117,105,115,105,
+116,105,111,110,99,97,108,108,101,100,32,116,104,101,32,112,101,114,115,101,99,
+117,116,105,111,110,100,101,115,105,103,110,97,116,105,111,110,123,102,111,110,
+116,45,115,105,122,101,58,97,112,112,101,97,114,101,100,32,105,110,105,110,118,
+101,115,116,105,103,97,116,101,101,120,112,101,114,105,101,110,99,101,100,109,
+111,115,116,32,108,105,107,101,108,121,119,105,100,101,108,121,32,117,115,101,
+100,100,105,115,99,117,115,115,105,111,110,115,112,114,101,115,101,110,99,101,32
+,111,102,32,40,100,111,99,117,109,101,110,116,46,101,120,116,101,110,115,105,118
+,101,108,121,73,116,32,104,97,115,32,98,101,101,110,105,116,32,100,111,101,115,
+32,110,111,116,99,111,110,116,114,97,114,121,32,116,111,105,110,104,97,98,105,
+116,97,110,116,115,105,109,112,114,111,118,101,109,101,110,116,115,99,104,111,
+108,97,114,115,104,105,112,99,111,110,115,117,109,112,116,105,111,110,105,110,
+115,116,114,117,99,116,105,111,110,102,111,114,32,101,120,97,109,112,108,101,111
+,110,101,32,111,114,32,109,111,114,101,112,120,59,32,112,97,100,100,105,110,103,
+116,104,101,32,99,117,114,114,101,110,116,97,32,115,101,114,105,101,115,32,111,
+102,97,114,101,32,117,115,117,97,108,108,121,114,111,108,101,32,105,110,32,116,
+104,101,112,114,101,118,105,111,117,115,108,121,32,100,101,114,105,118,97,116,
+105,118,101,115,101,118,105,100,101,110,99,101,32,111,102,101,120,112,101,114,
+105,101,110,99,101,115,99,111,108,111,114,115,99,104,101,109,101,115,116,97,116,
+101,100,32,116,104,97,116,99,101,114,116,105,102,105,99,97,116,101,60,47,97,62,
+60,47,100,105,118,62,10,32,115,101,108,101,99,116,101,100,61,34,104,105,103,104,
+32,115,99,104,111,111,108,114,101,115,112,111,110,115,101,32,116,111,99,111,109,
+102,111,114,116,97,98,108,101,97,100,111,112,116,105,111,110,32,111,102,116,104,
+114,101,101,32,121,101,97,114,115,116,104,101,32,99,111,117,110,116,114,121,105,
+110,32,70,101,98,114,117,97,114,121,115,111,32,116,104,97,116,32,116,104,101,112
+,101,111,112,108,101,32,119,104,111,32,112,114,111,118,105,100,101,100,32,98,121
+,60,112,97,114,97,109,32,110,97,109,101,97,102,102,101,99,116,101,100,32,98,121,
+105,110,32,116,101,114,109,115,32,111,102,97,112,112,111,105,110,116,109,101,110
+,116,73,83,79,45,56,56,53,57,45,49,34,119,97,115,32,98,111,114,110,32,105,110,
+104,105,115,116,111,114,105,99,97,108,32,114,101,103,97,114,100,101,100,32,97,
+115,109,101,97,115,117,114,101,109,101,110,116,105,115,32,98,97,115,101,100,32,
+111,110,32,97,110,100,32,111,116,104,101,114,32,58,32,102,117,110,99,116,105,111
+,110,40,115,105,103,110,105,102,105,99,97,110,116,99,101,108,101,98,114,97,116,
+105,111,110,116,114,97,110,115,109,105,116,116,101,100,47,106,115,47,106,113,117
+,101,114,121,46,105,115,32,107,110,111,119,110,32,97,115,116,104,101,111,114,101
+,116,105,99,97,108,32,116,97,98,105,110,100,101,120,61,34,105,116,32,99,111,117,
+108,100,32,98,101,60,110,111,115,99,114,105,112,116,62,10,104,97,118,105,110,103
+,32,98,101,101,110,13,10,60,104,101,97,100,62,13,10,60,32,38,113,117,111,116,59,
+84,104,101,32,99,111,109,112,105,108,97,116,105,111,110,104,101,32,104,97,100,32
+,98,101,101,110,112,114,111,100,117,99,101,100,32,98,121,112,104,105,108,111,115
+,111,112,104,101,114,99,111,110,115,116,114,117,99,116,101,100,105,110,116,101,
+110,100,101,100,32,116,111,97,109,111,110,103,32,111,116,104,101,114,99,111,109,
+112,97,114,101,100,32,116,111,116,111,32,115,97,121,32,116,104,97,116,69,110,103
+,105,110,101,101,114,105,110,103,97,32,100,105,102,102,101,114,101,110,116,114,
+101,102,101,114,114,101,100,32,116,111,100,105,102,102,101,114,101,110,99,101,
+115,98,101,108,105,101,102,32,116,104,97,116,112,104,111,116,111,103,114,97,112,
+104,115,105,100,101,110,116,105,102,121,105,110,103,72,105,115,116,111,114,121,
+32,111,102,32,82,101,112,117,98,108,105,99,32,111,102,110,101,99,101,115,115,97,
+114,105,108,121,112,114,111,98,97,98,105,108,105,116,121,116,101,99,104,110,105,
+99,97,108,108,121,108,101,97,118,105,110,103,32,116,104,101,115,112,101,99,116,
+97,99,117,108,97,114,102,114,97,99,116,105,111,110,32,111,102,101,108,101,99,116
+,114,105,99,105,116,121,104,101,97,100,32,111,102,32,116,104,101,114,101,115,116
+,97,117,114,97,110,116,115,112,97,114,116,110,101,114,115,104,105,112,101,109,
+112,104,97,115,105,115,32,111,110,109,111,115,116,32,114,101,99,101,110,116,115,
+104,97,114,101,32,119,105,116,104,32,115,97,121,105,110,103,32,116,104,97,116,
+102,105,108,108,101,100,32,119,105,116,104,100,101,115,105,103,110,101,100,32,
+116,111,105,116,32,105,115,32,111,102,116,101,110,34,62,60,47,105,102,114,97,109
+,101,62,97,115,32,102,111,108,108,111,119,115,58,109,101,114,103,101,100,32,119,
+105,116,104,116,104,114,111,117,103,104,32,116,104,101,99,111,109,109,101,114,99
+,105,97,108,32,112,111,105,110,116,101,100,32,111,117,116,111,112,112,111,114,
+116,117,110,105,116,121,118,105,101,119,32,111,102,32,116,104,101,114,101,113,
+117,105,114,101,109,101,110,116,100,105,118,105,115,105,111,110,32,111,102,112,
+114,111,103,114,97,109,109,105,110,103,104,101,32,114,101,99,101,105,118,101,100
+,115,101,116,73,110,116,101,114,118,97,108,34,62,60,47,115,112,97,110,62,60,47,
+105,110,32,78,101,119,32,89,111,114,107,97,100,100,105,116,105,111,110,97,108,32
+,99,111,109,112,114,101,115,115,105,111,110,10,10,60,100,105,118,32,105,100,61,
+34,105,110,99,111,114,112,111,114,97,116,101,59,60,47,115,99,114,105,112,116,62,
+60,97,116,116,97,99,104,69,118,101,110,116,98,101,99,97,109,101,32,116,104,101,
+32,34,32,116,97,114,103,101,116,61,34,95,99,97,114,114,105,101,100,32,111,117,
+116,83,111,109,101,32,111,102,32,116,104,101,115,99,105,101,110,99,101,32,97,110
+,100,116,104,101,32,116,105,109,101,32,111,102,67,111,110,116,97,105,110,101,114
+,34,62,109,97,105,110,116,97,105,110,105,110,103,67,104,114,105,115,116,111,112,
+104,101,114,77,117,99,104,32,111,102,32,116,104,101,119,114,105,116,105,110,103,
+115,32,111,102,34,32,104,101,105,103,104,116,61,34,50,115,105,122,101,32,111,102
+,32,116,104,101,118,101,114,115,105,111,110,32,111,102,32,109,105,120,116,117,
+114,101,32,111,102,32,98,101,116,119,101,101,110,32,116,104,101,69,120,97,109,
+112,108,101,115,32,111,102,101,100,117,99,97,116,105,111,110,97,108,99,111,109,
+112,101,116,105,116,105,118,101,32,111,110,115,117,98,109,105,116,61,34,100,105,
+114,101,99,116,111,114,32,111,102,100,105,115,116,105,110,99,116,105,118,101,47,
+68,84,68,32,88,72,84,77,76,32,114,101,108,97,116,105,110,103,32,116,111,116,101,
+110,100,101,110,99,121,32,116,111,112,114,111,118,105,110,99,101,32,111,102,119,
+104,105,99,104,32,119,111,117,108,100,100,101,115,112,105,116,101,32,116,104,101
+,115,99,105,101,110,116,105,102,105,99,32,108,101,103,105,115,108,97,116,117,114
+,101,46,105,110,110,101,114,72,84,77,76,32,97,108,108,101,103,97,116,105,111,110
+,115,65,103,114,105,99,117,108,116,117,114,101,119,97,115,32,117,115,101,100,32,
+105,110,97,112,112,114,111,97,99,104,32,116,111,105,110,116,101,108,108,105,103,
+101,110,116,121,101,97,114,115,32,108,97,116,101,114,44,115,97,110,115,45,115,
+101,114,105,102,100,101,116,101,114,109,105,110,105,110,103,80,101,114,102,111,
+114,109,97,110,99,101,97,112,112,101,97,114,97,110,99,101,115,44,32,119,104,105,
+99,104,32,105,115,32,102,111,117,110,100,97,116,105,111,110,115,97,98,98,114,101
+,118,105,97,116,101,100,104,105,103,104,101,114,32,116,104,97,110,115,32,102,114
+,111,109,32,116,104,101,32,105,110,100,105,118,105,100,117,97,108,32,99,111,109,
+112,111,115,101,100,32,111,102,115,117,112,112,111,115,101,100,32,116,111,99,108
+,97,105,109,115,32,116,104,97,116,97,116,116,114,105,98,117,116,105,111,110,102,
+111,110,116,45,115,105,122,101,58,49,101,108,101,109,101,110,116,115,32,111,102,
+72,105,115,116,111,114,105,99,97,108,32,104,105,115,32,98,114,111,116,104,101,
+114,97,116,32,116,104,101,32,116,105,109,101,97,110,110,105,118,101,114,115,97,
+114,121,103,111,118,101,114,110,101,100,32,98,121,114,101,108,97,116,101,100,32,
+116,111,32,117,108,116,105,109,97,116,101,108,121,32,105,110,110,111,118,97,116,
+105,111,110,115,105,116,32,105,115,32,115,116,105,108,108,99,97,110,32,111,110,
+108,121,32,98,101,100,101,102,105,110,105,116,105,111,110,115,116,111,71,77,84,
+83,116,114,105,110,103,65,32,110,117,109,98,101,114,32,111,102,105,109,103,32,99
+,108,97,115,115,61,34,69,118,101,110,116,117,97,108,108,121,44,119,97,115,32,99,
+104,97,110,103,101,100,111,99,99,117,114,114,101,100,32,105,110,110,101,105,103,
+104,98,111,114,105,110,103,100,105,115,116,105,110,103,117,105,115,104,119,104,
+101,110,32,104,101,32,119,97,115,105,110,116,114,111,100,117,99,105,110,103,116,
+101,114,114,101,115,116,114,105,97,108,77,97,110,121,32,111,102,32,116,104,101,
+97,114,103,117,101,115,32,116,104,97,116,97,110,32,65,109,101,114,105,99,97,110,
+99,111,110,113,117,101,115,116,32,111,102,119,105,100,101,115,112,114,101,97,100
+,32,119,101,114,101,32,107,105,108,108,101,100,115,99,114,101,101,110,32,97,110,
+100,32,73,110,32,111,114,100,101,114,32,116,111,101,120,112,101,99,116,101,100,
+32,116,111,100,101,115,99,101,110,100,97,110,116,115,97,114,101,32,108,111,99,97
+,116,101,100,108,101,103,105,115,108,97,116,105,118,101,103,101,110,101,114,97,
+116,105,111,110,115,32,98,97,99,107,103,114,111,117,110,100,109,111,115,116,32,
+112,101,111,112,108,101,121,101,97,114,115,32,97,102,116,101,114,116,104,101,114
+,101,32,105,115,32,110,111,116,104,101,32,104,105,103,104,101,115,116,102,114,
+101,113,117,101,110,116,108,121,32,116,104,101,121,32,100,111,32,110,111,116,97,
+114,103,117,101,100,32,116,104,97,116,115,104,111,119,101,100,32,116,104,97,116,
+112,114,101,100,111,109,105,110,97,110,116,116,104,101,111,108,111,103,105,99,97
+,108,98,121,32,116,104,101,32,116,105,109,101,99,111,110,115,105,100,101,114,105
+,110,103,115,104,111,114,116,45,108,105,118,101,100,60,47,115,112,97,110,62,60,
+47,97,62,99,97,110,32,98,101,32,117,115,101,100,118,101,114,121,32,108,105,116,
+116,108,101,111,110,101,32,111,102,32,116,104,101,32,104,97,100,32,97,108,114,
+101,97,100,121,105,110,116,101,114,112,114,101,116,101,100,99,111,109,109,117,
+110,105,99,97,116,101,102,101,97,116,117,114,101,115,32,111,102,103,111,118,101,
+114,110,109,101,110,116,44,60,47,110,111,115,99,114,105,112,116,62,101,110,116,
+101,114,101,100,32,116,104,101,34,32,104,101,105,103,104,116,61,34,51,73,110,100
+,101,112,101,110,100,101,110,116,112,111,112,117,108,97,116,105,111,110,115,108,
+97,114,103,101,45,115,99,97,108,101,46,32,65,108,116,104,111,117,103,104,32,117,
+115,101,100,32,105,110,32,116,104,101,100,101,115,116,114,117,99,116,105,111,110
+,112,111,115,115,105,98,105,108,105,116,121,115,116,97,114,116,105,110,103,32,
+105,110,116,119,111,32,111,114,32,109,111,114,101,101,120,112,114,101,115,115,
+105,111,110,115,115,117,98,111,114,100,105,110,97,116,101,108,97,114,103,101,114
+,32,116,104,97,110,104,105,115,116,111,114,121,32,97,110,100,60,47,111,112,116,
+105,111,110,62,13,10,67,111,110,116,105,110,101,110,116,97,108,101,108,105,109,
+105,110,97,116,105,110,103,119,105,108,108,32,110,111,116,32,98,101,112,114,97,
+99,116,105,99,101,32,111,102,105,110,32,102,114,111,110,116,32,111,102,115,105,
+116,101,32,111,102,32,116,104,101,101,110,115,117,114,101,32,116,104,97,116,116,
+111,32,99,114,101,97,116,101,32,97,109,105,115,115,105,115,115,105,112,112,105,
+112,111,116,101,110,116,105,97,108,108,121,111,117,116,115,116,97,110,100,105,
+110,103,98,101,116,116,101,114,32,116,104,97,110,119,104,97,116,32,105,115,32,
+110,111,119,115,105,116,117,97,116,101,100,32,105,110,109,101,116,97,32,110,97,
+109,101,61,34,84,114,97,100,105,116,105,111,110,97,108,115,117,103,103,101,115,
+116,105,111,110,115,84,114,97,110,115,108,97,116,105,111,110,116,104,101,32,102,
+111,114,109,32,111,102,97,116,109,111,115,112,104,101,114,105,99,105,100,101,111
+,108,111,103,105,99,97,108,101,110,116,101,114,112,114,105,115,101,115,99,97,108
+,99,117,108,97,116,105,110,103,101,97,115,116,32,111,102,32,116,104,101,114,101,
+109,110,97,110,116,115,32,111,102,112,108,117,103,105,110,115,112,97,103,101,47,
+105,110,100,101,120,46,112,104,112,63,114,101,109,97,105,110,101,100,32,105,110,
+116,114,97,110,115,102,111,114,109,101,100,72,101,32,119,97,115,32,97,108,115,
+111,119,97,115,32,97,108,114,101,97,100,121,115,116,97,116,105,115,116,105,99,97
+,108,105,110,32,102,97,118,111,114,32,111,102,77,105,110,105,115,116,114,121,32,
+111,102,109,111,118,101,109,101,110,116,32,111,102,102,111,114,109,117,108,97,
+116,105,111,110,105,115,32,114,101,113,117,105,114,101,100,60,108,105,110,107,32
+,114,101,108,61,34,84,104,105,115,32,105,115,32,116,104,101,32,60,97,32,104,114,
+101,102,61,34,47,112,111,112,117,108,97,114,105,122,101,100,105,110,118,111,108,
+118,101,100,32,105,110,97,114,101,32,117,115,101,100,32,116,111,97,110,100,32,
+115,101,118,101,114,97,108,109,97,100,101,32,98,121,32,116,104,101,115,101,101,
+109,115,32,116,111,32,98,101,108,105,107,101,108,121,32,116,104,97,116,80,97,108
+,101,115,116,105,110,105,97,110,110,97,109,101,100,32,97,102,116,101,114,105,116
+,32,104,97,100,32,98,101,101,110,109,111,115,116,32,99,111,109,109,111,110,116,
+111,32,114,101,102,101,114,32,116,111,98,117,116,32,116,104,105,115,32,105,115,
+99,111,110,115,101,99,117,116,105,118,101,116,101,109,112,111,114,97,114,105,108
+,121,73,110,32,103,101,110,101,114,97,108,44,99,111,110,118,101,110,116,105,111,
+110,115,116,97,107,101,115,32,112,108,97,99,101,115,117,98,100,105,118,105,115,
+105,111,110,116,101,114,114,105,116,111,114,105,97,108,111,112,101,114,97,116,
+105,111,110,97,108,112,101,114,109,97,110,101,110,116,108,121,119,97,115,32,108,
+97,114,103,101,108,121,111,117,116,98,114,101,97,107,32,111,102,105,110,32,116,
+104,101,32,112,97,115,116,102,111,108,108,111,119,105,110,103,32,97,32,120,109,
+108,110,115,58,111,103,61,34,62,60,97,32,99,108,97,115,115,61,34,99,108,97,115,
+115,61,34,116,101,120,116,67,111,110,118,101,114,115,105,111,110,32,109,97,121,
+32,98,101,32,117,115,101,100,109,97,110,117,102,97,99,116,117,114,101,97,102,116
+,101,114,32,98,101,105,110,103,99,108,101,97,114,102,105,120,34,62,10,113,117,
+101,115,116,105,111,110,32,111,102,119,97,115,32,101,108,101,99,116,101,100,116,
+111,32,98,101,99,111,109,101,32,97,98,101,99,97,117,115,101,32,111,102,32,115,
+111,109,101,32,112,101,111,112,108,101,105,110,115,112,105,114,101,100,32,98,121
+,115,117,99,99,101,115,115,102,117,108,32,97,32,116,105,109,101,32,119,104,101,
+110,109,111,114,101,32,99,111,109,109,111,110,97,109,111,110,103,115,116,32,116,
+104,101,97,110,32,111,102,102,105,99,105,97,108,119,105,100,116,104,58,49,48,48,
+37,59,116,101,99,104,110,111,108,111,103,121,44,119,97,115,32,97,100,111,112,116
+,101,100,116,111,32,107,101,101,112,32,116,104,101,115,101,116,116,108,101,109,
+101,110,116,115,108,105,118,101,32,98,105,114,116,104,115,105,110,100,101,120,46
+,104,116,109,108,34,67,111,110,110,101,99,116,105,99,117,116,97,115,115,105,103,
+110,101,100,32,116,111,38,97,109,112,59,116,105,109,101,115,59,97,99,99,111,117,
+110,116,32,102,111,114,97,108,105,103,110,61,114,105,103,104,116,116,104,101,32,
+99,111,109,112,97,110,121,97,108,119,97,121,115,32,98,101,101,110,114,101,116,
+117,114,110,101,100,32,116,111,105,110,118,111,108,118,101,109,101,110,116,66,
+101,99,97,117,115,101,32,116,104,101,116,104,105,115,32,112,101,114,105,111,100,
+34,32,110,97,109,101,61,34,113,34,32,99,111,110,102,105,110,101,100,32,116,111,
+97,32,114,101,115,117,108,116,32,111,102,118,97,108,117,101,61,34,34,32,47,62,
+105,115,32,97,99,116,117,97,108,108,121,69,110,118,105,114,111,110,109,101,110,
+116,13,10,60,47,104,101,97,100,62,13,10,67,111,110,118,101,114,115,101,108,121,
+44,62,10,60,100,105,118,32,105,100,61,34,48,34,32,119,105,100,116,104,61,34,49,
+105,115,32,112,114,111,98,97,98,108,121,104,97,118,101,32,98,101,99,111,109,101,
+99,111,110,116,114,111,108,108,105,110,103,116,104,101,32,112,114,111,98,108,101
+,109,99,105,116,105,122,101,110,115,32,111,102,112,111,108,105,116,105,99,105,97
+,110,115,114,101,97,99,104,101,100,32,116,104,101,97,115,32,101,97,114,108,121,
+32,97,115,58,110,111,110,101,59,32,111,118,101,114,60,116,97,98,108,101,32,99,
+101,108,108,118,97,108,105,100,105,116,121,32,111,102,100,105,114,101,99,116,108
+,121,32,116,111,111,110,109,111,117,115,101,100,111,119,110,119,104,101,114,101,
+32,105,116,32,105,115,119,104,101,110,32,105,116,32,119,97,115,109,101,109,98,
+101,114,115,32,111,102,32,114,101,108,97,116,105,111,110,32,116,111,97,99,99,111
+,109,109,111,100,97,116,101,97,108,111,110,103,32,119,105,116,104,32,73,110,32,
+116,104,101,32,108,97,116,101,116,104,101,32,69,110,103,108,105,115,104,100,101,
+108,105,99,105,111,117,115,34,62,116,104,105,115,32,105,115,32,110,111,116,116,
+104,101,32,112,114,101,115,101,110,116,105,102,32,116,104,101,121,32,97,114,101,
+97,110,100,32,102,105,110,97,108,108,121,97,32,109,97,116,116,101,114,32,111,102
+,13,10,9,60,47,100,105,118,62,13,10,13,10,60,47,115,99,114,105,112,116,62,102,97
+,115,116,101,114,32,116,104,97,110,109,97,106,111,114,105,116,121,32,111,102,97,
+102,116,101,114,32,119,104,105,99,104,99,111,109,112,97,114,97,116,105,118,101,
+116,111,32,109,97,105,110,116,97,105,110,105,109,112,114,111,118,101,32,116,104,
+101,97,119,97,114,100,101,100,32,116,104,101,101,114,34,32,99,108,97,115,115,61,
+34,102,114,97,109,101,98,111,114,100,101,114,114,101,115,116,111,114,97,116,105,
+111,110,105,110,32,116,104,101,32,115,97,109,101,97,110,97,108,121,115,105,115,
+32,111,102,116,104,101,105,114,32,102,105,114,115,116,68,117,114,105,110,103,32,
+116,104,101,32,99,111,110,116,105,110,101,110,116,97,108,115,101,113,117,101,110
+,99,101,32,111,102,102,117,110,99,116,105,111,110,40,41,123,102,111,110,116,45,
+115,105,122,101,58,32,119,111,114,107,32,111,110,32,116,104,101,60,47,115,99,114
+,105,112,116,62,10,60,98,101,103,105,110,115,32,119,105,116,104,106,97,118,97,
+115,99,114,105,112,116,58,99,111,110,115,116,105,116,117,101,110,116,119,97,115,
+32,102,111,117,110,100,101,100,101,113,117,105,108,105,98,114,105,117,109,97,115
+,115,117,109,101,32,116,104,97,116,105,115,32,103,105,118,101,110,32,98,121,110,
+101,101,100,115,32,116,111,32,98,101,99,111,111,114,100,105,110,97,116,101,115,
+116,104,101,32,118,97,114,105,111,117,115,97,114,101,32,112,97,114,116,32,111,
+102,111,110,108,121,32,105,110,32,116,104,101,115,101,99,116,105,111,110,115,32,
+111,102,105,115,32,97,32,99,111,109,109,111,110,116,104,101,111,114,105,101,115,
+32,111,102,100,105,115,99,111,118,101,114,105,101,115,97,115,115,111,99,105,97,
+116,105,111,110,101,100,103,101,32,111,102,32,116,104,101,115,116,114,101,110,
+103,116,104,32,111,102,112,111,115,105,116,105,111,110,32,105,110,112,114,101,
+115,101,110,116,45,100,97,121,117,110,105,118,101,114,115,97,108,108,121,116,111
+,32,102,111,114,109,32,116,104,101,98,117,116,32,105,110,115,116,101,97,100,99,
+111,114,112,111,114,97,116,105,111,110,97,116,116,97,99,104,101,100,32,116,111,
+105,115,32,99,111,109,109,111,110,108,121,114,101,97,115,111,110,115,32,102,111,
+114,32,38,113,117,111,116,59,116,104,101,32,99,97,110,32,98,101,32,109,97,100,
+101,119,97,115,32,97,98,108,101,32,116,111,119,104,105,99,104,32,109,101,97,110,
+115,98,117,116,32,100,105,100,32,110,111,116,111,110,77,111,117,115,101,79,118,
+101,114,97,115,32,112,111,115,115,105,98,108,101,111,112,101,114,97,116,101,100,
+32,98,121,99,111,109,105,110,103,32,102,114,111,109,116,104,101,32,112,114,105,
+109,97,114,121,97,100,100,105,116,105,111,110,32,111,102,102,111,114,32,115,101,
+118,101,114,97,108,116,114,97,110,115,102,101,114,114,101,100,97,32,112,101,114,
+105,111,100,32,111,102,97,114,101,32,97,98,108,101,32,116,111,104,111,119,101,
+118,101,114,44,32,105,116,115,104,111,117,108,100,32,104,97,118,101,109,117,99,
+104,32,108,97,114,103,101,114,10,9,60,47,115,99,114,105,112,116,62,97,100,111,
+112,116,101,100,32,116,104,101,112,114,111,112,101,114,116,121,32,111,102,100,
+105,114,101,99,116,101,100,32,98,121,101,102,102,101,99,116,105,118,101,108,121,
+119,97,115,32,98,114,111,117,103,104,116,99,104,105,108,100,114,101,110,32,111,
+102,80,114,111,103,114,97,109,109,105,110,103,108,111,110,103,101,114,32,116,104
+,97,110,109,97,110,117,115,99,114,105,112,116,115,119,97,114,32,97,103,97,105,
+110,115,116,98,121,32,109,101,97,110,115,32,111,102,97,110,100,32,109,111,115,
+116,32,111,102,115,105,109,105,108,97,114,32,116,111,32,112,114,111,112,114,105,
+101,116,97,114,121,111,114,105,103,105,110,97,116,105,110,103,112,114,101,115,
+116,105,103,105,111,117,115,103,114,97,109,109,97,116,105,99,97,108,101,120,112,
+101,114,105,101,110,99,101,46,116,111,32,109,97,107,101,32,116,104,101,73,116,32
+,119,97,115,32,97,108,115,111,105,115,32,102,111,117,110,100,32,105,110,99,111,
+109,112,101,116,105,116,111,114,115,105,110,32,116,104,101,32,85,46,83,46,114,
+101,112,108,97,99,101,32,116,104,101,98,114,111,117,103,104,116,32,116,104,101,
+99,97,108,99,117,108,97,116,105,111,110,102,97,108,108,32,111,102,32,116,104,101
+,116,104,101,32,103,101,110,101,114,97,108,112,114,97,99,116,105,99,97,108,108,
+121,105,110,32,104,111,110,111,114,32,111,102,114,101,108,101,97,115,101,100,32,
+105,110,114,101,115,105,100,101,110,116,105,97,108,97,110,100,32,115,111,109,101
+,32,111,102,107,105,110,103,32,111,102,32,116,104,101,114,101,97,99,116,105,111,
+110,32,116,111,49,115,116,32,69,97,114,108,32,111,102,99,117,108,116,117,114,101
+,32,97,110,100,112,114,105,110,99,105,112,97,108,108,121,60,47,116,105,116,108,
+101,62,10,32,32,116,104,101,121,32,99,97,110,32,98,101,98,97,99,107,32,116,111,
+32,116,104,101,115,111,109,101,32,111,102,32,104,105,115,101,120,112,111,115,117
+,114,101,32,116,111,97,114,101,32,115,105,109,105,108,97,114,102,111,114,109,32,
+111,102,32,116,104,101,97,100,100,70,97,118,111,114,105,116,101,99,105,116,105,
+122,101,110,115,104,105,112,112,97,114,116,32,105,110,32,116,104,101,112,101,111
+,112,108,101,32,119,105,116,104,105,110,32,112,114,97,99,116,105,99,101,116,111,
+32,99,111,110,116,105,110,117,101,38,97,109,112,59,109,105,110,117,115,59,97,112
+,112,114,111,118,101,100,32,98,121,32,116,104,101,32,102,105,114,115,116,32,97,
+108,108,111,119,101,100,32,116,104,101,97,110,100,32,102,111,114,32,116,104,101,
+102,117,110,99,116,105,111,110,105,110,103,112,108,97,121,105,110,103,32,116,104
+,101,115,111,108,117,116,105,111,110,32,116,111,104,101,105,103,104,116,61,34,48
+,34,32,105,110,32,104,105,115,32,98,111,111,107,109,111,114,101,32,116,104,97,
+110,32,97,102,111,108,108,111,119,115,32,116,104,101,99,114,101,97,116,101,100,
+32,116,104,101,112,114,101,115,101,110,99,101,32,105,110,38,110,98,115,112,59,60
+,47,116,100,62,110,97,116,105,111,110,97,108,105,115,116,116,104,101,32,105,100,
+101,97,32,111,102,97,32,99,104,97,114,97,99,116,101,114,119,101,114,101,32,102,
+111,114,99,101,100,32,99,108,97,115,115,61,34,98,116,110,100,97,121,115,32,111,
+102,32,116,104,101,102,101,97,116,117,114,101,100,32,105,110,115,104,111,119,105
+,110,103,32,116,104,101,105,110,116,101,114,101,115,116,32,105,110,105,110,32,
+112,108,97,99,101,32,111,102,116,117,114,110,32,111,102,32,116,104,101,116,104,
+101,32,104,101,97,100,32,111,102,76,111,114,100,32,111,102,32,116,104,101,112,
+111,108,105,116,105,99,97,108,108,121,104,97,115,32,105,116,115,32,111,119,110,
+69,100,117,99,97,116,105,111,110,97,108,97,112,112,114,111,118,97,108,32,111,102
+,115,111,109,101,32,111,102,32,116,104,101,101,97,99,104,32,111,116,104,101,114,
+44,98,101,104,97,118,105,111,114,32,111,102,97,110,100,32,98,101,99,97,117,115,
+101,97,110,100,32,97,110,111,116,104,101,114,97,112,112,101,97,114,101,100,32,
+111,110,114,101,99,111,114,100,101,100,32,105,110,98,108,97,99,107,38,113,117,
+111,116,59,109,97,121,32,105,110,99,108,117,100,101,116,104,101,32,119,111,114,
+108,100,39,115,99,97,110,32,108,101,97,100,32,116,111,114,101,102,101,114,115,32
+,116,111,32,97,98,111,114,100,101,114,61,34,48,34,32,103,111,118,101,114,110,109
+,101,110,116,32,119,105,110,110,105,110,103,32,116,104,101,114,101,115,117,108,
+116,101,100,32,105,110,32,119,104,105,108,101,32,116,104,101,32,87,97,115,104,
+105,110,103,116,111,110,44,116,104,101,32,115,117,98,106,101,99,116,99,105,116,
+121,32,105,110,32,116,104,101,62,60,47,100,105,118,62,13,10,9,9,114,101,102,108,
+101,99,116,32,116,104,101,116,111,32,99,111,109,112,108,101,116,101,98,101,99,97
+,109,101,32,109,111,114,101,114,97,100,105,111,97,99,116,105,118,101,114,101,106
+,101,99,116,101,100,32,98,121,119,105,116,104,111,117,116,32,97,110,121,104,105,
+115,32,102,97,116,104,101,114,44,119,104,105,99,104,32,99,111,117,108,100,99,111
+,112,121,32,111,102,32,116,104,101,116,111,32,105,110,100,105,99,97,116,101,97,
+32,112,111,108,105,116,105,99,97,108,97,99,99,111,117,110,116,115,32,111,102,99,
+111,110,115,116,105,116,117,116,101,115,119,111,114,107,101,100,32,119,105,116,
+104,101,114,60,47,97,62,60,47,108,105,62,111,102,32,104,105,115,32,108,105,102,
+101,97,99,99,111,109,112,97,110,105,101,100,99,108,105,101,110,116,87,105,100,
+116,104,112,114,101,118,101,110,116,32,116,104,101,76,101,103,105,115,108,97,116
+,105,118,101,100,105,102,102,101,114,101,110,116,108,121,116,111,103,101,116,104
+,101,114,32,105,110,104,97,115,32,115,101,118,101,114,97,108,102,111,114,32,97,
+110,111,116,104,101,114,116,101,120,116,32,111,102,32,116,104,101,102,111,117,
+110,100,101,100,32,116,104,101,101,32,119,105,116,104,32,116,104,101,32,105,115,
+32,117,115,101,100,32,102,111,114,99,104,97,110,103,101,100,32,116,104,101,117,
+115,117,97,108,108,121,32,116,104,101,112,108,97,99,101,32,119,104,101,114,101,
+119,104,101,114,101,97,115,32,116,104,101,62,32,60,97,32,104,114,101,102,61,34,
+34,62,60,97,32,104,114,101,102,61,34,116,104,101,109,115,101,108,118,101,115,44,
+97,108,116,104,111,117,103,104,32,104,101,116,104,97,116,32,99,97,110,32,98,101,
+116,114,97,100,105,116,105,111,110,97,108,114,111,108,101,32,111,102,32,116,104,
+101,97,115,32,97,32,114,101,115,117,108,116,114,101,109,111,118,101,67,104,105,
+108,100,100,101,115,105,103,110,101,100,32,98,121,119,101,115,116,32,111,102,32,
+116,104,101,83,111,109,101,32,112,101,111,112,108,101,112,114,111,100,117,99,116
+,105,111,110,44,115,105,100,101,32,111,102,32,116,104,101,110,101,119,115,108,
+101,116,116,101,114,115,117,115,101,100,32,98,121,32,116,104,101,100,111,119,110
+,32,116,111,32,116,104,101,97,99,99,101,112,116,101,100,32,98,121,108,105,118,
+101,32,105,110,32,116,104,101,97,116,116,101,109,112,116,115,32,116,111,111,117,
+116,115,105,100,101,32,116,104,101,102,114,101,113,117,101,110,99,105,101,115,72
+,111,119,101,118,101,114,44,32,105,110,112,114,111,103,114,97,109,109,101,114,
+115,97,116,32,108,101,97,115,116,32,105,110,97,112,112,114,111,120,105,109,97,
+116,101,97,108,116,104,111,117,103,104,32,105,116,119,97,115,32,112,97,114,116,
+32,111,102,97,110,100,32,118,97,114,105,111,117,115,71,111,118,101,114,110,111,
+114,32,111,102,116,104,101,32,97,114,116,105,99,108,101,116,117,114,110,101,100,
+32,105,110,116,111,62,60,97,32,104,114,101,102,61,34,47,116,104,101,32,101,99,
+111,110,111,109,121,105,115,32,116,104,101,32,109,111,115,116,109,111,115,116,32
+,119,105,100,101,108,121,119,111,117,108,100,32,108,97,116,101,114,97,110,100,32
+,112,101,114,104,97,112,115,114,105,115,101,32,116,111,32,116,104,101,111,99,99,
+117,114,115,32,119,104,101,110,117,110,100,101,114,32,119,104,105,99,104,99,111,
+110,100,105,116,105,111,110,115,46,116,104,101,32,119,101,115,116,101,114,110,
+116,104,101,111,114,121,32,116,104,97,116,105,115,32,112,114,111,100,117,99,101,
+100,116,104,101,32,99,105,116,121,32,111,102,105,110,32,119,104,105,99,104,32,
+104,101,115,101,101,110,32,105,110,32,116,104,101,116,104,101,32,99,101,110,116,
+114,97,108,98,117,105,108,100,105,110,103,32,111,102,109,97,110,121,32,111,102,
+32,104,105,115,97,114,101,97,32,111,102,32,116,104,101,105,115,32,116,104,101,32
+,111,110,108,121,109,111,115,116,32,111,102,32,116,104,101,109,97,110,121,32,111
+,102,32,116,104,101,116,104,101,32,87,101,115,116,101,114,110,84,104,101,114,101
+,32,105,115,32,110,111,101,120,116,101,110,100,101,100,32,116,111,83,116,97,116,
+105,115,116,105,99,97,108,99,111,108,115,112,97,110,61,50,32,124,115,104,111,114
+,116,32,115,116,111,114,121,112,111,115,115,105,98,108,101,32,116,111,116,111,
+112,111,108,111,103,105,99,97,108,99,114,105,116,105,99,97,108,32,111,102,114,
+101,112,111,114,116,101,100,32,116,111,97,32,67,104,114,105,115,116,105,97,110,
+100,101,99,105,115,105,111,110,32,116,111,105,115,32,101,113,117,97,108,32,116,
+111,112,114,111,98,108,101,109,115,32,111,102,84,104,105,115,32,99,97,110,32,98,
+101,109,101,114,99,104,97,110,100,105,115,101,102,111,114,32,109,111,115,116,32,
+111,102,110,111,32,101,118,105,100,101,110,99,101,101,100,105,116,105,111,110,
+115,32,111,102,101,108,101,109,101,110,116,115,32,105,110,38,113,117,111,116,59,
+46,32,84,104,101,99,111,109,47,105,109,97,103,101,115,47,119,104,105,99,104,32,
+109,97,107,101,115,116,104,101,32,112,114,111,99,101,115,115,114,101,109,97,105,
+110,115,32,116,104,101,108,105,116,101,114,97,116,117,114,101,44,105,115,32,97,
+32,109,101,109,98,101,114,116,104,101,32,112,111,112,117,108,97,114,116,104,101,
+32,97,110,99,105,101,110,116,112,114,111,98,108,101,109,115,32,105,110,116,105,
+109,101,32,111,102,32,116,104,101,100,101,102,101,97,116,101,100,32,98,121,98,
+111,100,121,32,111,102,32,116,104,101,97,32,102,101,119,32,121,101,97,114,115,
+109,117,99,104,32,111,102,32,116,104,101,116,104,101,32,119,111,114,107,32,111,
+102,67,97,108,105,102,111,114,110,105,97,44,115,101,114,118,101,100,32,97,115,32
+,97,103,111,118,101,114,110,109,101,110,116,46,99,111,110,99,101,112,116,115,32,
+111,102,109,111,118,101,109,101,110,116,32,105,110,9,9,60,100,105,118,32,105,100
+,61,34,105,116,34,32,118,97,108,117,101,61,34,108,97,110,103,117,97,103,101,32,
+111,102,97,115,32,116,104,101,121,32,97,114,101,112,114,111,100,117,99,101,100,
+32,105,110,105,115,32,116,104,97,116,32,116,104,101,101,120,112,108,97,105,110,
+32,116,104,101,100,105,118,62,60,47,100,105,118,62,10,72,111,119,101,118,101,114
+,32,116,104,101,108,101,97,100,32,116,111,32,116,104,101,9,60,97,32,104,114,101,
+102,61,34,47,119,97,115,32,103,114,97,110,116,101,100,112,101,111,112,108,101,32
+,104,97,118,101,99,111,110,116,105,110,117,97,108,108,121,119,97,115,32,115,101,
+101,110,32,97,115,97,110,100,32,114,101,108,97,116,101,100,116,104,101,32,114,
+111,108,101,32,111,102,112,114,111,112,111,115,101,100,32,98,121,111,102,32,116,
+104,101,32,98,101,115,116,101,97,99,104,32,111,116,104,101,114,46,67,111,110,115
+,116,97,110,116,105,110,101,112,101,111,112,108,101,32,102,114,111,109,100,105,
+97,108,101,99,116,115,32,111,102,116,111,32,114,101,118,105,115,105,111,110,119,
+97,115,32,114,101,110,97,109,101,100,97,32,115,111,117,114,99,101,32,111,102,116
+,104,101,32,105,110,105,116,105,97,108,108,97,117,110,99,104,101,100,32,105,110,
+112,114,111,118,105,100,101,32,116,104,101,116,111,32,116,104,101,32,119,101,115
+,116,119,104,101,114,101,32,116,104,101,114,101,97,110,100,32,115,105,109,105,
+108,97,114,98,101,116,119,101,101,110,32,116,119,111,105,115,32,97,108,115,111,
+32,116,104,101,69,110,103,108,105,115,104,32,97,110,100,99,111,110,100,105,116,
+105,111,110,115,44,116,104,97,116,32,105,116,32,119,97,115,101,110,116,105,116,
+108,101,100,32,116,111,116,104,101,109,115,101,108,118,101,115,46,113,117,97,110
+,116,105,116,121,32,111,102,114,97,110,115,112,97,114,101,110,99,121,116,104,101
+,32,115,97,109,101,32,97,115,116,111,32,106,111,105,110,32,116,104,101,99,111,
+117,110,116,114,121,32,97,110,100,116,104,105,115,32,105,115,32,116,104,101,84,
+104,105,115,32,108,101,100,32,116,111,97,32,115,116,97,116,101,109,101,110,116,
+99,111,110,116,114,97,115,116,32,116,111,108,97,115,116,73,110,100,101,120,79,
+102,116,104,114,111,117,103,104,32,104,105,115,105,115,32,100,101,115,105,103,
+110,101,100,116,104,101,32,116,101,114,109,32,105,115,105,115,32,112,114,111,118
+,105,100,101,100,112,114,111,116,101,99,116,32,116,104,101,110,103,60,47,97,62,
+60,47,108,105,62,84,104,101,32,99,117,114,114,101,110,116,116,104,101,32,115,105
+,116,101,32,111,102,115,117,98,115,116,97,110,116,105,97,108,101,120,112,101,114
+,105,101,110,99,101,44,105,110,32,116,104,101,32,87,101,115,116,116,104,101,121,
+32,115,104,111,117,108,100,115,108,111,118,101,110,196,141,105,110,97,99,111,109
+,101,110,116,97,114,105,111,115,117,110,105,118,101,114,115,105,100,97,100,99,
+111,110,100,105,99,105,111,110,101,115,97,99,116,105,118,105,100,97,100,101,115,
+101,120,112,101,114,105,101,110,99,105,97,116,101,99,110,111,108,111,103,195,173
+,97,112,114,111,100,117,99,99,105,195,179,110,112,117,110,116,117,97,99,105,195,
+179,110,97,112,108,105,99,97,99,105,195,179,110,99,111,110,116,114,97,115,101,
+195,177,97,99,97,116,101,103,111,114,195,173,97,115,114,101,103,105,115,116,114,
+97,114,115,101,112,114,111,102,101,115,105,111,110,97,108,116,114,97,116,97,109,
+105,101,110,116,111,114,101,103,195,173,115,116,114,97,116,101,115,101,99,114,
+101,116,97,114,195,173,97,112,114,105,110,99,105,112,97,108,101,115,112,114,111,
+116,101,99,99,105,195,179,110,105,109,112,111,114,116,97,110,116,101,115,105,109
+,112,111,114,116,97,110,99,105,97,112,111,115,105,98,105,108,105,100,97,100,105,
+110,116,101,114,101,115,97,110,116,101,99,114,101,99,105,109,105,101,110,116,111
+,110,101,99,101,115,105,100,97,100,101,115,115,117,115,99,114,105,98,105,114,115
+,101,97,115,111,99,105,97,99,105,195,179,110,100,105,115,112,111,110,105,98,108,
+101,115,101,118,97,108,117,97,99,105,195,179,110,101,115,116,117,100,105,97,110,
+116,101,115,114,101,115,112,111,110,115,97,98,108,101,114,101,115,111,108,117,99
+,105,195,179,110,103,117,97,100,97,108,97,106,97,114,97,114,101,103,105,115,116,
+114,97,100,111,115,111,112,111,114,116,117,110,105,100,97,100,99,111,109,101,114
+,99,105,97,108,101,115,102,111,116,111,103,114,97,102,195,173,97,97,117,116,111,
+114,105,100,97,100,101,115,105,110,103,101,110,105,101,114,195,173,97,116,101,
+108,101,118,105,115,105,195,179,110,99,111,109,112,101,116,101,110,99,105,97,111
+,112,101,114,97,99,105,111,110,101,115,101,115,116,97,98,108,101,99,105,100,111,
+115,105,109,112,108,101,109,101,110,116,101,97,99,116,117,97,108,109,101,110,116
+,101,110,97,118,101,103,97,99,105,195,179,110,99,111,110,102,111,114,109,105,100
+,97,100,108,105,110,101,45,104,101,105,103,104,116,58,102,111,110,116,45,102,97,
+109,105,108,121,58,34,32,58,32,34,104,116,116,112,58,47,47,97,112,112,108,105,99
+,97,116,105,111,110,115,108,105,110,107,34,32,104,114,101,102,61,34,115,112,101,
+99,105,102,105,99,97,108,108,121,47,47,60,33,91,67,68,65,84,65,91,10,79,114,103,
+97,110,105,122,97,116,105,111,110,100,105,115,116,114,105,98,117,116,105,111,110
+,48,112,120,59,32,104,101,105,103,104,116,58,114,101,108,97,116,105,111,110,115,
+104,105,112,100,101,118,105,99,101,45,119,105,100,116,104,60,100,105,118,32,99,
+108,97,115,115,61,34,60,108,97,98,101,108,32,102,111,114,61,34,114,101,103,105,
+115,116,114,97,116,105,111,110,60,47,110,111,115,99,114,105,112,116,62,10,47,105
+,110,100,101,120,46,104,116,109,108,34,119,105,110,100,111,119,46,111,112,101,
+110,40,32,33,105,109,112,111,114,116,97,110,116,59,97,112,112,108,105,99,97,116,
+105,111,110,47,105,110,100,101,112,101,110,100,101,110,99,101,47,47,119,119,119,
+46,103,111,111,103,108,101,111,114,103,97,110,105,122,97,116,105,111,110,97,117,
+116,111,99,111,109,112,108,101,116,101,114,101,113,117,105,114,101,109,101,110,
+116,115,99,111,110,115,101,114,118,97,116,105,118,101,60,102,111,114,109,32,110,
+97,109,101,61,34,105,110,116,101,108,108,101,99,116,117,97,108,109,97,114,103,
+105,110,45,108,101,102,116,58,49,56,116,104,32,99,101,110,116,117,114,121,97,110
+,32,105,109,112,111,114,116,97,110,116,105,110,115,116,105,116,117,116,105,111,
+110,115,97,98,98,114,101,118,105,97,116,105,111,110,60,105,109,103,32,99,108,97,
+115,115,61,34,111,114,103,97,110,105,115,97,116,105,111,110,99,105,118,105,108,
+105,122,97,116,105,111,110,49,57,116,104,32,99,101,110,116,117,114,121,97,114,99
+,104,105,116,101,99,116,117,114,101,105,110,99,111,114,112,111,114,97,116,101,
+100,50,48,116,104,32,99,101,110,116,117,114,121,45,99,111,110,116,97,105,110,101
+,114,34,62,109,111,115,116,32,110,111,116,97,98,108,121,47,62,60,47,97,62,60,47,
+100,105,118,62,110,111,116,105,102,105,99,97,116,105,111,110,39,117,110,100,101,
+102,105,110,101,100,39,41,70,117,114,116,104,101,114,109,111,114,101,44,98,101,
+108,105,101,118,101,32,116,104,97,116,105,110,110,101,114,72,84,77,76,32,61,32,
+112,114,105,111,114,32,116,111,32,116,104,101,100,114,97,109,97,116,105,99,97,
+108,108,121,114,101,102,101,114,114,105,110,103,32,116,111,110,101,103,111,116,
+105,97,116,105,111,110,115,104,101,97,100,113,117,97,114,116,101,114,115,83,111,
+117,116,104,32,65,102,114,105,99,97,117,110,115,117,99,99,101,115,115,102,117,
+108,80,101,110,110,115,121,108,118,97,110,105,97,65,115,32,97,32,114,101,115,117
+,108,116,44,60,104,116,109,108,32,108,97,110,103,61,34,38,108,116,59,47,115,117,
+112,38,103,116,59,100,101,97,108,105,110,103,32,119,105,116,104,112,104,105,108,
+97,100,101,108,112,104,105,97,104,105,115,116,111,114,105,99,97,108,108,121,41,
+59,60,47,115,99,114,105,112,116,62,10,112,97,100,100,105,110,103,45,116,111,112,
+58,101,120,112,101,114,105,109,101,110,116,97,108,103,101,116,65,116,116,114,105
+,98,117,116,101,105,110,115,116,114,117,99,116,105,111,110,115,116,101,99,104,
+110,111,108,111,103,105,101,115,112,97,114,116,32,111,102,32,116,104,101,32,61,
+102,117,110,99,116,105,111,110,40,41,123,115,117,98,115,99,114,105,112,116,105,
+111,110,108,46,100,116,100,34,62,13,10,60,104,116,103,101,111,103,114,97,112,104
+,105,99,97,108,67,111,110,115,116,105,116,117,116,105,111,110,39,44,32,102,117,
+110,99,116,105,111,110,40,115,117,112,112,111,114,116,101,100,32,98,121,97,103,
+114,105,99,117,108,116,117,114,97,108,99,111,110,115,116,114,117,99,116,105,111,
+110,112,117,98,108,105,99,97,116,105,111,110,115,102,111,110,116,45,115,105,122,
+101,58,32,49,97,32,118,97,114,105,101,116,121,32,111,102,60,100,105,118,32,115,
+116,121,108,101,61,34,69,110,99,121,99,108,111,112,101,100,105,97,105,102,114,97
+,109,101,32,115,114,99,61,34,100,101,109,111,110,115,116,114,97,116,101,100,97,
+99,99,111,109,112,108,105,115,104,101,100,117,110,105,118,101,114,115,105,116,
+105,101,115,68,101,109,111,103,114,97,112,104,105,99,115,41,59,60,47,115,99,114,
+105,112,116,62,60,100,101,100,105,99,97,116,101,100,32,116,111,107,110,111,119,
+108,101,100,103,101,32,111,102,115,97,116,105,115,102,97,99,116,105,111,110,112,
+97,114,116,105,99,117,108,97,114,108,121,60,47,100,105,118,62,60,47,100,105,118,
+62,69,110,103,108,105,115,104,32,40,85,83,41,97,112,112,101,110,100,67,104,105,
+108,100,40,116,114,97,110,115,109,105,115,115,105,111,110,115,46,32,72,111,119,
+101,118,101,114,44,32,105,110,116,101,108,108,105,103,101,110,99,101,34,32,116,
+97,98,105,110,100,101,120,61,34,102,108,111,97,116,58,114,105,103,104,116,59,67,
+111,109,109,111,110,119,101,97,108,116,104,114,97,110,103,105,110,103,32,102,114
+,111,109,105,110,32,119,104,105,99,104,32,116,104,101,97,116,32,108,101,97,115,
+116,32,111,110,101,114,101,112,114,111,100,117,99,116,105,111,110,101,110,99,121
+,99,108,111,112,101,100,105,97,59,102,111,110,116,45,115,105,122,101,58,49,106,
+117,114,105,115,100,105,99,116,105,111,110,97,116,32,116,104,97,116,32,116,105,
+109,101,34,62,60,97,32,99,108,97,115,115,61,34,73,110,32,97,100,100,105,116,105,
+111,110,44,100,101,115,99,114,105,112,116,105,111,110,43,99,111,110,118,101,114,
+115,97,116,105,111,110,99,111,110,116,97,99,116,32,119,105,116,104,105,115,32,
+103,101,110,101,114,97,108,108,121,114,34,32,99,111,110,116,101,110,116,61,34,
+114,101,112,114,101,115,101,110,116,105,110,103,38,108,116,59,109,97,116,104,38,
+103,116,59,112,114,101,115,101,110,116,97,116,105,111,110,111,99,99,97,115,105,
+111,110,97,108,108,121,60,105,109,103,32,119,105,100,116,104,61,34,110,97,118,
+105,103,97,116,105,111,110,34,62,99,111,109,112,101,110,115,97,116,105,111,110,
+99,104,97,109,112,105,111,110,115,104,105,112,109,101,100,105,97,61,34,97,108,
+108,34,32,118,105,111,108,97,116,105,111,110,32,111,102,114,101,102,101,114,101,
+110,99,101,32,116,111,114,101,116,117,114,110,32,116,114,117,101,59,83,116,114,
+105,99,116,47,47,69,78,34,32,116,114,97,110,115,97,99,116,105,111,110,115,105,
+110,116,101,114,118,101,110,116,105,111,110,118,101,114,105,102,105,99,97,116,
+105,111,110,73,110,102,111,114,109,97,116,105,111,110,32,100,105,102,102,105,99,
+117,108,116,105,101,115,67,104,97,109,112,105,111,110,115,104,105,112,99,97,112,
+97,98,105,108,105,116,105,101,115,60,33,91,101,110,100,105,102,93,45,45,62,125,
+10,60,47,115,99,114,105,112,116,62,10,67,104,114,105,115,116,105,97,110,105,116,
+121,102,111,114,32,101,120,97,109,112,108,101,44,80,114,111,102,101,115,115,105,
+111,110,97,108,114,101,115,116,114,105,99,116,105,111,110,115,115,117,103,103,
+101,115,116,32,116,104,97,116,119,97,115,32,114,101,108,101,97,115,101,100,40,
+115,117,99,104,32,97,115,32,116,104,101,114,101,109,111,118,101,67,108,97,115,
+115,40,117,110,101,109,112,108,111,121,109,101,110,116,116,104,101,32,65,109,101
+,114,105,99,97,110,115,116,114,117,99,116,117,114,101,32,111,102,47,105,110,100,
+101,120,46,104,116,109,108,32,112,117,98,108,105,115,104,101,100,32,105,110,115,
+112,97,110,32,99,108,97,115,115,61,34,34,62,60,97,32,104,114,101,102,61,34,47,
+105,110,116,114,111,100,117,99,116,105,111,110,98,101,108,111,110,103,105,110,
+103,32,116,111,99,108,97,105,109,101,100,32,116,104,97,116,99,111,110,115,101,
+113,117,101,110,99,101,115,60,109,101,116,97,32,110,97,109,101,61,34,71,117,105,
+100,101,32,116,111,32,116,104,101,111,118,101,114,119,104,101,108,109,105,110,
+103,97,103,97,105,110,115,116,32,116,104,101,32,99,111,110,99,101,110,116,114,97
+,116,101,100,44,10,46,110,111,110,116,111,117,99,104,32,111,98,115,101,114,118,
+97,116,105,111,110,115,60,47,97,62,10,60,47,100,105,118,62,10,102,32,40,100,111,
+99,117,109,101,110,116,46,98,111,114,100,101,114,58,32,49,112,120,32,123,102,111
+,110,116,45,115,105,122,101,58,49,116,114,101,97,116,109,101,110,116,32,111,102,
+48,34,32,104,101,105,103,104,116,61,34,49,109,111,100,105,102,105,99,97,116,105,
+111,110,73,110,100,101,112,101,110,100,101,110,99,101,100,105,118,105,100,101,
+100,32,105,110,116,111,103,114,101,97,116,101,114,32,116,104,97,110,97,99,104,
+105,101,118,101,109,101,110,116,115,101,115,116,97,98,108,105,115,104,105,110,
+103,74,97,118,97,83,99,114,105,112,116,34,32,110,101,118,101,114,116,104,101,108
+,101,115,115,115,105,103,110,105,102,105,99,97,110,99,101,66,114,111,97,100,99,
+97,115,116,105,110,103,62,38,110,98,115,112,59,60,47,116,100,62,99,111,110,116,
+97,105,110,101,114,34,62,10,115,117,99,104,32,97,115,32,116,104,101,32,105,110,
+102,108,117,101,110,99,101,32,111,102,97,32,112,97,114,116,105,99,117,108,97,114
+,115,114,99,61,39,104,116,116,112,58,47,47,110,97,118,105,103,97,116,105,111,110
+,34,32,104,97,108,102,32,111,102,32,116,104,101,32,115,117,98,115,116,97,110,116
+,105,97,108,32,38,110,98,115,112,59,60,47,100,105,118,62,97,100,118,97,110,116,
+97,103,101,32,111,102,100,105,115,99,111,118,101,114,121,32,111,102,102,117,110,
+100,97,109,101,110,116,97,108,32,109,101,116,114,111,112,111,108,105,116,97,110,
+116,104,101,32,111,112,112,111,115,105,116,101,34,32,120,109,108,58,108,97,110,
+103,61,34,100,101,108,105,98,101,114,97,116,101,108,121,97,108,105,103,110,61,99
+,101,110,116,101,114,101,118,111,108,117,116,105,111,110,32,111,102,112,114,101,
+115,101,114,118,97,116,105,111,110,105,109,112,114,111,118,101,109,101,110,116,
+115,98,101,103,105,110,110,105,110,103,32,105,110,74,101,115,117,115,32,67,104,
+114,105,115,116,80,117,98,108,105,99,97,116,105,111,110,115,100,105,115,97,103,
+114,101,101,109,101,110,116,116,101,120,116,45,97,108,105,103,110,58,114,44,32,
+102,117,110,99,116,105,111,110,40,41,115,105,109,105,108,97,114,105,116,105,101,
+115,98,111,100,121,62,60,47,104,116,109,108,62,105,115,32,99,117,114,114,101,110
+,116,108,121,97,108,112,104,97,98,101,116,105,99,97,108,105,115,32,115,111,109,
+101,116,105,109,101,115,116,121,112,101,61,34,105,109,97,103,101,47,109,97,110,
+121,32,111,102,32,116,104,101,32,102,108,111,119,58,104,105,100,100,101,110,59,
+97,118,97,105,108,97,98,108,101,32,105,110,100,101,115,99,114,105,98,101,32,116,
+104,101,101,120,105,115,116,101,110,99,101,32,111,102,97,108,108,32,111,118,101,
+114,32,116,104,101,116,104,101,32,73,110,116,101,114,110,101,116,9,60,117,108,32
+,99,108,97,115,115,61,34,105,110,115,116,97,108,108,97,116,105,111,110,110,101,
+105,103,104,98,111,114,104,111,111,100,97,114,109,101,100,32,102,111,114,99,101,
+115,114,101,100,117,99,105,110,103,32,116,104,101,99,111,110,116,105,110,117,101
+,115,32,116,111,78,111,110,101,116,104,101,108,101,115,115,44,116,101,109,112,
+101,114,97,116,117,114,101,115,10,9,9,60,97,32,104,114,101,102,61,34,99,108,111,
+115,101,32,116,111,32,116,104,101,101,120,97,109,112,108,101,115,32,111,102,32,
+105,115,32,97,98,111,117,116,32,116,104,101,40,115,101,101,32,98,101,108,111,119
+,41,46,34,32,105,100,61,34,115,101,97,114,99,104,112,114,111,102,101,115,115,105
+,111,110,97,108,105,115,32,97,118,97,105,108,97,98,108,101,116,104,101,32,111,
+102,102,105,99,105,97,108,9,9,60,47,115,99,114,105,112,116,62,10,10,9,9,60,100,
+105,118,32,105,100,61,34,97,99,99,101,108,101,114,97,116,105,111,110,116,104,114
+,111,117,103,104,32,116,104,101,32,72,97,108,108,32,111,102,32,70,97,109,101,100
+,101,115,99,114,105,112,116,105,111,110,115,116,114,97,110,115,108,97,116,105,
+111,110,115,105,110,116,101,114,102,101,114,101,110,99,101,32,116,121,112,101,61
+,39,116,101,120,116,47,114,101,99,101,110,116,32,121,101,97,114,115,105,110,32,
+116,104,101,32,119,111,114,108,100,118,101,114,121,32,112,111,112,117,108,97,114
+,123,98,97,99,107,103,114,111,117,110,100,58,116,114,97,100,105,116,105,111,110,
+97,108,32,115,111,109,101,32,111,102,32,116,104,101,32,99,111,110,110,101,99,116
+,101,100,32,116,111,101,120,112,108,111,105,116,97,116,105,111,110,101,109,101,
+114,103,101,110,99,101,32,111,102,99,111,110,115,116,105,116,117,116,105,111,110
+,65,32,72,105,115,116,111,114,121,32,111,102,115,105,103,110,105,102,105,99,97,
+110,116,32,109,97,110,117,102,97,99,116,117,114,101,100,101,120,112,101,99,116,
+97,116,105,111,110,115,62,60,110,111,115,99,114,105,112,116,62,60,99,97,110,32,
+98,101,32,102,111,117,110,100,98,101,99,97,117,115,101,32,116,104,101,32,104,97,
+115,32,110,111,116,32,98,101,101,110,110,101,105,103,104,98,111,117,114,105,110,
+103,119,105,116,104,111,117,116,32,116,104,101,32,97,100,100,101,100,32,116,111,
+32,116,104,101,9,60,108,105,32,99,108,97,115,115,61,34,105,110,115,116,114,117,
+109,101,110,116,97,108,83,111,118,105,101,116,32,85,110,105,111,110,97,99,107,
+110,111,119,108,101,100,103,101,100,119,104,105,99,104,32,99,97,110,32,98,101,
+110,97,109,101,32,102,111,114,32,116,104,101,97,116,116,101,110,116,105,111,110,
+32,116,111,97,116,116,101,109,112,116,115,32,116,111,32,100,101,118,101,108,111,
+112,109,101,110,116,115,73,110,32,102,97,99,116,44,32,116,104,101,60,108,105,32,
+99,108,97,115,115,61,34,97,105,109,112,108,105,99,97,116,105,111,110,115,115,117
+,105,116,97,98,108,101,32,102,111,114,109,117,99,104,32,111,102,32,116,104,101,
+32,99,111,108,111,110,105,122,97,116,105,111,110,112,114,101,115,105,100,101,110
+,116,105,97,108,99,97,110,99,101,108,66,117,98,98,108,101,32,73,110,102,111,114,
+109,97,116,105,111,110,109,111,115,116,32,111,102,32,116,104,101,32,105,115,32,
+100,101,115,99,114,105,98,101,100,114,101,115,116,32,111,102,32,116,104,101,32,
+109,111,114,101,32,111,114,32,108,101,115,115,105,110,32,83,101,112,116,101,109,
+98,101,114,73,110,116,101,108,108,105,103,101,110,99,101,115,114,99,61,34,104,
+116,116,112,58,47,47,112,120,59,32,104,101,105,103,104,116,58,32,97,118,97,105,
+108,97,98,108,101,32,116,111,109,97,110,117,102,97,99,116,117,114,101,114,104,
+117,109,97,110,32,114,105,103,104,116,115,108,105,110,107,32,104,114,101,102,61,
+34,47,97,118,97,105,108,97,98,105,108,105,116,121,112,114,111,112,111,114,116,
+105,111,110,97,108,111,117,116,115,105,100,101,32,116,104,101,32,97,115,116,114,
+111,110,111,109,105,99,97,108,104,117,109,97,110,32,98,101,105,110,103,115,110,
+97,109,101,32,111,102,32,116,104,101,32,97,114,101,32,102,111,117,110,100,32,105
+,110,97,114,101,32,98,97,115,101,100,32,111,110,115,109,97,108,108,101,114,32,
+116,104,97,110,97,32,112,101,114,115,111,110,32,119,104,111,101,120,112,97,110,
+115,105,111,110,32,111,102,97,114,103,117,105,110,103,32,116,104,97,116,110,111,
+119,32,107,110,111,119,110,32,97,115,73,110,32,116,104,101,32,101,97,114,108,121
+,105,110,116,101,114,109,101,100,105,97,116,101,100,101,114,105,118,101,100,32,
+102,114,111,109,83,99,97,110,100,105,110,97,118,105,97,110,60,47,97,62,60,47,100
+,105,118,62,13,10,99,111,110,115,105,100,101,114,32,116,104,101,97,110,32,101,
+115,116,105,109,97,116,101,100,116,104,101,32,78,97,116,105,111,110,97,108,60,
+100,105,118,32,105,100,61,34,112,97,103,114,101,115,117,108,116,105,110,103,32,
+105,110,99,111,109,109,105,115,115,105,111,110,101,100,97,110,97,108,111,103,111
+,117,115,32,116,111,97,114,101,32,114,101,113,117,105,114,101,100,47,117,108,62,
+10,60,47,100,105,118,62,10,119,97,115,32,98,97,115,101,100,32,111,110,97,110,100
+,32,98,101,99,97,109,101,32,97,38,110,98,115,112,59,38,110,98,115,112,59,116,34,
+32,118,97,108,117,101,61,34,34,32,119,97,115,32,99,97,112,116,117,114,101,100,
+110,111,32,109,111,114,101,32,116,104,97,110,114,101,115,112,101,99,116,105,118,
+101,108,121,99,111,110,116,105,110,117,101,32,116,111,32,62,13,10,60,104,101,97,
+100,62,13,10,60,119,101,114,101,32,99,114,101,97,116,101,100,109,111,114,101,32,
+103,101,110,101,114,97,108,105,110,102,111,114,109,97,116,105,111,110,32,117,115
+,101,100,32,102,111,114,32,116,104,101,105,110,100,101,112,101,110,100,101,110,
+116,32,116,104,101,32,73,109,112,101,114,105,97,108,99,111,109,112,111,110,101,
+110,116,32,111,102,116,111,32,116,104,101,32,110,111,114,116,104,105,110,99,108,
+117,100,101,32,116,104,101,32,67,111,110,115,116,114,117,99,116,105,111,110,115,
+105,100,101,32,111,102,32,116,104,101,32,119,111,117,108,100,32,110,111,116,32,
+98,101,102,111,114,32,105,110,115,116,97,110,99,101,105,110,118,101,110,116,105,
+111,110,32,111,102,109,111,114,101,32,99,111,109,112,108,101,120,99,111,108,108,
+101,99,116,105,118,101,108,121,98,97,99,107,103,114,111,117,110,100,58,32,116,
+101,120,116,45,97,108,105,103,110,58,32,105,116,115,32,111,114,105,103,105,110,
+97,108,105,110,116,111,32,97,99,99,111,117,110,116,116,104,105,115,32,112,114,
+111,99,101,115,115,97,110,32,101,120,116,101,110,115,105,118,101,104,111,119,101
+,118,101,114,44,32,116,104,101,116,104,101,121,32,97,114,101,32,110,111,116,114,
+101,106,101,99,116,101,100,32,116,104,101,99,114,105,116,105,99,105,115,109,32,
+111,102,100,117,114,105,110,103,32,119,104,105,99,104,112,114,111,98,97,98,108,
+121,32,116,104,101,116,104,105,115,32,97,114,116,105,99,108,101,40,102,117,110,
+99,116,105,111,110,40,41,123,73,116,32,115,104,111,117,108,100,32,98,101,97,110,
+32,97,103,114,101,101,109,101,110,116,97,99,99,105,100,101,110,116,97,108,108,
+121,100,105,102,102,101,114,115,32,102,114,111,109,65,114,99,104,105,116,101,99,
+116,117,114,101,98,101,116,116,101,114,32,107,110,111,119,110,97,114,114,97,110,
+103,101,109,101,110,116,115,105,110,102,108,117,101,110,99,101,32,111,110,97,116
+,116,101,110,100,101,100,32,116,104,101,105,100,101,110,116,105,99,97,108,32,116
+,111,115,111,117,116,104,32,111,102,32,116,104,101,112,97,115,115,32,116,104,114
+,111,117,103,104,120,109,108,34,32,116,105,116,108,101,61,34,119,101,105,103,104
+,116,58,98,111,108,100,59,99,114,101,97,116,105,110,103,32,116,104,101,100,105,
+115,112,108,97,121,58,110,111,110,101,114,101,112,108,97,99,101,100,32,116,104,
+101,60,105,109,103,32,115,114,99,61,34,47,105,104,116,116,112,115,58,47,47,119,
+119,119,46,87,111,114,108,100,32,87,97,114,32,73,73,116,101,115,116,105,109,111,
+110,105,97,108,115,102,111,117,110,100,32,105,110,32,116,104,101,114,101,113,117
+,105,114,101,100,32,116,111,32,97,110,100,32,116,104,97,116,32,116,104,101,98,
+101,116,119,101,101,110,32,116,104,101,32,119,97,115,32,100,101,115,105,103,110,
+101,100,99,111,110,115,105,115,116,115,32,111,102,32,99,111,110,115,105,100,101,
+114,97,98,108,121,112,117,98,108,105,115,104,101,100,32,98,121,116,104,101,32,
+108,97,110,103,117,97,103,101,67,111,110,115,101,114,118,97,116,105,111,110,99,
+111,110,115,105,115,116,101,100,32,111,102,114,101,102,101,114,32,116,111,32,116
+,104,101,98,97,99,107,32,116,111,32,116,104,101,32,99,115,115,34,32,109,101,100,
+105,97,61,34,80,101,111,112,108,101,32,102,114,111,109,32,97,118,97,105,108,97,
+98,108,101,32,111,110,112,114,111,118,101,100,32,116,111,32,98,101,115,117,103,
+103,101,115,116,105,111,110,115,34,119,97,115,32,107,110,111,119,110,32,97,115,
+118,97,114,105,101,116,105,101,115,32,111,102,108,105,107,101,108,121,32,116,111
+,32,98,101,99,111,109,112,114,105,115,101,100,32,111,102,115,117,112,112,111,114
+,116,32,116,104,101,32,104,97,110,100,115,32,111,102,32,116,104,101,99,111,117,
+112,108,101,100,32,119,105,116,104,99,111,110,110,101,99,116,32,97,110,100,32,98
+,111,114,100,101,114,58,110,111,110,101,59,112,101,114,102,111,114,109,97,110,99
+,101,115,98,101,102,111,114,101,32,98,101,105,110,103,108,97,116,101,114,32,98,
+101,99,97,109,101,99,97,108,99,117,108,97,116,105,111,110,115,111,102,116,101,
+110,32,99,97,108,108,101,100,114,101,115,105,100,101,110,116,115,32,111,102,109,
+101,97,110,105,110,103,32,116,104,97,116,62,60,108,105,32,99,108,97,115,115,61,
+34,101,118,105,100,101,110,99,101,32,102,111,114,101,120,112,108,97,110,97,116,
+105,111,110,115,101,110,118,105,114,111,110,109,101,110,116,115,34,62,60,47,97,
+62,60,47,100,105,118,62,119,104,105,99,104,32,97,108,108,111,119,115,73,110,116,
+114,111,100,117,99,116,105,111,110,100,101,118,101,108,111,112,101,100,32,98,121
+,97,32,119,105,100,101,32,114,97,110,103,101,111,110,32,98,101,104,97,108,102,32
+,111,102,118,97,108,105,103,110,61,34,116,111,112,34,112,114,105,110,99,105,112,
+108,101,32,111,102,97,116,32,116,104,101,32,116,105,109,101,44,60,47,110,111,115
+,99,114,105,112,116,62,13,115,97,105,100,32,116,111,32,104,97,118,101,105,110,32
+,116,104,101,32,102,105,114,115,116,119,104,105,108,101,32,111,116,104,101,114,
+115,104,121,112,111,116,104,101,116,105,99,97,108,112,104,105,108,111,115,111,
+112,104,101,114,115,112,111,119,101,114,32,111,102,32,116,104,101,99,111,110,116
+,97,105,110,101,100,32,105,110,112,101,114,102,111,114,109,101,100,32,98,121,105
+,110,97,98,105,108,105,116,121,32,116,111,119,101,114,101,32,119,114,105,116,116
+,101,110,115,112,97,110,32,115,116,121,108,101,61,34,105,110,112,117,116,32,110,
+97,109,101,61,34,116,104,101,32,113,117,101,115,116,105,111,110,105,110,116,101,
+110,100,101,100,32,102,111,114,114,101,106,101,99,116,105,111,110,32,111,102,105
+,109,112,108,105,101,115,32,116,104,97,116,105,110,118,101,110,116,101,100,32,
+116,104,101,116,104,101,32,115,116,97,110,100,97,114,100,119,97,115,32,112,114,
+111,98,97,98,108,121,108,105,110,107,32,98,101,116,119,101,101,110,112,114,111,
+102,101,115,115,111,114,32,111,102,105,110,116,101,114,97,99,116,105,111,110,115
+,99,104,97,110,103,105,110,103,32,116,104,101,73,110,100,105,97,110,32,79,99,101
+,97,110,32,99,108,97,115,115,61,34,108,97,115,116,119,111,114,107,105,110,103,32
+,119,105,116,104,39,104,116,116,112,58,47,47,119,119,119,46,121,101,97,114,115,
+32,98,101,102,111,114,101,84,104,105,115,32,119,97,115,32,116,104,101,114,101,99
+,114,101,97,116,105,111,110,97,108,101,110,116,101,114,105,110,103,32,116,104,
+101,109,101,97,115,117,114,101,109,101,110,116,115,97,110,32,101,120,116,114,101
+,109,101,108,121,118,97,108,117,101,32,111,102,32,116,104,101,115,116,97,114,116
+,32,111,102,32,116,104,101,10,60,47,115,99,114,105,112,116,62,10,10,97,110,32,
+101,102,102,111,114,116,32,116,111,105,110,99,114,101,97,115,101,32,116,104,101,
+116,111,32,116,104,101,32,115,111,117,116,104,115,112,97,99,105,110,103,61,34,48
+,34,62,115,117,102,102,105,99,105,101,110,116,108,121,116,104,101,32,69,117,114,
+111,112,101,97,110,99,111,110,118,101,114,116,101,100,32,116,111,99,108,101,97,
+114,84,105,109,101,111,117,116,100,105,100,32,110,111,116,32,104,97,118,101,99,
+111,110,115,101,113,117,101,110,116,108,121,102,111,114,32,116,104,101,32,110,
+101,120,116,101,120,116,101,110,115,105,111,110,32,111,102,101,99,111,110,111,
+109,105,99,32,97,110,100,97,108,116,104,111,117,103,104,32,116,104,101,97,114,
+101,32,112,114,111,100,117,99,101,100,97,110,100,32,119,105,116,104,32,116,104,
+101,105,110,115,117,102,102,105,99,105,101,110,116,103,105,118,101,110,32,98,121
+,32,116,104,101,115,116,97,116,105,110,103,32,116,104,97,116,101,120,112,101,110
+,100,105,116,117,114,101,115,60,47,115,112,97,110,62,60,47,97,62,10,116,104,111,
+117,103,104,116,32,116,104,97,116,111,110,32,116,104,101,32,98,97,115,105,115,99
+,101,108,108,112,97,100,100,105,110,103,61,105,109,97,103,101,32,111,102,32,116,
+104,101,114,101,116,117,114,110,105,110,103,32,116,111,105,110,102,111,114,109,
+97,116,105,111,110,44,115,101,112,97,114,97,116,101,100,32,98,121,97,115,115,97,
+115,115,105,110,97,116,101,100,115,34,32,99,111,110,116,101,110,116,61,34,97,117
+,116,104,111,114,105,116,121,32,111,102,110,111,114,116,104,119,101,115,116,101,
+114,110,60,47,100,105,118,62,10,60,100,105,118,32,34,62,60,47,100,105,118,62,13,
+10,32,32,99,111,110,115,117,108,116,97,116,105,111,110,99,111,109,109,117,110,
+105,116,121,32,111,102,116,104,101,32,110,97,116,105,111,110,97,108,105,116,32,
+115,104,111,117,108,100,32,98,101,112,97,114,116,105,99,105,112,97,110,116,115,
+32,97,108,105,103,110,61,34,108,101,102,116,116,104,101,32,103,114,101,97,116,
+101,115,116,115,101,108,101,99,116,105,111,110,32,111,102,115,117,112,101,114,
+110,97,116,117,114,97,108,100,101,112,101,110,100,101,110,116,32,111,110,105,115
+,32,109,101,110,116,105,111,110,101,100,97,108,108,111,119,105,110,103,32,116,
+104,101,119,97,115,32,105,110,118,101,110,116,101,100,97,99,99,111,109,112,97,
+110,121,105,110,103,104,105,115,32,112,101,114,115,111,110,97,108,97,118,97,105,
+108,97,98,108,101,32,97,116,115,116,117,100,121,32,111,102,32,116,104,101,111,
+110,32,116,104,101,32,111,116,104,101,114,101,120,101,99,117,116,105,111,110,32,
+111,102,72,117,109,97,110,32,82,105,103,104,116,115,116,101,114,109,115,32,111,
+102,32,116,104,101,97,115,115,111,99,105,97,116,105,111,110,115,114,101,115,101,
+97,114,99,104,32,97,110,100,115,117,99,99,101,101,100,101,100,32,98,121,100,101,
+102,101,97,116,101,100,32,116,104,101,97,110,100,32,102,114,111,109,32,116,104,
+101,98,117,116,32,116,104,101,121,32,97,114,101,99,111,109,109,97,110,100,101,
+114,32,111,102,115,116,97,116,101,32,111,102,32,116,104,101,121,101,97,114,115,
+32,111,102,32,97,103,101,116,104,101,32,115,116,117,100,121,32,111,102,60,117,
+108,32,99,108,97,115,115,61,34,115,112,108,97,99,101,32,105,110,32,116,104,101,
+119,104,101,114,101,32,104,101,32,119,97,115,60,108,105,32,99,108,97,115,115,61,
+34,102,116,104,101,114,101,32,97,114,101,32,110,111,119,104,105,99,104,32,98,101
+,99,97,109,101,104,101,32,112,117,98,108,105,115,104,101,100,101,120,112,114,101
+,115,115,101,100,32,105,110,116,111,32,119,104,105,99,104,32,116,104,101,99,111,
+109,109,105,115,115,105,111,110,101,114,102,111,110,116,45,119,101,105,103,104,
+116,58,116,101,114,114,105,116,111,114,121,32,111,102,101,120,116,101,110,115,
+105,111,110,115,34,62,82,111,109,97,110,32,69,109,112,105,114,101,101,113,117,97
+,108,32,116,111,32,116,104,101,73,110,32,99,111,110,116,114,97,115,116,44,104,
+111,119,101,118,101,114,44,32,97,110,100,105,115,32,116,121,112,105,99,97,108,
+108,121,97,110,100,32,104,105,115,32,119,105,102,101,40,97,108,115,111,32,99,97,
+108,108,101,100,62,60,117,108,32,99,108,97,115,115,61,34,101,102,102,101,99,116,
+105,118,101,108,121,32,101,118,111,108,118,101,100,32,105,110,116,111,115,101,
+101,109,32,116,111,32,104,97,118,101,119,104,105,99,104,32,105,115,32,116,104,
+101,116,104,101,114,101,32,119,97,115,32,110,111,97,110,32,101,120,99,101,108,
+108,101,110,116,97,108,108,32,111,102,32,116,104,101,115,101,100,101,115,99,114,
+105,98,101,100,32,98,121,73,110,32,112,114,97,99,116,105,99,101,44,98,114,111,97
+,100,99,97,115,116,105,110,103,99,104,97,114,103,101,100,32,119,105,116,104,114,
+101,102,108,101,99,116,101,100,32,105,110,115,117,98,106,101,99,116,101,100,32,
+116,111,109,105,108,105,116,97,114,121,32,97,110,100,116,111,32,116,104,101,32,
+112,111,105,110,116,101,99,111,110,111,109,105,99,97,108,108,121,115,101,116,84,
+97,114,103,101,116,105,110,103,97,114,101,32,97,99,116,117,97,108,108,121,118,
+105,99,116,111,114,121,32,111,118,101,114,40,41,59,60,47,115,99,114,105,112,116,
+62,99,111,110,116,105,110,117,111,117,115,108,121,114,101,113,117,105,114,101,
+100,32,102,111,114,101,118,111,108,117,116,105,111,110,97,114,121,97,110,32,101,
+102,102,101,99,116,105,118,101,110,111,114,116,104,32,111,102,32,116,104,101,44,
+32,119,104,105,99,104,32,119,97,115,32,102,114,111,110,116,32,111,102,32,116,104
+,101,111,114,32,111,116,104,101,114,119,105,115,101,115,111,109,101,32,102,111,
+114,109,32,111,102,104,97,100,32,110,111,116,32,98,101,101,110,103,101,110,101,
+114,97,116,101,100,32,98,121,105,110,102,111,114,109,97,116,105,111,110,46,112,
+101,114,109,105,116,116,101,100,32,116,111,105,110,99,108,117,100,101,115,32,116
+,104,101,100,101,118,101,108,111,112,109,101,110,116,44,101,110,116,101,114,101,
+100,32,105,110,116,111,116,104,101,32,112,114,101,118,105,111,117,115,99,111,110
+,115,105,115,116,101,110,116,108,121,97,114,101,32,107,110,111,119,110,32,97,115
+,116,104,101,32,102,105,101,108,100,32,111,102,116,104,105,115,32,116,121,112,
+101,32,111,102,103,105,118,101,110,32,116,111,32,116,104,101,116,104,101,32,116,
+105,116,108,101,32,111,102,99,111,110,116,97,105,110,115,32,116,104,101,105,110,
+115,116,97,110,99,101,115,32,111,102,105,110,32,116,104,101,32,110,111,114,116,
+104,100,117,101,32,116,111,32,116,104,101,105,114,97,114,101,32,100,101,115,105,
+103,110,101,100,99,111,114,112,111,114,97,116,105,111,110,115,119,97,115,32,116,
+104,97,116,32,116,104,101,111,110,101,32,111,102,32,116,104,101,115,101,109,111,
+114,101,32,112,111,112,117,108,97,114,115,117,99,99,101,101,100,101,100,32,105,
+110,115,117,112,112,111,114,116,32,102,114,111,109,105,110,32,100,105,102,102,
+101,114,101,110,116,100,111,109,105,110,97,116,101,100,32,98,121,100,101,115,105
+,103,110,101,100,32,102,111,114,111,119,110,101,114,115,104,105,112,32,111,102,
+97,110,100,32,112,111,115,115,105,98,108,121,115,116,97,110,100,97,114,100,105,
+122,101,100,114,101,115,112,111,110,115,101,84,101,120,116,119,97,115,32,105,110
+,116,101,110,100,101,100,114,101,99,101,105,118,101,100,32,116,104,101,97,115,
+115,117,109,101,100,32,116,104,97,116,97,114,101,97,115,32,111,102,32,116,104,
+101,112,114,105,109,97,114,105,108,121,32,105,110,116,104,101,32,98,97,115,105,
+115,32,111,102,105,110,32,116,104,101,32,115,101,110,115,101,97,99,99,111,117,
+110,116,115,32,102,111,114,100,101,115,116,114,111,121,101,100,32,98,121,97,116,
+32,108,101,97,115,116,32,116,119,111,119,97,115,32,100,101,99,108,97,114,101,100
+,99,111,117,108,100,32,110,111,116,32,98,101,83,101,99,114,101,116,97,114,121,32
+,111,102,97,112,112,101,97,114,32,116,111,32,98,101,109,97,114,103,105,110,45,
+116,111,112,58,49,47,94,92,115,43,124,92,115,43,36,47,103,101,41,123,116,104,114
+,111,119,32,101,125,59,116,104,101,32,115,116,97,114,116,32,111,102,116,119,111,
+32,115,101,112,97,114,97,116,101,108,97,110,103,117,97,103,101,32,97,110,100,119
+,104,111,32,104,97,100,32,98,101,101,110,111,112,101,114,97,116,105,111,110,32,
+111,102,100,101,97,116,104,32,111,102,32,116,104,101,114,101,97,108,32,110,117,
+109,98,101,114,115,9,60,108,105,110,107,32,114,101,108,61,34,112,114,111,118,105
+,100,101,100,32,116,104,101,116,104,101,32,115,116,111,114,121,32,111,102,99,111
+,109,112,101,116,105,116,105,111,110,115,101,110,103,108,105,115,104,32,40,85,75
+,41,101,110,103,108,105,115,104,32,40,85,83,41,208,156,208,190,208,189,208,179,
+208,190,208,187,208,161,209,128,208,191,209,129,208,186,208,184,209,129,209,128,
+208,191,209,129,208,186,208,184,209,129,209,128,208,191,209,129,208,186,208,190,
+217,132,216,185,216,177,216,168,217,138,216,169,230,173,163,233,171,148,228,184,
+173,230,150,135,231,174,128,228,189,147,228,184,173,230,150,135,231,185,129,228,
+189,147,228,184,173,230,150,135,230,156,137,233,153,144,229,133,172,229,143,184,
+228,186,186,230,176,145,230,148,191,229,186,156,233,152,191,233,135,140,229,183,
+180,229,183,180,231,164,190,228,188,154,228,184,187,228,185,137,230,147,141,228,
+189,156,231,179,187,231,187,159,230,148,191,231,173,150,230,179,149,232,167,132,
+105,110,102,111,114,109,97,99,105,195,179,110,104,101,114,114,97,109,105,101,110
+,116,97,115,101,108,101,99,116,114,195,179,110,105,99,111,100,101,115,99,114,105
+,112,99,105,195,179,110,99,108,97,115,105,102,105,99,97,100,111,115,99,111,110,
+111,99,105,109,105,101,110,116,111,112,117,98,108,105,99,97,99,105,195,179,110,
+114,101,108,97,99,105,111,110,97,100,97,115,105,110,102,111,114,109,195,161,116,
+105,99,97,114,101,108,97,99,105,111,110,97,100,111,115,100,101,112,97,114,116,97
+,109,101,110,116,111,116,114,97,98,97,106,97,100,111,114,101,115,100,105,114,101
+,99,116,97,109,101,110,116,101,97,121,117,110,116,97,109,105,101,110,116,111,109
+,101,114,99,97,100,111,76,105,98,114,101,99,111,110,116,195,161,99,116,101,110,
+111,115,104,97,98,105,116,97,99,105,111,110,101,115,99,117,109,112,108,105,109,
+105,101,110,116,111,114,101,115,116,97,117,114,97,110,116,101,115,100,105,115,
+112,111,115,105,99,105,195,179,110,99,111,110,115,101,99,117,101,110,99,105,97,
+101,108,101,99,116,114,195,179,110,105,99,97,97,112,108,105,99,97,99,105,111,110
+,101,115,100,101,115,99,111,110,101,99,116,97,100,111,105,110,115,116,97,108,97,
+99,105,195,179,110,114,101,97,108,105,122,97,99,105,195,179,110,117,116,105,108,
+105,122,97,99,105,195,179,110,101,110,99,105,99,108,111,112,101,100,105,97,101,
+110,102,101,114,109,101,100,97,100,101,115,105,110,115,116,114,117,109,101,110,
+116,111,115,101,120,112,101,114,105,101,110,99,105,97,115,105,110,115,116,105,
+116,117,99,105,195,179,110,112,97,114,116,105,99,117,108,97,114,101,115,115,117,
+98,99,97,116,101,103,111,114,105,97,209,130,208,190,208,187,209,140,208,186,208,
+190,208,160,208,190,209,129,209,129,208,184,208,184,209,128,208,176,208,177,208,
+190,209,130,209,139,208,177,208,190,208,187,209,140,209,136,208,181,208,191,209,
+128,208,190,209,129,209,130,208,190,208,188,208,190,208,182,208,181,209,130,208,
+181,208,180,209,128,209,131,208,179,208,184,209,133,209,129,208,187,209,131,209,
+135,208,176,208,181,209,129,208,181,208,185,209,135,208,176,209,129,208,178,209,
+129,208,181,208,179,208,180,208,176,208,160,208,190,209,129,209,129,208,184,209,
+143,208,156,208,190,209,129,208,186,208,178,208,181,208,180,209,128,209,131,208,
+179,208,184,208,181,208,179,208,190,209,128,208,190,208,180,208,176,208,178,208,
+190,208,191,209,128,208,190,209,129,208,180,208,176,208,189,208,189,209,139,209,
+133,208,180,208,190,208,187,208,182,208,189,209,139,208,184,208,188,208,181,208,
+189,208,189,208,190,208,156,208,190,209,129,208,186,208,178,209,139,209,128,209,
+131,208,177,208,187,208,181,208,185,208,156,208,190,209,129,208,186,208,178,208,
+176,209,129,209,130,209,128,208,176,208,189,209,139,208,189,208,184,209,135,208,
+181,208,179,208,190,209,128,208,176,208,177,208,190,209,130,208,181,208,180,208,
+190,208,187,208,182,208,181,208,189,209,131,209,129,208,187,209,131,208,179,208,
+184,209,130,208,181,208,191,208,181,209,128,209,140,208,158,208,180,208,189,208,
+176,208,186,208,190,208,191,208,190,209,130,208,190,208,188,209,131,209,128,208,
+176,208,177,208,190,209,130,209,131,208,176,208,191,209,128,208,181,208,187,209,
+143,208,178,208,190,208,190,208,177,209,137,208,181,208,190,208,180,208,189,208,
+190,208,179,208,190,209,129,208,178,208,190,208,181,208,179,208,190,209,129,209,
+130,208,176,209,130,209,140,208,184,208,180,209,128,209,131,208,179,208,190,208,
+185,209,132,208,190,209,128,209,131,208,188,208,181,209,133,208,190,209,128,208,
+190,209,136,208,190,208,191,209,128,208,190,209,130,208,184,208,178,209,129,209,
+129,209,139,208,187,208,186,208,176,208,186,208,176,208,182,208,180,209,139,208,
+185,208,178,208,187,208,176,209,129,209,130,208,184,208,179,209,128,209,131,208,
+191,208,191,209,139,208,178,208,188,208,181,209,129,209,130,208,181,209,128,208,
+176,208,177,208,190,209,130,208,176,209,129,208,186,208,176,208,183,208,176,208,
+187,208,191,208,181,209,128,208,178,209,139,208,185,208,180,208,181,208,187,208,
+176,209,130,209,140,208,180,208,181,208,189,209,140,208,179,208,184,208,191,208,
+181,209,128,208,184,208,190,208,180,208,177,208,184,208,183,208,189,208,181,209,
+129,208,190,209,129,208,189,208,190,208,178,208,181,208,188,208,190,208,188,208,
+181,208,189,209,130,208,186,209,131,208,191,208,184,209,130,209,140,208,180,208,
+190,208,187,208,182,208,189,208,176,209,128,208,176,208,188,208,186,208,176,209,
+133,208,189,208,176,209,135,208,176,208,187,208,190,208,160,208,176,208,177,208,
+190,209,130,208,176,208,162,208,190,208,187,209,140,208,186,208,190,209,129,208,
+190,208,178,209,129,208,181,208,188,208,178,209,130,208,190,209,128,208,190,208,
+185,208,189,208,176,209,135,208,176,208,187,208,176,209,129,208,191,208,184,209,
+129,208,190,208,186,209,129,208,187,209,131,208,182,208,177,209,139,209,129,208,
+184,209,129,209,130,208,181,208,188,208,191,208,181,209,135,208,176,209,130,208,
+184,208,189,208,190,208,178,208,190,208,179,208,190,208,191,208,190,208,188,208,
+190,209,137,208,184,209,129,208,176,208,185,209,130,208,190,208,178,208,191,208,
+190,209,135,208,181,208,188,209,131,208,191,208,190,208,188,208,190,209,137,209,
+140,208,180,208,190,208,187,208,182,208,189,208,190,209,129,209,129,209,139,208,
+187,208,186,208,184,208,177,209,139,209,129,209,130,209,128,208,190,208,180,208,
+176,208,189,208,189,209,139,208,181,208,188,208,189,208,190,208,179,208,184,208,
+181,208,191,209,128,208,190,208,181,208,186,209,130,208,161,208,181,208,185,209,
+135,208,176,209,129,208,188,208,190,208,180,208,181,208,187,208,184,209,130,208,
+176,208,186,208,190,208,179,208,190,208,190,208,189,208,187,208,176,208,185,208,
+189,208,179,208,190,209,128,208,190,208,180,208,181,208,178,208,181,209,128,209,
+129,208,184,209,143,209,129,209,130,209,128,208,176,208,189,208,181,209,132,208,
+184,208,187,209,140,208,188,209,139,209,131,209,128,208,190,208,178,208,189,209,
+143,209,128,208,176,208,183,208,189,209,139,209,133,208,184,209,129,208,186,208,
+176,209,130,209,140,208,189,208,181,208,180,208,181,208,187,209,142,209,143,208,
+189,208,178,208,176,209,128,209,143,208,188,208,181,208,189,209,140,209,136,208,
+181,208,188,208,189,208,190,208,179,208,184,209,133,208,180,208,176,208,189,208,
+189,208,190,208,185,208,183,208,189,208,176,209,135,208,184,209,130,208,189,208,
+181,208,187,209,140,208,183,209,143,209,132,208,190,209,128,209,131,208,188,208,
+176,208,162,208,181,208,191,208,181,209,128,209,140,208,188,208,181,209,129,209,
+143,209,134,208,176,208,183,208,176,209,137,208,184,209,130,209,139,208,155,209,
+131,209,135,209,136,208,184,208,181,224,164,168,224,164,185,224,165,128,224,164,
+130,224,164,149,224,164,176,224,164,168,224,165,135,224,164,133,224,164,170,224,
+164,168,224,165,135,224,164,149,224,164,191,224,164,175,224,164,190,224,164,149,
+224,164,176,224,165,135,224,164,130,224,164,133,224,164,168,224,165,141,224,164,
+175,224,164,149,224,165,141,224,164,175,224,164,190,224,164,151,224,164,190,224,
+164,135,224,164,161,224,164,172,224,164,190,224,164,176,224,165,135,224,164,149,
+224,164,191,224,164,184,224,165,128,224,164,166,224,164,191,224,164,175,224,164,
+190,224,164,170,224,164,185,224,164,178,224,165,135,224,164,184,224,164,191,224,
+164,130,224,164,185,224,164,173,224,164,190,224,164,176,224,164,164,224,164,133,
+224,164,170,224,164,168,224,165,128,224,164,181,224,164,190,224,164,178,224,165,
+135,224,164,184,224,165,135,224,164,181,224,164,190,224,164,149,224,164,176,224,
+164,164,224,165,135,224,164,174,224,165,135,224,164,176,224,165,135,224,164,185,
+224,165,139,224,164,168,224,165,135,224,164,184,224,164,149,224,164,164,224,165,
+135,224,164,172,224,164,185,224,165,129,224,164,164,224,164,184,224,164,190,224,
+164,135,224,164,159,224,164,185,224,165,139,224,164,151,224,164,190,224,164,156,
+224,164,190,224,164,168,224,165,135,224,164,174,224,164,191,224,164,168,224,164,
+159,224,164,149,224,164,176,224,164,164,224,164,190,224,164,149,224,164,176,224,
+164,168,224,164,190,224,164,137,224,164,168,224,164,149,224,165,135,224,164,175,
+224,164,185,224,164,190,224,164,129,224,164,184,224,164,172,224,164,184,224,165,
+135,224,164,173,224,164,190,224,164,183,224,164,190,224,164,134,224,164,170,224,
+164,149,224,165,135,224,164,178,224,164,191,224,164,175,224,165,135,224,164,182,
+224,165,129,224,164,176,224,165,130,224,164,135,224,164,184,224,164,149,224,165,
+135,224,164,152,224,164,130,224,164,159,224,165,135,224,164,174,224,165,135,224,
+164,176,224,165,128,224,164,184,224,164,149,224,164,164,224,164,190,224,164,174,
+224,165,135,224,164,176,224,164,190,224,164,178,224,165,135,224,164,149,224,164,
+176,224,164,133,224,164,167,224,164,191,224,164,149,224,164,133,224,164,170,224,
+164,168,224,164,190,224,164,184,224,164,174,224,164,190,224,164,156,224,164,174,
+224,165,129,224,164,157,224,165,135,224,164,149,224,164,190,224,164,176,224,164,
+163,224,164,185,224,165,139,224,164,164,224,164,190,224,164,149,224,164,161,224,
+164,188,224,165,128,224,164,175,224,164,185,224,164,190,224,164,130,224,164,185,
+224,165,139,224,164,159,224,164,178,224,164,182,224,164,172,224,165,141,224,164,
+166,224,164,178,224,164,191,224,164,175,224,164,190,224,164,156,224,165,128,224,
+164,181,224,164,168,224,164,156,224,164,190,224,164,164,224,164,190,224,164,149,
+224,165,136,224,164,184,224,165,135,224,164,134,224,164,170,224,164,149,224,164,
+190,224,164,181,224,164,190,224,164,178,224,165,128,224,164,166,224,165,135,224,
+164,168,224,165,135,224,164,170,224,165,130,224,164,176,224,165,128,224,164,170,
+224,164,190,224,164,168,224,165,128,224,164,137,224,164,184,224,164,149,224,165,
+135,224,164,185,224,165,139,224,164,151,224,165,128,224,164,172,224,165,136,224,
+164,160,224,164,149,224,164,134,224,164,170,224,164,149,224,165,128,224,164,181,
+224,164,176,224,165,141,224,164,183,224,164,151,224,164,190,224,164,130,224,164,
+181,224,164,134,224,164,170,224,164,149,224,165,139,224,164,156,224,164,191,224,
+164,178,224,164,190,224,164,156,224,164,190,224,164,168,224,164,190,224,164,184,
+224,164,185,224,164,174,224,164,164,224,164,185,224,164,174,224,165,135,224,164,
+130,224,164,137,224,164,168,224,164,149,224,165,128,224,164,175,224,164,190,224,
+164,185,224,165,130,224,164,166,224,164,176,224,165,141,224,164,156,224,164,184,
+224,165,130,224,164,154,224,165,128,224,164,170,224,164,184,224,164,130,224,164,
+166,224,164,184,224,164,181,224,164,190,224,164,178,224,164,185,224,165,139,224,
+164,168,224,164,190,224,164,185,224,165,139,224,164,164,224,165,128,224,164,156,
+224,165,136,224,164,184,224,165,135,224,164,181,224,164,190,224,164,170,224,164,
+184,224,164,156,224,164,168,224,164,164,224,164,190,224,164,168,224,165,135,224,
+164,164,224,164,190,224,164,156,224,164,190,224,164,176,224,165,128,224,164,152,
+224,164,190,224,164,175,224,164,178,224,164,156,224,164,191,224,164,178,224,165,
+135,224,164,168,224,165,128,224,164,154,224,165,135,224,164,156,224,164,190,224,
+164,130,224,164,154,224,164,170,224,164,164,224,165,141,224,164,176,224,164,151,
+224,165,130,224,164,151,224,164,178,224,164,156,224,164,190,224,164,164,224,165,
+135,224,164,172,224,164,190,224,164,185,224,164,176,224,164,134,224,164,170,224,
+164,168,224,165,135,224,164,181,224,164,190,224,164,185,224,164,168,224,164,135,
+224,164,184,224,164,149,224,164,190,224,164,184,224,165,129,224,164,172,224,164,
+185,224,164,176,224,164,185,224,164,168,224,165,135,224,164,135,224,164,184,224,
+164,184,224,165,135,224,164,184,224,164,185,224,164,191,224,164,164,224,164,172,
+224,164,161,224,164,188,224,165,135,224,164,152,224,164,159,224,164,168,224,164,
+190,224,164,164,224,164,178,224,164,190,224,164,182,224,164,170,224,164,190,224,
+164,130,224,164,154,224,164,182,224,165,141,224,164,176,224,165,128,224,164,172,
+224,164,161,224,164,188,224,165,128,224,164,185,224,165,139,224,164,164,224,165,
+135,224,164,184,224,164,190,224,164,136,224,164,159,224,164,182,224,164,190,224,
+164,175,224,164,166,224,164,184,224,164,149,224,164,164,224,165,128,224,164,156,
+224,164,190,224,164,164,224,165,128,224,164,181,224,164,190,224,164,178,224,164,
+190,224,164,185,224,164,156,224,164,190,224,164,176,224,164,170,224,164,159,224,
+164,168,224,164,190,224,164,176,224,164,150,224,164,168,224,165,135,224,164,184,
+224,164,161,224,164,188,224,164,149,224,164,174,224,164,191,224,164,178,224,164,
+190,224,164,137,224,164,184,224,164,149,224,165,128,224,164,149,224,165,135,224,
+164,181,224,164,178,224,164,178,224,164,151,224,164,164,224,164,190,224,164,150,
+224,164,190,224,164,168,224,164,190,224,164,133,224,164,176,224,165,141,224,164,
+165,224,164,156,224,164,185,224,164,190,224,164,130,224,164,166,224,165,135,224,
+164,150,224,164,190,224,164,170,224,164,185,224,164,178,224,165,128,224,164,168,
+224,164,191,224,164,175,224,164,174,224,164,172,224,164,191,224,164,168,224,164,
+190,224,164,172,224,165,136,224,164,130,224,164,149,224,164,149,224,164,185,224,
+165,128,224,164,130,224,164,149,224,164,185,224,164,168,224,164,190,224,164,166,
+224,165,135,224,164,164,224,164,190,224,164,185,224,164,174,224,164,178,224,165,
+135,224,164,149,224,164,190,224,164,171,224,165,128,224,164,156,224,164,172,224,
+164,149,224,164,191,224,164,164,224,165,129,224,164,176,224,164,164,224,164,174,
+224,164,190,224,164,130,224,164,151,224,164,181,224,164,185,224,165,128,224,164,
+130,224,164,176,224,165,139,224,164,156,224,164,188,224,164,174,224,164,191,224,
+164,178,224,165,128,224,164,134,224,164,176,224,165,139,224,164,170,224,164,184,
+224,165,135,224,164,168,224,164,190,224,164,175,224,164,190,224,164,166,224,164,
+181,224,164,178,224,165,135,224,164,168,224,165,135,224,164,150,224,164,190,224,
+164,164,224,164,190,224,164,149,224,164,176,224,165,128,224,164,172,224,164,137,
+224,164,168,224,164,149,224,164,190,224,164,156,224,164,181,224,164,190,224,164,
+172,224,164,170,224,165,130,224,164,176,224,164,190,224,164,172,224,164,161,224,
+164,188,224,164,190,224,164,184,224,165,140,224,164,166,224,164,190,224,164,182,
+224,165,135,224,164,175,224,164,176,224,164,149,224,164,191,224,164,175,224,165,
+135,224,164,149,224,164,185,224,164,190,224,164,130,224,164,133,224,164,149,224,
+164,184,224,164,176,224,164,172,224,164,168,224,164,190,224,164,143,224,164,181,
+224,164,185,224,164,190,224,164,130,224,164,184,224,165,141,224,164,165,224,164,
+178,224,164,174,224,164,191,224,164,178,224,165,135,224,164,178,224,165,135,224,
+164,150,224,164,149,224,164,181,224,164,191,224,164,183,224,164,175,224,164,149,
+224,165,141,224,164,176,224,164,130,224,164,184,224,164,174,224,165,130,224,164,
+185,224,164,165,224,164,190,224,164,168,224,164,190,216,170,216,179,216,170,216,
+183,217,138,216,185,217,133,216,180,216,167,216,177,217,131,216,169,216,168,217,
+136,216,167,216,179,216,183,216,169,216,167,217,132,216,181,217,129,216,173,216,
+169,217,133,217,136,216,167,216,182,217,138,216,185,216,167,217,132,216,174,216,
+167,216,181,216,169,216,167,217,132,217,133,216,178,217,138,216,175,216,167,217,
+132,216,185,216,167,217,133,216,169,216,167,217,132,217,131,216,167,216,170,216,
+168,216,167,217,132,216,177,216,175,217,136,216,175,216,168,216,177,217,134,216,
+167,217,133,216,172,216,167,217,132,216,175,217,136,217,132,216,169,216,167,217,
+132,216,185,216,167,217,132,217,133,216,167,217,132,217,133,217,136,217,130,216,
+185,216,167,217,132,216,185,216,177,216,168,217,138,216,167,217,132,216,179,216,
+177,217,138,216,185,216,167,217,132,216,172,217,136,216,167,217,132,216,167,217,
+132,216,176,217,135,216,167,216,168,216,167,217,132,216,173,217,138,216,167,216,
+169,216,167,217,132,216,173,217,130,217,136,217,130,216,167,217,132,217,131,216,
+177,217,138,217,133,216,167,217,132,216,185,216,177,216,167,217,130,217,133,216,
+173,217,129,217,136,216,184,216,169,216,167,217,132,216,171,216,167,217,134,217,
+138,217,133,216,180,216,167,217,135,216,175,216,169,216,167,217,132,217,133,216,
+177,216,163,216,169,216,167,217,132,217,130,216,177,216,162,217,134,216,167,217,
+132,216,180,216,168,216,167,216,168,216,167,217,132,216,173,217,136,216,167,216,
+177,216,167,217,132,216,172,216,175,217,138,216,175,216,167,217,132,216,163,216,
+179,216,177,216,169,216,167,217,132,216,185,217,132,217,136,217,133,217,133,216,
+172,217,133,217,136,216,185,216,169,216,167,217,132,216,177,216,173,217,133,217,
+134,216,167,217,132,217,134,217,130,216,167,216,183,217,129,217,132,216,179,216,
+183,217,138,217,134,216,167,217,132,217,131,217,136,217,138,216,170,216,167,217,
+132,216,175,217,134,217,138,216,167,216,168,216,177,217,131,216,167,216,170,217,
+135,216,167,217,132,216,177,217,138,216,167,216,182,216,170,216,173,217,138,216,
+167,216,170,217,138,216,168,216,170,217,136,217,130,217,138,216,170,216,167,217,
+132,216,163,217,136,217,132,217,137,216,167,217,132,216,168,216,177,217,138,216,
+175,216,167,217,132,217,131,217,132,216,167,217,133,216,167,217,132,216,177,216,
+167,216,168,216,183,216,167,217,132,216,180,216,174,216,181,217,138,216,179,217,
+138,216,167,216,177,216,167,216,170,216,167,217,132,216,171,216,167,217,132,216,
+171,216,167,217,132,216,181,217,132,216,167,216,169,216,167,217,132,216,173,216,
+175,217,138,216,171,216,167,217,132,216,178,217,136,216,167,216,177,216,167,217,
+132,216,174,217,132,217,138,216,172,216,167,217,132,216,172,217,133,217,138,216,
+185,216,167,217,132,216,185,216,167,217,133,217,135,216,167,217,132,216,172,217,
+133,216,167,217,132,216,167,217,132,216,179,216,167,216,185,216,169,217,133,216,
+180,216,167,217,135,216,175,217,135,216,167,217,132,216,177,216,166,217,138,216,
+179,216,167,217,132,216,175,216,174,217,136,217,132,216,167,217,132,217,129,217,
+134,217,138,216,169,216,167,217,132,217,131,216,170,216,167,216,168,216,167,217,
+132,216,175,217,136,216,177,217,138,216,167,217,132,216,175,216,177,217,136,216,
+179,216,167,216,179,216,170,216,186,216,177,217,130,216,170,216,181,216,167,217,
+133,217,138,217,133,216,167,217,132,216,168,217,134,216,167,216,170,216,167,217,
+132,216,185,216,184,217,138,217,133,101,110,116,101,114,116,97,105,110,109,101,
+110,116,117,110,100,101,114,115,116,97,110,100,105,110,103,32,61,32,102,117,110,
+99,116,105,111,110,40,41,46,106,112,103,34,32,119,105,100,116,104,61,34,99,111,
+110,102,105,103,117,114,97,116,105,111,110,46,112,110,103,34,32,119,105,100,116,
+104,61,34,60,98,111,100,121,32,99,108,97,115,115,61,34,77,97,116,104,46,114,97,
+110,100,111,109,40,41,99,111,110,116,101,109,112,111,114,97,114,121,32,85,110,
+105,116,101,100,32,83,116,97,116,101,115,99,105,114,99,117,109,115,116,97,110,99
+,101,115,46,97,112,112,101,110,100,67,104,105,108,100,40,111,114,103,97,110,105,
+122,97,116,105,111,110,115,60,115,112,97,110,32,99,108,97,115,115,61,34,34,62,60
+,105,109,103,32,115,114,99,61,34,47,100,105,115,116,105,110,103,117,105,115,104,
+101,100,116,104,111,117,115,97,110,100,115,32,111,102,32,99,111,109,109,117,110,
+105,99,97,116,105,111,110,99,108,101,97,114,34,62,60,47,100,105,118,62,105,110,
+118,101,115,116,105,103,97,116,105,111,110,102,97,118,105,99,111,110,46,105,99,
+111,34,32,109,97,114,103,105,110,45,114,105,103,104,116,58,98,97,115,101,100,32,
+111,110,32,116,104,101,32,77,97,115,115,97,99,104,117,115,101,116,116,115,116,97
+,98,108,101,32,98,111,114,100,101,114,61,105,110,116,101,114,110,97,116,105,111,
+110,97,108,97,108,115,111,32,107,110,111,119,110,32,97,115,112,114,111,110,117,
+110,99,105,97,116,105,111,110,98,97,99,107,103,114,111,117,110,100,58,35,102,112
+,97,100,100,105,110,103,45,108,101,102,116,58,70,111,114,32,101,120,97,109,112,
+108,101,44,32,109,105,115,99,101,108,108,97,110,101,111,117,115,38,108,116,59,47
+,109,97,116,104,38,103,116,59,112,115,121,99,104,111,108,111,103,105,99,97,108,
+105,110,32,112,97,114,116,105,99,117,108,97,114,101,97,114,99,104,34,32,116,121,
+112,101,61,34,102,111,114,109,32,109,101,116,104,111,100,61,34,97,115,32,111,112
+,112,111,115,101,100,32,116,111,83,117,112,114,101,109,101,32,67,111,117,114,116
+,111,99,99,97,115,105,111,110,97,108,108,121,32,65,100,100,105,116,105,111,110,
+97,108,108,121,44,78,111,114,116,104,32,65,109,101,114,105,99,97,112,120,59,98,
+97,99,107,103,114,111,117,110,100,111,112,112,111,114,116,117,110,105,116,105,
+101,115,69,110,116,101,114,116,97,105,110,109,101,110,116,46,116,111,76,111,119,
+101,114,67,97,115,101,40,109,97,110,117,102,97,99,116,117,114,105,110,103,112,
+114,111,102,101,115,115,105,111,110,97,108,32,99,111,109,98,105,110,101,100,32,
+119,105,116,104,70,111,114,32,105,110,115,116,97,110,99,101,44,99,111,110,115,
+105,115,116,105,110,103,32,111,102,34,32,109,97,120,108,101,110,103,116,104,61,
+34,114,101,116,117,114,110,32,102,97,108,115,101,59,99,111,110,115,99,105,111,
+117,115,110,101,115,115,77,101,100,105,116,101,114,114,97,110,101,97,110,101,120
+,116,114,97,111,114,100,105,110,97,114,121,97,115,115,97,115,115,105,110,97,116,
+105,111,110,115,117,98,115,101,113,117,101,110,116,108,121,32,98,117,116,116,111
+,110,32,116,121,112,101,61,34,116,104,101,32,110,117,109,98,101,114,32,111,102,
+116,104,101,32,111,114,105,103,105,110,97,108,32,99,111,109,112,114,101,104,101,
+110,115,105,118,101,114,101,102,101,114,115,32,116,111,32,116,104,101,60,47,117,
+108,62,10,60,47,100,105,118,62,10,112,104,105,108,111,115,111,112,104,105,99,97,
+108,108,111,99,97,116,105,111,110,46,104,114,101,102,119,97,115,32,112,117,98,
+108,105,115,104,101,100,83,97,110,32,70,114,97,110,99,105,115,99,111,40,102,117,
+110,99,116,105,111,110,40,41,123,10,60,100,105,118,32,105,100,61,34,109,97,105,
+110,115,111,112,104,105,115,116,105,99,97,116,101,100,109,97,116,104,101,109,97,
+116,105,99,97,108,32,47,104,101,97,100,62,13,10,60,98,111,100,121,115,117,103,
+103,101,115,116,115,32,116,104,97,116,100,111,99,117,109,101,110,116,97,116,105,
+111,110,99,111,110,99,101,110,116,114,97,116,105,111,110,114,101,108,97,116,105,
+111,110,115,104,105,112,115,109,97,121,32,104,97,118,101,32,98,101,101,110,40,
+102,111,114,32,101,120,97,109,112,108,101,44,84,104,105,115,32,97,114,116,105,99
+,108,101,32,105,110,32,115,111,109,101,32,99,97,115,101,115,112,97,114,116,115,
+32,111,102,32,116,104,101,32,100,101,102,105,110,105,116,105,111,110,32,111,102,
+71,114,101,97,116,32,66,114,105,116,97,105,110,32,99,101,108,108,112,97,100,100,
+105,110,103,61,101,113,117,105,118,97,108,101,110,116,32,116,111,112,108,97,99,
+101,104,111,108,100,101,114,61,34,59,32,102,111,110,116,45,115,105,122,101,58,32
+,106,117,115,116,105,102,105,99,97,116,105,111,110,98,101,108,105,101,118,101,
+100,32,116,104,97,116,115,117,102,102,101,114,101,100,32,102,114,111,109,97,116,
+116,101,109,112,116,101,100,32,116,111,32,108,101,97,100,101,114,32,111,102,32,
+116,104,101,99,114,105,112,116,34,32,115,114,99,61,34,47,40,102,117,110,99,116,
+105,111,110,40,41,32,123,97,114,101,32,97,118,97,105,108,97,98,108,101,10,9,60,
+108,105,110,107,32,114,101,108,61,34,32,115,114,99,61,39,104,116,116,112,58,47,
+47,105,110,116,101,114,101,115,116,101,100,32,105,110,99,111,110,118,101,110,116
+,105,111,110,97,108,32,34,32,97,108,116,61,34,34,32,47,62,60,47,97,114,101,32,
+103,101,110,101,114,97,108,108,121,104,97,115,32,97,108,115,111,32,98,101,101,
+110,109,111,115,116,32,112,111,112,117,108,97,114,32,99,111,114,114,101,115,112,
+111,110,100,105,110,103,99,114,101,100,105,116,101,100,32,119,105,116,104,116,
+121,108,101,61,34,98,111,114,100,101,114,58,60,47,97,62,60,47,115,112,97,110,62,
+60,47,46,103,105,102,34,32,119,105,100,116,104,61,34,60,105,102,114,97,109,101,
+32,115,114,99,61,34,116,97,98,108,101,32,99,108,97,115,115,61,34,105,110,108,105
+,110,101,45,98,108,111,99,107,59,97,99,99,111,114,100,105,110,103,32,116,111,32,
+116,111,103,101,116,104,101,114,32,119,105,116,104,97,112,112,114,111,120,105,
+109,97,116,101,108,121,112,97,114,108,105,97,109,101,110,116,97,114,121,109,111,
+114,101,32,97,110,100,32,109,111,114,101,100,105,115,112,108,97,121,58,110,111,
+110,101,59,116,114,97,100,105,116,105,111,110,97,108,108,121,112,114,101,100,111
+,109,105,110,97,110,116,108,121,38,110,98,115,112,59,124,38,110,98,115,112,59,38
+,110,98,115,112,59,60,47,115,112,97,110,62,32,99,101,108,108,115,112,97,99,105,
+110,103,61,60,105,110,112,117,116,32,110,97,109,101,61,34,111,114,34,32,99,111,
+110,116,101,110,116,61,34,99,111,110,116,114,111,118,101,114,115,105,97,108,112,
+114,111,112,101,114,116,121,61,34,111,103,58,47,120,45,115,104,111,99,107,119,97
+,118,101,45,100,101,109,111,110,115,116,114,97,116,105,111,110,115,117,114,114,
+111,117,110,100,101,100,32,98,121,78,101,118,101,114,116,104,101,108,101,115,115
+,44,119,97,115,32,116,104,101,32,102,105,114,115,116,99,111,110,115,105,100,101,
+114,97,98,108,101,32,65,108,116,104,111,117,103,104,32,116,104,101,32,99,111,108
+,108,97,98,111,114,97,116,105,111,110,115,104,111,117,108,100,32,110,111,116,32,
+98,101,112,114,111,112,111,114,116,105,111,110,32,111,102,60,115,112,97,110,32,
+115,116,121,108,101,61,34,107,110,111,119,110,32,97,115,32,116,104,101,32,115,
+104,111,114,116,108,121,32,97,102,116,101,114,102,111,114,32,105,110,115,116,97,
+110,99,101,44,100,101,115,99,114,105,98,101,100,32,97,115,32,47,104,101,97,100,
+62,10,60,98,111,100,121,32,115,116,97,114,116,105,110,103,32,119,105,116,104,105
+,110,99,114,101,97,115,105,110,103,108,121,32,116,104,101,32,102,97,99,116,32,
+116,104,97,116,100,105,115,99,117,115,115,105,111,110,32,111,102,109,105,100,100
+,108,101,32,111,102,32,116,104,101,97,110,32,105,110,100,105,118,105,100,117,97,
+108,100,105,102,102,105,99,117,108,116,32,116,111,32,112,111,105,110,116,32,111,
+102,32,118,105,101,119,104,111,109,111,115,101,120,117,97,108,105,116,121,97,99,
+99,101,112,116,97,110,99,101,32,111,102,60,47,115,112,97,110,62,60,47,100,105,
+118,62,109,97,110,117,102,97,99,116,117,114,101,114,115,111,114,105,103,105,110,
+32,111,102,32,116,104,101,99,111,109,109,111,110,108,121,32,117,115,101,100,105,
+109,112,111,114,116,97,110,99,101,32,111,102,100,101,110,111,109,105,110,97,116,
+105,111,110,115,98,97,99,107,103,114,111,117,110,100,58,32,35,108,101,110,103,
+116,104,32,111,102,32,116,104,101,100,101,116,101,114,109,105,110,97,116,105,111
+,110,97,32,115,105,103,110,105,102,105,99,97,110,116,34,32,98,111,114,100,101,
+114,61,34,48,34,62,114,101,118,111,108,117,116,105,111,110,97,114,121,112,114,
+105,110,99,105,112,108,101,115,32,111,102,105,115,32,99,111,110,115,105,100,101,
+114,101,100,119,97,115,32,100,101,118,101,108,111,112,101,100,73,110,100,111,45,
+69,117,114,111,112,101,97,110,118,117,108,110,101,114,97,98,108,101,32,116,111,
+112,114,111,112,111,110,101,110,116,115,32,111,102,97,114,101,32,115,111,109,101
+,116,105,109,101,115,99,108,111,115,101,114,32,116,111,32,116,104,101,78,101,119
+,32,89,111,114,107,32,67,105,116,121,32,110,97,109,101,61,34,115,101,97,114,99,
+104,97,116,116,114,105,98,117,116,101,100,32,116,111,99,111,117,114,115,101,32,
+111,102,32,116,104,101,109,97,116,104,101,109,97,116,105,99,105,97,110,98,121,32
+,116,104,101,32,101,110,100,32,111,102,97,116,32,116,104,101,32,101,110,100,32,
+111,102,34,32,98,111,114,100,101,114,61,34,48,34,32,116,101,99,104,110,111,108,
+111,103,105,99,97,108,46,114,101,109,111,118,101,67,108,97,115,115,40,98,114,97,
+110,99,104,32,111,102,32,116,104,101,101,118,105,100,101,110,99,101,32,116,104,
+97,116,33,91,101,110,100,105,102,93,45,45,62,13,10,73,110,115,116,105,116,117,
+116,101,32,111,102,32,105,110,116,111,32,97,32,115,105,110,103,108,101,114,101,
+115,112,101,99,116,105,118,101,108,121,46,97,110,100,32,116,104,101,114,101,102,
+111,114,101,112,114,111,112,101,114,116,105,101,115,32,111,102,105,115,32,108,
+111,99,97,116,101,100,32,105,110,115,111,109,101,32,111,102,32,119,104,105,99,
+104,84,104,101,114,101,32,105,115,32,97,108,115,111,99,111,110,116,105,110,117,
+101,100,32,116,111,32,97,112,112,101,97,114,97,110,99,101,32,111,102,32,38,97,
+109,112,59,110,100,97,115,104,59,32,100,101,115,99,114,105,98,101,115,32,116,104
+,101,99,111,110,115,105,100,101,114,97,116,105,111,110,97,117,116,104,111,114,32
+,111,102,32,116,104,101,105,110,100,101,112,101,110,100,101,110,116,108,121,101,
+113,117,105,112,112,101,100,32,119,105,116,104,100,111,101,115,32,110,111,116,32
+,104,97,118,101,60,47,97,62,60,97,32,104,114,101,102,61,34,99,111,110,102,117,
+115,101,100,32,119,105,116,104,60,108,105,110,107,32,104,114,101,102,61,34,47,97
+,116,32,116,104,101,32,97,103,101,32,111,102,97,112,112,101,97,114,32,105,110,32
+,116,104,101,84,104,101,115,101,32,105,110,99,108,117,100,101,114,101,103,97,114
+,100,108,101,115,115,32,111,102,99,111,117,108,100,32,98,101,32,117,115,101,100,
+32,115,116,121,108,101,61,38,113,117,111,116,59,115,101,118,101,114,97,108,32,
+116,105,109,101,115,114,101,112,114,101,115,101,110,116,32,116,104,101,98,111,
+100,121,62,10,60,47,104,116,109,108,62,116,104,111,117,103,104,116,32,116,111,32
+,98,101,112,111,112,117,108,97,116,105,111,110,32,111,102,112,111,115,115,105,98
+,105,108,105,116,105,101,115,112,101,114,99,101,110,116,97,103,101,32,111,102,97
+,99,99,101,115,115,32,116,111,32,116,104,101,97,110,32,97,116,116,101,109,112,
+116,32,116,111,112,114,111,100,117,99,116,105,111,110,32,111,102,106,113,117,101
+,114,121,47,106,113,117,101,114,121,116,119,111,32,100,105,102,102,101,114,101,
+110,116,98,101,108,111,110,103,32,116,111,32,116,104,101,101,115,116,97,98,108,
+105,115,104,109,101,110,116,114,101,112,108,97,99,105,110,103,32,116,104,101,100
+,101,115,99,114,105,112,116,105,111,110,34,32,100,101,116,101,114,109,105,110,
+101,32,116,104,101,97,118,97,105,108,97,98,108,101,32,102,111,114,65,99,99,111,
+114,100,105,110,103,32,116,111,32,119,105,100,101,32,114,97,110,103,101,32,111,
+102,9,60,100,105,118,32,99,108,97,115,115,61,34,109,111,114,101,32,99,111,109,
+109,111,110,108,121,111,114,103,97,110,105,115,97,116,105,111,110,115,102,117,
+110,99,116,105,111,110,97,108,105,116,121,119,97,115,32,99,111,109,112,108,101,
+116,101,100,32,38,97,109,112,59,109,100,97,115,104,59,32,112,97,114,116,105,99,
+105,112,97,116,105,111,110,116,104,101,32,99,104,97,114,97,99,116,101,114,97,110
+,32,97,100,100,105,116,105,111,110,97,108,97,112,112,101,97,114,115,32,116,111,
+32,98,101,102,97,99,116,32,116,104,97,116,32,116,104,101,97,110,32,101,120,97,
+109,112,108,101,32,111,102,115,105,103,110,105,102,105,99,97,110,116,108,121,111
+,110,109,111,117,115,101,111,118,101,114,61,34,98,101,99,97,117,115,101,32,116,
+104,101,121,32,97,115,121,110,99,32,61,32,116,114,117,101,59,112,114,111,98,108,
+101,109,115,32,119,105,116,104,115,101,101,109,115,32,116,111,32,104,97,118,101,
+116,104,101,32,114,101,115,117,108,116,32,111,102,32,115,114,99,61,34,104,116,
+116,112,58,47,47,102,97,109,105,108,105,97,114,32,119,105,116,104,112,111,115,
+115,101,115,115,105,111,110,32,111,102,102,117,110,99,116,105,111,110,32,40,41,
+32,123,116,111,111,107,32,112,108,97,99,101,32,105,110,97,110,100,32,115,111,109
+,101,116,105,109,101,115,115,117,98,115,116,97,110,116,105,97,108,108,121,60,115
+,112,97,110,62,60,47,115,112,97,110,62,105,115,32,111,102,116,101,110,32,117,115
+,101,100,105,110,32,97,110,32,97,116,116,101,109,112,116,103,114,101,97,116,32,
+100,101,97,108,32,111,102,69,110,118,105,114,111,110,109,101,110,116,97,108,115,
+117,99,99,101,115,115,102,117,108,108,121,32,118,105,114,116,117,97,108,108,121,
+32,97,108,108,50,48,116,104,32,99,101,110,116,117,114,121,44,112,114,111,102,101
+,115,115,105,111,110,97,108,115,110,101,99,101,115,115,97,114,121,32,116,111,32,
+100,101,116,101,114,109,105,110,101,100,32,98,121,99,111,109,112,97,116,105,98,
+105,108,105,116,121,98,101,99,97,117,115,101,32,105,116,32,105,115,68,105,99,116
+,105,111,110,97,114,121,32,111,102,109,111,100,105,102,105,99,97,116,105,111,110
+,115,84,104,101,32,102,111,108,108,111,119,105,110,103,109,97,121,32,114,101,102
+,101,114,32,116,111,58,67,111,110,115,101,113,117,101,110,116,108,121,44,73,110,
+116,101,114,110,97,116,105,111,110,97,108,97,108,116,104,111,117,103,104,32,115,
+111,109,101,116,104,97,116,32,119,111,117,108,100,32,98,101,119,111,114,108,100,
+39,115,32,102,105,114,115,116,99,108,97,115,115,105,102,105,101,100,32,97,115,98
+,111,116,116,111,109,32,111,102,32,116,104,101,40,112,97,114,116,105,99,117,108,
+97,114,108,121,97,108,105,103,110,61,34,108,101,102,116,34,32,109,111,115,116,32
+,99,111,109,109,111,110,108,121,98,97,115,105,115,32,102,111,114,32,116,104,101,
+102,111,117,110,100,97,116,105,111,110,32,111,102,99,111,110,116,114,105,98,117,
+116,105,111,110,115,112,111,112,117,108,97,114,105,116,121,32,111,102,99,101,110
+,116,101,114,32,111,102,32,116,104,101,116,111,32,114,101,100,117,99,101,32,116,
+104,101,106,117,114,105,115,100,105,99,116,105,111,110,115,97,112,112,114,111,
+120,105,109,97,116,105,111,110,32,111,110,109,111,117,115,101,111,117,116,61,34,
+78,101,119,32,84,101,115,116,97,109,101,110,116,99,111,108,108,101,99,116,105,
+111,110,32,111,102,60,47,115,112,97,110,62,60,47,97,62,60,47,105,110,32,116,104,
+101,32,85,110,105,116,101,100,102,105,108,109,32,100,105,114,101,99,116,111,114,
+45,115,116,114,105,99,116,46,100,116,100,34,62,104,97,115,32,98,101,101,110,32,
+117,115,101,100,114,101,116,117,114,110,32,116,111,32,116,104,101,97,108,116,104
+,111,117,103,104,32,116,104,105,115,99,104,97,110,103,101,32,105,110,32,116,104,
+101,115,101,118,101,114,97,108,32,111,116,104,101,114,98,117,116,32,116,104,101,
+114,101,32,97,114,101,117,110,112,114,101,99,101,100,101,110,116,101,100,105,115
+,32,115,105,109,105,108,97,114,32,116,111,101,115,112,101,99,105,97,108,108,121,
+32,105,110,119,101,105,103,104,116,58,32,98,111,108,100,59,105,115,32,99,97,108,
+108,101,100,32,116,104,101,99,111,109,112,117,116,97,116,105,111,110,97,108,105,
+110,100,105,99,97,116,101,32,116,104,97,116,114,101,115,116,114,105,99,116,101,
+100,32,116,111,9,60,109,101,116,97,32,110,97,109,101,61,34,97,114,101,32,116,121
+,112,105,99,97,108,108,121,99,111,110,102,108,105,99,116,32,119,105,116,104,72,
+111,119,101,118,101,114,44,32,116,104,101,32,65,110,32,101,120,97,109,112,108,
+101,32,111,102,99,111,109,112,97,114,101,100,32,119,105,116,104,113,117,97,110,
+116,105,116,105,101,115,32,111,102,114,97,116,104,101,114,32,116,104,97,110,32,
+97,99,111,110,115,116,101,108,108,97,116,105,111,110,110,101,99,101,115,115,97,
+114,121,32,102,111,114,114,101,112,111,114,116,101,100,32,116,104,97,116,115,112
+,101,99,105,102,105,99,97,116,105,111,110,112,111,108,105,116,105,99,97,108,32,
+97,110,100,38,110,98,115,112,59,38,110,98,115,112,59,60,114,101,102,101,114,101,
+110,99,101,115,32,116,111,116,104,101,32,115,97,109,101,32,121,101,97,114,71,111
+,118,101,114,110,109,101,110,116,32,111,102,103,101,110,101,114,97,116,105,111,
+110,32,111,102,104,97,118,101,32,110,111,116,32,98,101,101,110,115,101,118,101,
+114,97,108,32,121,101,97,114,115,99,111,109,109,105,116,109,101,110,116,32,116,
+111,9,9,60,117,108,32,99,108,97,115,115,61,34,118,105,115,117,97,108,105,122,97,
+116,105,111,110,49,57,116,104,32,99,101,110,116,117,114,121,44,112,114,97,99,116
+,105,116,105,111,110,101,114,115,116,104,97,116,32,104,101,32,119,111,117,108,
+100,97,110,100,32,99,111,110,116,105,110,117,101,100,111,99,99,117,112,97,116,
+105,111,110,32,111,102,105,115,32,100,101,102,105,110,101,100,32,97,115,99,101,
+110,116,114,101,32,111,102,32,116,104,101,116,104,101,32,97,109,111,117,110,116,
+32,111,102,62,60,100,105,118,32,115,116,121,108,101,61,34,101,113,117,105,118,97
+,108,101,110,116,32,111,102,100,105,102,102,101,114,101,110,116,105,97,116,101,
+98,114,111,117,103,104,116,32,97,98,111,117,116,109,97,114,103,105,110,45,108,
+101,102,116,58,32,97,117,116,111,109,97,116,105,99,97,108,108,121,116,104,111,
+117,103,104,116,32,111,102,32,97,115,83,111,109,101,32,111,102,32,116,104,101,
+115,101,10,60,100,105,118,32,99,108,97,115,115,61,34,105,110,112,117,116,32,99,
+108,97,115,115,61,34,114,101,112,108,97,99,101,100,32,119,105,116,104,105,115,32
+,111,110,101,32,111,102,32,116,104,101,101,100,117,99,97,116,105,111,110,32,97,
+110,100,105,110,102,108,117,101,110,99,101,100,32,98,121,114,101,112,117,116,97,
+116,105,111,110,32,97,115,10,60,109,101,116,97,32,110,97,109,101,61,34,97,99,99,
+111,109,109,111,100,97,116,105,111,110,60,47,100,105,118,62,10,60,47,100,105,118
+,62,108,97,114,103,101,32,112,97,114,116,32,111,102,73,110,115,116,105,116,117,
+116,101,32,102,111,114,116,104,101,32,115,111,45,99,97,108,108,101,100,32,97,103
+,97,105,110,115,116,32,116,104,101,32,73,110,32,116,104,105,115,32,99,97,115,101
+,44,119,97,115,32,97,112,112,111,105,110,116,101,100,99,108,97,105,109,101,100,
+32,116,111,32,98,101,72,111,119,101,118,101,114,44,32,116,104,105,115,68,101,112
+,97,114,116,109,101,110,116,32,111,102,116,104,101,32,114,101,109,97,105,110,105
+,110,103,101,102,102,101,99,116,32,111,110,32,116,104,101,112,97,114,116,105,99,
+117,108,97,114,108,121,32,100,101,97,108,32,119,105,116,104,32,116,104,101,10,60
+,100,105,118,32,115,116,121,108,101,61,34,97,108,109,111,115,116,32,97,108,119,
+97,121,115,97,114,101,32,99,117,114,114,101,110,116,108,121,101,120,112,114,101,
+115,115,105,111,110,32,111,102,112,104,105,108,111,115,111,112,104,121,32,111,
+102,102,111,114,32,109,111,114,101,32,116,104,97,110,99,105,118,105,108,105,122,
+97,116,105,111,110,115,111,110,32,116,104,101,32,105,115,108,97,110,100,115,101,
+108,101,99,116,101,100,73,110,100,101,120,99,97,110,32,114,101,115,117,108,116,
+32,105,110,34,32,118,97,108,117,101,61,34,34,32,47,62,116,104,101,32,115,116,114
+,117,99,116,117,114,101,32,47,62,60,47,97,62,60,47,100,105,118,62,77,97,110,121,
+32,111,102,32,116,104,101,115,101,99,97,117,115,101,100,32,98,121,32,116,104,101
+,111,102,32,116,104,101,32,85,110,105,116,101,100,115,112,97,110,32,99,108,97,
+115,115,61,34,109,99,97,110,32,98,101,32,116,114,97,99,101,100,105,115,32,114,
+101,108,97,116,101,100,32,116,111,98,101,99,97,109,101,32,111,110,101,32,111,102
+,105,115,32,102,114,101,113,117,101,110,116,108,121,108,105,118,105,110,103,32,
+105,110,32,116,104,101,116,104,101,111,114,101,116,105,99,97,108,108,121,70,111,
+108,108,111,119,105,110,103,32,116,104,101,82,101,118,111,108,117,116,105,111,
+110,97,114,121,103,111,118,101,114,110,109,101,110,116,32,105,110,105,115,32,100
+,101,116,101,114,109,105,110,101,100,116,104,101,32,112,111,108,105,116,105,99,
+97,108,105,110,116,114,111,100,117,99,101,100,32,105,110,115,117,102,102,105,99,
+105,101,110,116,32,116,111,100,101,115,99,114,105,112,116,105,111,110,34,62,115,
+104,111,114,116,32,115,116,111,114,105,101,115,115,101,112,97,114,97,116,105,111
+,110,32,111,102,97,115,32,116,111,32,119,104,101,116,104,101,114,107,110,111,119
+,110,32,102,111,114,32,105,116,115,119,97,115,32,105,110,105,116,105,97,108,108,
+121,100,105,115,112,108,97,121,58,98,108,111,99,107,105,115,32,97,110,32,101,120
+,97,109,112,108,101,116,104,101,32,112,114,105,110,99,105,112,97,108,99,111,110,
+115,105,115,116,115,32,111,102,32,97,114,101,99,111,103,110,105,122,101,100,32,
+97,115,47,98,111,100,121,62,60,47,104,116,109,108,62,97,32,115,117,98,115,116,97
+,110,116,105,97,108,114,101,99,111,110,115,116,114,117,99,116,101,100,104,101,97
+,100,32,111,102,32,115,116,97,116,101,114,101,115,105,115,116,97,110,99,101,32,
+116,111,117,110,100,101,114,103,114,97,100,117,97,116,101,84,104,101,114,101,32,
+97,114,101,32,116,119,111,103,114,97,118,105,116,97,116,105,111,110,97,108,97,
+114,101,32,100,101,115,99,114,105,98,101,100,105,110,116,101,110,116,105,111,110
+,97,108,108,121,115,101,114,118,101,100,32,97,115,32,116,104,101,99,108,97,115,
+115,61,34,104,101,97,100,101,114,111,112,112,111,115,105,116,105,111,110,32,116,
+111,102,117,110,100,97,109,101,110,116,97,108,108,121,100,111,109,105,110,97,116
+,101,100,32,116,104,101,97,110,100,32,116,104,101,32,111,116,104,101,114,97,108,
+108,105,97,110,99,101,32,119,105,116,104,119,97,115,32,102,111,114,99,101,100,32
+,116,111,114,101,115,112,101,99,116,105,118,101,108,121,44,97,110,100,32,112,111
+,108,105,116,105,99,97,108,105,110,32,115,117,112,112,111,114,116,32,111,102,112
+,101,111,112,108,101,32,105,110,32,116,104,101,50,48,116,104,32,99,101,110,116,
+117,114,121,46,97,110,100,32,112,117,98,108,105,115,104,101,100,108,111,97,100,
+67,104,97,114,116,98,101,97,116,116,111,32,117,110,100,101,114,115,116,97,110,
+100,109,101,109,98,101,114,32,115,116,97,116,101,115,101,110,118,105,114,111,110
+,109,101,110,116,97,108,102,105,114,115,116,32,104,97,108,102,32,111,102,99,111,
+117,110,116,114,105,101,115,32,97,110,100,97,114,99,104,105,116,101,99,116,117,
+114,97,108,98,101,32,99,111,110,115,105,100,101,114,101,100,99,104,97,114,97,99,
+116,101,114,105,122,101,100,99,108,101,97,114,73,110,116,101,114,118,97,108,97,
+117,116,104,111,114,105,116,97,116,105,118,101,70,101,100,101,114,97,116,105,111
+,110,32,111,102,119,97,115,32,115,117,99,99,101,101,100,101,100,97,110,100,32,
+116,104,101,114,101,32,97,114,101,97,32,99,111,110,115,101,113,117,101,110,99,
+101,116,104,101,32,80,114,101,115,105,100,101,110,116,97,108,115,111,32,105,110,
+99,108,117,100,101,100,102,114,101,101,32,115,111,102,116,119,97,114,101,115,117
+,99,99,101,115,115,105,111,110,32,111,102,100,101,118,101,108,111,112,101,100,32
+,116,104,101,119,97,115,32,100,101,115,116,114,111,121,101,100,97,119,97,121,32,
+102,114,111,109,32,116,104,101,59,10,60,47,115,99,114,105,112,116,62,10,60,97,
+108,116,104,111,117,103,104,32,116,104,101,121,102,111,108,108,111,119,101,100,
+32,98,121,32,97,109,111,114,101,32,112,111,119,101,114,102,117,108,114,101,115,
+117,108,116,101,100,32,105,110,32,97,85,110,105,118,101,114,115,105,116,121,32,
+111,102,72,111,119,101,118,101,114,44,32,109,97,110,121,116,104,101,32,112,114,
+101,115,105,100,101,110,116,72,111,119,101,118,101,114,44,32,115,111,109,101,105
+,115,32,116,104,111,117,103,104,116,32,116,111,117,110,116,105,108,32,116,104,
+101,32,101,110,100,119,97,115,32,97,110,110,111,117,110,99,101,100,97,114,101,32
+,105,109,112,111,114,116,97,110,116,97,108,115,111,32,105,110,99,108,117,100,101
+,115,62,60,105,110,112,117,116,32,116,121,112,101,61,116,104,101,32,99,101,110,
+116,101,114,32,111,102,32,68,79,32,78,79,84,32,65,76,84,69,82,117,115,101,100,32
+,116,111,32,114,101,102,101,114,116,104,101,109,101,115,47,63,115,111,114,116,61
+,116,104,97,116,32,104,97,100,32,98,101,101,110,116,104,101,32,98,97,115,105,115
+,32,102,111,114,104,97,115,32,100,101,118,101,108,111,112,101,100,105,110,32,116
+,104,101,32,115,117,109,109,101,114,99,111,109,112,97,114,97,116,105,118,101,108
+,121,100,101,115,99,114,105,98,101,100,32,116,104,101,115,117,99,104,32,97,115,
+32,116,104,111,115,101,116,104,101,32,114,101,115,117,108,116,105,110,103,105,
+115,32,105,109,112,111,115,115,105,98,108,101,118,97,114,105,111,117,115,32,111,
+116,104,101,114,83,111,117,116,104,32,65,102,114,105,99,97,110,104,97,118,101,32
+,116,104,101,32,115,97,109,101,101,102,102,101,99,116,105,118,101,110,101,115,
+115,105,110,32,119,104,105,99,104,32,99,97,115,101,59,32,116,101,120,116,45,97,
+108,105,103,110,58,115,116,114,117,99,116,117,114,101,32,97,110,100,59,32,98,97,
+99,107,103,114,111,117,110,100,58,114,101,103,97,114,100,105,110,103,32,116,104,
+101,115,117,112,112,111,114,116,101,100,32,116,104,101,105,115,32,97,108,115,111
+,32,107,110,111,119,110,115,116,121,108,101,61,34,109,97,114,103,105,110,105,110
+,99,108,117,100,105,110,103,32,116,104,101,98,97,104,97,115,97,32,77,101,108,97,
+121,117,110,111,114,115,107,32,98,111,107,109,195,165,108,110,111,114,115,107,32
+,110,121,110,111,114,115,107,115,108,111,118,101,110,197,161,196,141,105,110,97,
+105,110,116,101,114,110,97,99,105,111,110,97,108,99,97,108,105,102,105,99,97,99,
+105,195,179,110,99,111,109,117,110,105,99,97,99,105,195,179,110,99,111,110,115,
+116,114,117,99,99,105,195,179,110,34,62,60,100,105,118,32,99,108,97,115,115,61,
+34,100,105,115,97,109,98,105,103,117,97,116,105,111,110,68,111,109,97,105,110,78
+,97,109,101,39,44,32,39,97,100,109,105,110,105,115,116,114,97,116,105,111,110,
+115,105,109,117,108,116,97,110,101,111,117,115,108,121,116,114,97,110,115,112,
+111,114,116,97,116,105,111,110,73,110,116,101,114,110,97,116,105,111,110,97,108,
+32,109,97,114,103,105,110,45,98,111,116,116,111,109,58,114,101,115,112,111,110,
+115,105,98,105,108,105,116,121,60,33,91,101,110,100,105,102,93,45,45,62,10,60,47
+,62,60,109,101,116,97,32,110,97,109,101,61,34,105,109,112,108,101,109,101,110,
+116,97,116,105,111,110,105,110,102,114,97,115,116,114,117,99,116,117,114,101,114
+,101,112,114,101,115,101,110,116,97,116,105,111,110,98,111,114,100,101,114,45,98
+,111,116,116,111,109,58,60,47,104,101,97,100,62,10,60,98,111,100,121,62,61,104,
+116,116,112,37,51,65,37,50,70,37,50,70,60,102,111,114,109,32,109,101,116,104,111
+,100,61,34,109,101,116,104,111,100,61,34,112,111,115,116,34,32,47,102,97,118,105
+,99,111,110,46,105,99,111,34,32,125,41,59,10,60,47,115,99,114,105,112,116,62,10,
+46,115,101,116,65,116,116,114,105,98,117,116,101,40,65,100,109,105,110,105,115,
+116,114,97,116,105,111,110,61,32,110,101,119,32,65,114,114,97,121,40,41,59,60,33
+,91,101,110,100,105,102,93,45,45,62,13,10,100,105,115,112,108,97,121,58,98,108,
+111,99,107,59,85,110,102,111,114,116,117,110,97,116,101,108,121,44,34,62,38,110,
+98,115,112,59,60,47,100,105,118,62,47,102,97,118,105,99,111,110,46,105,99,111,34
+,62,61,39,115,116,121,108,101,115,104,101,101,116,39,32,105,100,101,110,116,105,
+102,105,99,97,116,105,111,110,44,32,102,111,114,32,101,120,97,109,112,108,101,44
+,60,108,105,62,60,97,32,104,114,101,102,61,34,47,97,110,32,97,108,116,101,114,
+110,97,116,105,118,101,97,115,32,97,32,114,101,115,117,108,116,32,111,102,112,
+116,34,62,60,47,115,99,114,105,112,116,62,10,116,121,112,101,61,34,115,117,98,
+109,105,116,34,32,10,40,102,117,110,99,116,105,111,110,40,41,32,123,114,101,99,
+111,109,109,101,110,100,97,116,105,111,110,102,111,114,109,32,97,99,116,105,111,
+110,61,34,47,116,114,97,110,115,102,111,114,109,97,116,105,111,110,114,101,99,
+111,110,115,116,114,117,99,116,105,111,110,46,115,116,121,108,101,46,100,105,115
+,112,108,97,121,32,65,99,99,111,114,100,105,110,103,32,116,111,32,104,105,100,
+100,101,110,34,32,110,97,109,101,61,34,97,108,111,110,103,32,119,105,116,104,32,
+116,104,101,100,111,99,117,109,101,110,116,46,98,111,100,121,46,97,112,112,114,
+111,120,105,109,97,116,101,108,121,32,67,111,109,109,117,110,105,99,97,116,105,
+111,110,115,112,111,115,116,34,32,97,99,116,105,111,110,61,34,109,101,97,110,105
+,110,103,32,38,113,117,111,116,59,45,45,60,33,91,101,110,100,105,102,93,45,45,62
+,80,114,105,109,101,32,77,105,110,105,115,116,101,114,99,104,97,114,97,99,116,
+101,114,105,115,116,105,99,60,47,97,62,32,60,97,32,99,108,97,115,115,61,116,104,
+101,32,104,105,115,116,111,114,121,32,111,102,32,111,110,109,111,117,115,101,111
+,118,101,114,61,34,116,104,101,32,103,111,118,101,114,110,109,101,110,116,104,
+114,101,102,61,34,104,116,116,112,115,58,47,47,119,97,115,32,111,114,105,103,105
+,110,97,108,108,121,119,97,115,32,105,110,116,114,111,100,117,99,101,100,99,108,
+97,115,115,105,102,105,99,97,116,105,111,110,114,101,112,114,101,115,101,110,116
+,97,116,105,118,101,97,114,101,32,99,111,110,115,105,100,101,114,101,100,60,33,
+91,101,110,100,105,102,93,45,45,62,10,10,100,101,112,101,110,100,115,32,111,110,
+32,116,104,101,85,110,105,118,101,114,115,105,116,121,32,111,102,32,105,110,32,
+99,111,110,116,114,97,115,116,32,116,111,32,112,108,97,99,101,104,111,108,100,
+101,114,61,34,105,110,32,116,104,101,32,99,97,115,101,32,111,102,105,110,116,101
+,114,110,97,116,105,111,110,97,108,32,99,111,110,115,116,105,116,117,116,105,111
+,110,97,108,115,116,121,108,101,61,34,98,111,114,100,101,114,45,58,32,102,117,
+110,99,116,105,111,110,40,41,32,123,66,101,99,97,117,115,101,32,111,102,32,116,
+104,101,45,115,116,114,105,99,116,46,100,116,100,34,62,10,60,116,97,98,108,101,
+32,99,108,97,115,115,61,34,97,99,99,111,109,112,97,110,105,101,100,32,98,121,97,
+99,99,111,117,110,116,32,111,102,32,116,104,101,60,115,99,114,105,112,116,32,115
+,114,99,61,34,47,110,97,116,117,114,101,32,111,102,32,116,104,101,32,116,104,101
+,32,112,101,111,112,108,101,32,105,110,32,105,110,32,97,100,100,105,116,105,111,
+110,32,116,111,115,41,59,32,106,115,46,105,100,32,61,32,105,100,34,32,119,105,
+100,116,104,61,34,49,48,48,37,34,114,101,103,97,114,100,105,110,103,32,116,104,
+101,32,82,111,109,97,110,32,67,97,116,104,111,108,105,99,97,110,32,105,110,100,
+101,112,101,110,100,101,110,116,102,111,108,108,111,119,105,110,103,32,116,104,
+101,32,46,103,105,102,34,32,119,105,100,116,104,61,34,49,116,104,101,32,102,111,
+108,108,111,119,105,110,103,32,100,105,115,99,114,105,109,105,110,97,116,105,111
+,110,97,114,99,104,97,101,111,108,111,103,105,99,97,108,112,114,105,109,101,32,
+109,105,110,105,115,116,101,114,46,106,115,34,62,60,47,115,99,114,105,112,116,62
+,99,111,109,98,105,110,97,116,105,111,110,32,111,102,32,109,97,114,103,105,110,
+119,105,100,116,104,61,34,99,114,101,97,116,101,69,108,101,109,101,110,116,40,
+119,46,97,116,116,97,99,104,69,118,101,110,116,40,60,47,97,62,60,47,116,100,62,
+60,47,116,114,62,115,114,99,61,34,104,116,116,112,115,58,47,47,97,73,110,32,112,
+97,114,116,105,99,117,108,97,114,44,32,97,108,105,103,110,61,34,108,101,102,116,
+34,32,67,122,101,99,104,32,82,101,112,117,98,108,105,99,85,110,105,116,101,100,
+32,75,105,110,103,100,111,109,99,111,114,114,101,115,112,111,110,100,101,110,99,
+101,99,111,110,99,108,117,100,101,100,32,116,104,97,116,46,104,116,109,108,34,32
+,116,105,116,108,101,61,34,40,102,117,110,99,116,105,111,110,32,40,41,32,123,99,
+111,109,101,115,32,102,114,111,109,32,116,104,101,97,112,112,108,105,99,97,116,
+105,111,110,32,111,102,60,115,112,97,110,32,99,108,97,115,115,61,34,115,98,101,
+108,105,101,118,101,100,32,116,111,32,98,101,101,109,101,110,116,40,39,115,99,
+114,105,112,116,39,60,47,97,62,10,60,47,108,105,62,10,60,108,105,118,101,114,121
+,32,100,105,102,102,101,114,101,110,116,62,60,115,112,97,110,32,99,108,97,115,
+115,61,34,111,112,116,105,111,110,32,118,97,108,117,101,61,34,40,97,108,115,111,
+32,107,110,111,119,110,32,97,115,9,60,108,105,62,60,97,32,104,114,101,102,61,34,
+62,60,105,110,112,117,116,32,110,97,109,101,61,34,115,101,112,97,114,97,116,101,
+100,32,102,114,111,109,114,101,102,101,114,114,101,100,32,116,111,32,97,115,32,
+118,97,108,105,103,110,61,34,116,111,112,34,62,102,111,117,110,100,101,114,32,
+111,102,32,116,104,101,97,116,116,101,109,112,116,105,110,103,32,116,111,32,99,
+97,114,98,111,110,32,100,105,111,120,105,100,101,10,10,60,100,105,118,32,99,108,
+97,115,115,61,34,99,108,97,115,115,61,34,115,101,97,114,99,104,45,47,98,111,100,
+121,62,10,60,47,104,116,109,108,62,111,112,112,111,114,116,117,110,105,116,121,
+32,116,111,99,111,109,109,117,110,105,99,97,116,105,111,110,115,60,47,104,101,97
+,100,62,13,10,60,98,111,100,121,32,115,116,121,108,101,61,34,119,105,100,116,104
+,58,84,105,225,186,191,110,103,32,86,105,225,187,135,116,99,104,97,110,103,101,
+115,32,105,110,32,116,104,101,98,111,114,100,101,114,45,99,111,108,111,114,58,35
+,48,34,32,98,111,114,100,101,114,61,34,48,34,32,60,47,115,112,97,110,62,60,47,
+100,105,118,62,60,119,97,115,32,100,105,115,99,111,118,101,114,101,100,34,32,116
+,121,112,101,61,34,116,101,120,116,34,32,41,59,10,60,47,115,99,114,105,112,116,
+62,10,10,68,101,112,97,114,116,109,101,110,116,32,111,102,32,101,99,99,108,101,
+115,105,97,115,116,105,99,97,108,116,104,101,114,101,32,104,97,115,32,98,101,101
+,110,114,101,115,117,108,116,105,110,103,32,102,114,111,109,60,47,98,111,100,121
+,62,60,47,104,116,109,108,62,104,97,115,32,110,101,118,101,114,32,98,101,101,110
+,116,104,101,32,102,105,114,115,116,32,116,105,109,101,105,110,32,114,101,115,
+112,111,110,115,101,32,116,111,97,117,116,111,109,97,116,105,99,97,108,108,121,
+32,60,47,100,105,118,62,10,10,60,100,105,118,32,105,119,97,115,32,99,111,110,115
+,105,100,101,114,101,100,112,101,114,99,101,110,116,32,111,102,32,116,104,101,34
+,32,47,62,60,47,97,62,60,47,100,105,118,62,99,111,108,108,101,99,116,105,111,110
+,32,111,102,32,100,101,115,99,101,110,100,101,100,32,102,114,111,109,115,101,99,
+116,105,111,110,32,111,102,32,116,104,101,97,99,99,101,112,116,45,99,104,97,114,
+115,101,116,116,111,32,98,101,32,99,111,110,102,117,115,101,100,109,101,109,98,
+101,114,32,111,102,32,116,104,101,32,112,97,100,100,105,110,103,45,114,105,103,
+104,116,58,116,114,97,110,115,108,97,116,105,111,110,32,111,102,105,110,116,101,
+114,112,114,101,116,97,116,105,111,110,32,104,114,101,102,61,39,104,116,116,112,
+58,47,47,119,104,101,116,104,101,114,32,111,114,32,110,111,116,84,104,101,114,
+101,32,97,114,101,32,97,108,115,111,116,104,101,114,101,32,97,114,101,32,109,97,
+110,121,97,32,115,109,97,108,108,32,110,117,109,98,101,114,111,116,104,101,114,
+32,112,97,114,116,115,32,111,102,105,109,112,111,115,115,105,98,108,101,32,116,
+111,32,32,99,108,97,115,115,61,34,98,117,116,116,111,110,108,111,99,97,116,101,
+100,32,105,110,32,116,104,101,46,32,72,111,119,101,118,101,114,44,32,116,104,101
+,97,110,100,32,101,118,101,110,116,117,97,108,108,121,65,116,32,116,104,101,32,
+101,110,100,32,111,102,32,98,101,99,97,117,115,101,32,111,102,32,105,116,115,114
+,101,112,114,101,115,101,110,116,115,32,116,104,101,60,102,111,114,109,32,97,99,
+116,105,111,110,61,34,32,109,101,116,104,111,100,61,34,112,111,115,116,34,105,
+116,32,105,115,32,112,111,115,115,105,98,108,101,109,111,114,101,32,108,105,107,
+101,108,121,32,116,111,97,110,32,105,110,99,114,101,97,115,101,32,105,110,104,97
+,118,101,32,97,108,115,111,32,98,101,101,110,99,111,114,114,101,115,112,111,110,
+100,115,32,116,111,97,110,110,111,117,110,99,101,100,32,116,104,97,116,97,108,
+105,103,110,61,34,114,105,103,104,116,34,62,109,97,110,121,32,99,111,117,110,116
+,114,105,101,115,102,111,114,32,109,97,110,121,32,121,101,97,114,115,101,97,114,
+108,105,101,115,116,32,107,110,111,119,110,98,101,99,97,117,115,101,32,105,116,
+32,119,97,115,112,116,34,62,60,47,115,99,114,105,112,116,62,13,32,118,97,108,105
+,103,110,61,34,116,111,112,34,32,105,110,104,97,98,105,116,97,110,116,115,32,111
+,102,102,111,108,108,111,119,105,110,103,32,121,101,97,114,13,10,60,100,105,118,
+32,99,108,97,115,115,61,34,109,105,108,108,105,111,110,32,112,101,111,112,108,
+101,99,111,110,116,114,111,118,101,114,115,105,97,108,32,99,111,110,99,101,114,
+110,105,110,103,32,116,104,101,97,114,103,117,101,32,116,104,97,116,32,116,104,
+101,103,111,118,101,114,110,109,101,110,116,32,97,110,100,97,32,114,101,102,101,
+114,101,110,99,101,32,116,111,116,114,97,110,115,102,101,114,114,101,100,32,116,
+111,100,101,115,99,114,105,98,105,110,103,32,116,104,101,32,115,116,121,108,101,
+61,34,99,111,108,111,114,58,97,108,116,104,111,117,103,104,32,116,104,101,114,
+101,98,101,115,116,32,107,110,111,119,110,32,102,111,114,115,117,98,109,105,116,
+34,32,110,97,109,101,61,34,109,117,108,116,105,112,108,105,99,97,116,105,111,110
+,109,111,114,101,32,116,104,97,110,32,111,110,101,32,114,101,99,111,103,110,105,
+116,105,111,110,32,111,102,67,111,117,110,99,105,108,32,111,102,32,116,104,101,
+101,100,105,116,105,111,110,32,111,102,32,116,104,101,32,32,60,109,101,116,97,32
+,110,97,109,101,61,34,69,110,116,101,114,116,97,105,110,109,101,110,116,32,97,
+119,97,121,32,102,114,111,109,32,116,104,101,32,59,109,97,114,103,105,110,45,114
+,105,103,104,116,58,97,116,32,116,104,101,32,116,105,109,101,32,111,102,105,110,
+118,101,115,116,105,103,97,116,105,111,110,115,99,111,110,110,101,99,116,101,100
+,32,119,105,116,104,97,110,100,32,109,97,110,121,32,111,116,104,101,114,97,108,
+116,104,111,117,103,104,32,105,116,32,105,115,98,101,103,105,110,110,105,110,103
+,32,119,105,116,104,32,60,115,112,97,110,32,99,108,97,115,115,61,34,100,101,115,
+99,101,110,100,97,110,116,115,32,111,102,60,115,112,97,110,32,99,108,97,115,115,
+61,34,105,32,97,108,105,103,110,61,34,114,105,103,104,116,34,60,47,104,101,97,
+100,62,10,60,98,111,100,121,32,97,115,112,101,99,116,115,32,111,102,32,116,104,
+101,104,97,115,32,115,105,110,99,101,32,98,101,101,110,69,117,114,111,112,101,97
+,110,32,85,110,105,111,110,114,101,109,105,110,105,115,99,101,110,116,32,111,102
+,109,111,114,101,32,100,105,102,102,105,99,117,108,116,86,105,99,101,32,80,114,
+101,115,105,100,101,110,116,99,111,109,112,111,115,105,116,105,111,110,32,111,
+102,112,97,115,115,101,100,32,116,104,114,111,117,103,104,109,111,114,101,32,105
+,109,112,111,114,116,97,110,116,102,111,110,116,45,115,105,122,101,58,49,49,112,
+120,101,120,112,108,97,110,97,116,105,111,110,32,111,102,116,104,101,32,99,111,
+110,99,101,112,116,32,111,102,119,114,105,116,116,101,110,32,105,110,32,116,104,
+101,9,60,115,112,97,110,32,99,108,97,115,115,61,34,105,115,32,111,110,101,32,111
+,102,32,116,104,101,32,114,101,115,101,109,98,108,97,110,99,101,32,116,111,111,
+110,32,116,104,101,32,103,114,111,117,110,100,115,119,104,105,99,104,32,99,111,
+110,116,97,105,110,115,105,110,99,108,117,100,105,110,103,32,116,104,101,32,100,
+101,102,105,110,101,100,32,98,121,32,116,104,101,112,117,98,108,105,99,97,116,
+105,111,110,32,111,102,109,101,97,110,115,32,116,104,97,116,32,116,104,101,111,
+117,116,115,105,100,101,32,111,102,32,116,104,101,115,117,112,112,111,114,116,32
+,111,102,32,116,104,101,60,105,110,112,117,116,32,99,108,97,115,115,61,34,60,115
+,112,97,110,32,99,108,97,115,115,61,34,116,40,77,97,116,104,46,114,97,110,100,
+111,109,40,41,109,111,115,116,32,112,114,111,109,105,110,101,110,116,100,101,115
+,99,114,105,112,116,105,111,110,32,111,102,67,111,110,115,116,97,110,116,105,110
+,111,112,108,101,119,101,114,101,32,112,117,98,108,105,115,104,101,100,60,100,
+105,118,32,99,108,97,115,115,61,34,115,101,97,112,112,101,97,114,115,32,105,110,
+32,116,104,101,49,34,32,104,101,105,103,104,116,61,34,49,34,32,109,111,115,116,
+32,105,109,112,111,114,116,97,110,116,119,104,105,99,104,32,105,110,99,108,117,
+100,101,115,119,104,105,99,104,32,104,97,100,32,98,101,101,110,100,101,115,116,
+114,117,99,116,105,111,110,32,111,102,116,104,101,32,112,111,112,117,108,97,116,
+105,111,110,10,9,60,100,105,118,32,99,108,97,115,115,61,34,112,111,115,115,105,
+98,105,108,105,116,121,32,111,102,115,111,109,101,116,105,109,101,115,32,117,115
+,101,100,97,112,112,101,97,114,32,116,111,32,104,97,118,101,115,117,99,99,101,
+115,115,32,111,102,32,116,104,101,105,110,116,101,110,100,101,100,32,116,111,32,
+98,101,112,114,101,115,101,110,116,32,105,110,32,116,104,101,115,116,121,108,101
+,61,34,99,108,101,97,114,58,98,13,10,60,47,115,99,114,105,112,116,62,13,10,60,
+119,97,115,32,102,111,117,110,100,101,100,32,105,110,105,110,116,101,114,118,105
+,101,119,32,119,105,116,104,95,105,100,34,32,99,111,110,116,101,110,116,61,34,99
+,97,112,105,116,97,108,32,111,102,32,116,104,101,13,10,60,108,105,110,107,32,114
+,101,108,61,34,115,114,101,108,101,97,115,101,32,111,102,32,116,104,101,112,111,
+105,110,116,32,111,117,116,32,116,104,97,116,120,77,76,72,116,116,112,82,101,113
+,117,101,115,116,97,110,100,32,115,117,98,115,101,113,117,101,110,116,115,101,99
+,111,110,100,32,108,97,114,103,101,115,116,118,101,114,121,32,105,109,112,111,
+114,116,97,110,116,115,112,101,99,105,102,105,99,97,116,105,111,110,115,115,117,
+114,102,97,99,101,32,111,102,32,116,104,101,97,112,112,108,105,101,100,32,116,
+111,32,116,104,101,102,111,114,101,105,103,110,32,112,111,108,105,99,121,95,115,
+101,116,68,111,109,97,105,110,78,97,109,101,101,115,116,97,98,108,105,115,104,
+101,100,32,105,110,105,115,32,98,101,108,105,101,118,101,100,32,116,111,73,110,
+32,97,100,100,105,116,105,111,110,32,116,111,109,101,97,110,105,110,103,32,111,
+102,32,116,104,101,105,115,32,110,97,109,101,100,32,97,102,116,101,114,116,111,
+32,112,114,111,116,101,99,116,32,116,104,101,105,115,32,114,101,112,114,101,115,
+101,110,116,101,100,68,101,99,108,97,114,97,116,105,111,110,32,111,102,109,111,
+114,101,32,101,102,102,105,99,105,101,110,116,67,108,97,115,115,105,102,105,99,
+97,116,105,111,110,111,116,104,101,114,32,102,111,114,109,115,32,111,102,104,101
+,32,114,101,116,117,114,110,101,100,32,116,111,60,115,112,97,110,32,99,108,97,
+115,115,61,34,99,112,101,114,102,111,114,109,97,110,99,101,32,111,102,40,102,117
+,110,99,116,105,111,110,40,41,32,123,13,105,102,32,97,110,100,32,111,110,108,121
+,32,105,102,114,101,103,105,111,110,115,32,111,102,32,116,104,101,108,101,97,100
+,105,110,103,32,116,111,32,116,104,101,114,101,108,97,116,105,111,110,115,32,119
+,105,116,104,85,110,105,116,101,100,32,78,97,116,105,111,110,115,115,116,121,108
+,101,61,34,104,101,105,103,104,116,58,111,116,104,101,114,32,116,104,97,110,32,
+116,104,101,121,112,101,34,32,99,111,110,116,101,110,116,61,34,65,115,115,111,99
+,105,97,116,105,111,110,32,111,102,10,60,47,104,101,97,100,62,10,60,98,111,100,
+121,108,111,99,97,116,101,100,32,111,110,32,116,104,101,105,115,32,114,101,102,
+101,114,114,101,100,32,116,111,40,105,110,99,108,117,100,105,110,103,32,116,104,
+101,99,111,110,99,101,110,116,114,97,116,105,111,110,115,116,104,101,32,105,110,
+100,105,118,105,100,117,97,108,97,109,111,110,103,32,116,104,101,32,109,111,115,
+116,116,104,97,110,32,97,110,121,32,111,116,104,101,114,47,62,10,60,108,105,110,
+107,32,114,101,108,61,34,32,114,101,116,117,114,110,32,102,97,108,115,101,59,116
+,104,101,32,112,117,114,112,111,115,101,32,111,102,116,104,101,32,97,98,105,108,
+105,116,121,32,116,111,59,99,111,108,111,114,58,35,102,102,102,125,10,46,10,60,
+115,112,97,110,32,99,108,97,115,115,61,34,116,104,101,32,115,117,98,106,101,99,
+116,32,111,102,100,101,102,105,110,105,116,105,111,110,115,32,111,102,62,13,10,
+60,108,105,110,107,32,114,101,108,61,34,99,108,97,105,109,32,116,104,97,116,32,
+116,104,101,104,97,118,101,32,100,101,118,101,108,111,112,101,100,60,116,97,98,
+108,101,32,119,105,100,116,104,61,34,99,101,108,101,98,114,97,116,105,111,110,32
+,111,102,70,111,108,108,111,119,105,110,103,32,116,104,101,32,116,111,32,100,105
+,115,116,105,110,103,117,105,115,104,60,115,112,97,110,32,99,108,97,115,115,61,
+34,98,116,97,107,101,115,32,112,108,97,99,101,32,105,110,117,110,100,101,114,32,
+116,104,101,32,110,97,109,101,110,111,116,101,100,32,116,104,97,116,32,116,104,
+101,62,60,33,91,101,110,100,105,102,93,45,45,62,10,115,116,121,108,101,61,34,109
+,97,114,103,105,110,45,105,110,115,116,101,97,100,32,111,102,32,116,104,101,105,
+110,116,114,111,100,117,99,101,100,32,116,104,101,116,104,101,32,112,114,111,99,
+101,115,115,32,111,102,105,110,99,114,101,97,115,105,110,103,32,116,104,101,100,
+105,102,102,101,114,101,110,99,101,115,32,105,110,101,115,116,105,109,97,116,101
+,100,32,116,104,97,116,101,115,112,101,99,105,97,108,108,121,32,116,104,101,47,
+100,105,118,62,60,100,105,118,32,105,100,61,34,119,97,115,32,101,118,101,110,116
+,117,97,108,108,121,116,104,114,111,117,103,104,111,117,116,32,104,105,115,116,
+104,101,32,100,105,102,102,101,114,101,110,99,101,115,111,109,101,116,104,105,
+110,103,32,116,104,97,116,115,112,97,110,62,60,47,115,112,97,110,62,60,47,115,
+105,103,110,105,102,105,99,97,110,116,108,121,32,62,60,47,115,99,114,105,112,116
+,62,13,10,13,10,101,110,118,105,114,111,110,109,101,110,116,97,108,32,116,111,32
+,112,114,101,118,101,110,116,32,116,104,101,104,97,118,101,32,98,101,101,110,32,
+117,115,101,100,101,115,112,101,99,105,97,108,108,121,32,102,111,114,117,110,100
+,101,114,115,116,97,110,100,32,116,104,101,105,115,32,101,115,115,101,110,116,
+105,97,108,108,121,119,101,114,101,32,116,104,101,32,102,105,114,115,116,105,115
+,32,116,104,101,32,108,97,114,103,101,115,116,104,97,118,101,32,98,101,101,110,
+32,109,97,100,101,34,32,115,114,99,61,34,104,116,116,112,58,47,47,105,110,116,
+101,114,112,114,101,116,101,100,32,97,115,115,101,99,111,110,100,32,104,97,108,
+102,32,111,102,99,114,111,108,108,105,110,103,61,34,110,111,34,32,105,115,32,99,
+111,109,112,111,115,101,100,32,111,102,73,73,44,32,72,111,108,121,32,82,111,109,
+97,110,105,115,32,101,120,112,101,99,116,101,100,32,116,111,104,97,118,101,32,
+116,104,101,105,114,32,111,119,110,100,101,102,105,110,101,100,32,97,115,32,116,
+104,101,116,114,97,100,105,116,105,111,110,97,108,108,121,32,104,97,118,101,32,
+100,105,102,102,101,114,101,110,116,97,114,101,32,111,102,116,101,110,32,117,115
+,101,100,116,111,32,101,110,115,117,114,101,32,116,104,97,116,97,103,114,101,101
+,109,101,110,116,32,119,105,116,104,99,111,110,116,97,105,110,105,110,103,32,116
+,104,101,97,114,101,32,102,114,101,113,117,101,110,116,108,121,105,110,102,111,
+114,109,97,116,105,111,110,32,111,110,101,120,97,109,112,108,101,32,105,115,32,
+116,104,101,114,101,115,117,108,116,105,110,103,32,105,110,32,97,60,47,97,62,60,
+47,108,105,62,60,47,117,108,62,32,99,108,97,115,115,61,34,102,111,111,116,101,
+114,97,110,100,32,101,115,112,101,99,105,97,108,108,121,116,121,112,101,61,34,98
+,117,116,116,111,110,34,32,60,47,115,112,97,110,62,60,47,115,112,97,110,62,119,
+104,105,99,104,32,105,110,99,108,117,100,101,100,62,10,60,109,101,116,97,32,110,
+97,109,101,61,34,99,111,110,115,105,100,101,114,101,100,32,116,104,101,99,97,114
+,114,105,101,100,32,111,117,116,32,98,121,72,111,119,101,118,101,114,44,32,105,
+116,32,105,115,98,101,99,97,109,101,32,112,97,114,116,32,111,102,105,110,32,114,
+101,108,97,116,105,111,110,32,116,111,112,111,112,117,108,97,114,32,105,110,32,
+116,104,101,116,104,101,32,99,97,112,105,116,97,108,32,111,102,119,97,115,32,111
+,102,102,105,99,105,97,108,108,121,119,104,105,99,104,32,104,97,115,32,98,101,
+101,110,116,104,101,32,72,105,115,116,111,114,121,32,111,102,97,108,116,101,114,
+110,97,116,105,118,101,32,116,111,100,105,102,102,101,114,101,110,116,32,102,114
+,111,109,116,111,32,115,117,112,112,111,114,116,32,116,104,101,115,117,103,103,
+101,115,116,101,100,32,116,104,97,116,105,110,32,116,104,101,32,112,114,111,99,
+101,115,115,32,32,60,100,105,118,32,99,108,97,115,115,61,34,116,104,101,32,102,
+111,117,110,100,97,116,105,111,110,98,101,99,97,117,115,101,32,111,102,32,104,
+105,115,99,111,110,99,101,114,110,101,100,32,119,105,116,104,116,104,101,32,117,
+110,105,118,101,114,115,105,116,121,111,112,112,111,115,101,100,32,116,111,32,
+116,104,101,116,104,101,32,99,111,110,116,101,120,116,32,111,102,60,115,112,97,
+110,32,99,108,97,115,115,61,34,112,116,101,120,116,34,32,110,97,109,101,61,34,
+113,34,9,9,60,100,105,118,32,99,108,97,115,115,61,34,116,104,101,32,115,99,105,
+101,110,116,105,102,105,99,114,101,112,114,101,115,101,110,116,101,100,32,98,121
+,109,97,116,104,101,109,97,116,105,99,105,97,110,115,101,108,101,99,116,101,100,
+32,98,121,32,116,104,101,116,104,97,116,32,104,97,118,101,32,98,101,101,110,62,
+60,100,105,118,32,99,108,97,115,115,61,34,99,100,105,118,32,105,100,61,34,104,
+101,97,100,101,114,105,110,32,112,97,114,116,105,99,117,108,97,114,44,99,111,110
+,118,101,114,116,101,100,32,105,110,116,111,41,59,10,60,47,115,99,114,105,112,
+116,62,10,60,112,104,105,108,111,115,111,112,104,105,99,97,108,32,115,114,112,
+115,107,111,104,114,118,97,116,115,107,105,116,105,225,186,191,110,103,32,86,105
+,225,187,135,116,208,160,209,131,209,129,209,129,208,186,208,184,208,185,209,128
+,209,131,209,129,209,129,208,186,208,184,208,185,105,110,118,101,115,116,105,103
+,97,99,105,195,179,110,112,97,114,116,105,99,105,112,97,99,105,195,179,110,208,
+186,208,190,209,130,208,190,209,128,209,139,208,181,208,190,208,177,208,187,208,
+176,209,129,209,130,208,184,208,186,208,190,209,130,208,190,209,128,209,139,208,
+185,209,135,208,181,208,187,208,190,208,178,208,181,208,186,209,129,208,184,209,
+129,209,130,208,181,208,188,209,139,208,157,208,190,208,178,208,190,209,129,209,
+130,208,184,208,186,208,190,209,130,208,190,209,128,209,139,209,133,208,190,208,
+177,208,187,208,176,209,129,209,130,209,140,208,178,209,128,208,181,208,188,208,
+181,208,189,208,184,208,186,208,190,209,130,208,190,209,128,208,176,209,143,209,
+129,208,181,208,179,208,190,208,180,208,189,209,143,209,129,208,186,208,176,209,
+135,208,176,209,130,209,140,208,189,208,190,208,178,208,190,209,129,209,130,208,
+184,208,163,208,186,209,128,208,176,208,184,208,189,209,139,208,178,208,190,208,
+191,209,128,208,190,209,129,209,139,208,186,208,190,209,130,208,190,209,128,208,
+190,208,185,209,129,208,180,208,181,208,187,208,176,209,130,209,140,208,191,208,
+190,208,188,208,190,209,137,209,140,209,142,209,129,209,128,208,181,208,180,209,
+129,209,130,208,178,208,190,208,177,209,128,208,176,208,183,208,190,208,188,209,
+129,209,130,208,190,209,128,208,190,208,189,209,139,209,131,209,135,208,176,209,
+129,209,130,208,184,208,181,209,130,208,181,209,135,208,181,208,189,208,184,208,
+181,208,147,208,187,208,176,208,178,208,189,208,176,209,143,208,184,209,129,209,
+130,208,190,209,128,208,184,208,184,209,129,208,184,209,129,209,130,208,181,208,
+188,208,176,209,128,208,181,209,136,208,181,208,189,208,184,209,143,208,161,208,
+186,208,176,209,135,208,176,209,130,209,140,208,191,208,190,209,141,209,130,208,
+190,208,188,209,131,209,129,208,187,208,181,208,180,209,131,208,181,209,130,209,
+129,208,186,208,176,208,183,208,176,209,130,209,140,209,130,208,190,208,178,208,
+176,209,128,208,190,208,178,208,186,208,190,208,189,208,181,209,135,208,189,208,
+190,209,128,208,181,209,136,208,181,208,189,208,184,208,181,208,186,208,190,209,
+130,208,190,209,128,208,190,208,181,208,190,209,128,208,179,208,176,208,189,208,
+190,208,178,208,186,208,190,209,130,208,190,209,128,208,190,208,188,208,160,208,
+181,208,186,208,187,208,176,208,188,208,176,216,167,217,132,217,133,217,134,216,
+170,216,175,217,137,217,133,217,134,216,170,216,175,217,138,216,167,216,170,216,
+167,217,132,217,133,217,136,216,182,217,136,216,185,216,167,217,132,216,168,216,
+177,216,167,217,133,216,172,216,167,217,132,217,133,217,136,216,167,217,130,216,
+185,216,167,217,132,216,177,216,179,216,167,216,166,217,132,217,133,216,180,216,
+167,216,177,217,131,216,167,216,170,216,167,217,132,216,163,216,185,216,182,216,
+167,216,161,216,167,217,132,216,177,217,138,216,167,216,182,216,169,216,167,217,
+132,216,170,216,181,217,133,217,138,217,133,216,167,217,132,216,167,216,185,216,
+182,216,167,216,161,216,167,217,132,217,134,216,170,216,167,216,166,216,172,216,
+167,217,132,216,163,217,132,216,185,216,167,216,168,216,167,217,132,216,170,216,
+179,216,172,217,138,217,132,216,167,217,132,216,163,217,130,216,179,216,167,217,
+133,216,167,217,132,216,182,216,186,216,183,216,167,216,170,216,167,217,132,217,
+129,217,138,216,175,217,138,217,136,216,167,217,132,216,170,216,177,216,173,217,
+138,216,168,216,167,217,132,216,172,216,175,217,138,216,175,216,169,216,167,217,
+132,216,170,216,185,217,132,217,138,217,133,216,167,217,132,216,163,216,174,216,
+168,216,167,216,177,216,167,217,132,216,167,217,129,217,132,216,167,217,133,216,
+167,217,132,216,163,217,129,217,132,216,167,217,133,216,167,217,132,216,170,216,
+167,216,177,217,138,216,174,216,167,217,132,216,170,217,130,217,134,217,138,216,
+169,216,167,217,132,216,167,217,132,216,185,216,167,216,168,216,167,217,132,216,
+174,217,136,216,167,216,183,216,177,216,167,217,132,217,133,216,172,216,170,217,
+133,216,185,216,167,217,132,216,175,217,138,217,131,217,136,216,177,216,167,217,
+132,216,179,217,138,216,167,216,173,216,169,216,185,216,168,216,175,216,167,217,
+132,217,132,217,135,216,167,217,132,216,170,216,177,216,168,217,138,216,169,216,
+167,217,132,216,177,217,136,216,167,216,168,216,183,216,167,217,132,216,163,216,
+175,216,168,217,138,216,169,216,167,217,132,216,167,216,174,216,168,216,167,216,
+177,216,167,217,132,217,133,216,170,216,173,216,175,216,169,216,167,217,132,216,
+167,216,186,216,167,217,134,217,138,99,117,114,115,111,114,58,112,111,105,110,
+116,101,114,59,60,47,116,105,116,108,101,62,10,60,109,101,116,97,32,34,32,104,
+114,101,102,61,34,104,116,116,112,58,47,47,34,62,60,115,112,97,110,32,99,108,97,
+115,115,61,34,109,101,109,98,101,114,115,32,111,102,32,116,104,101,32,119,105,
+110,100,111,119,46,108,111,99,97,116,105,111,110,118,101,114,116,105,99,97,108,
+45,97,108,105,103,110,58,47,97,62,32,124,32,60,97,32,104,114,101,102,61,34,60,33
+,100,111,99,116,121,112,101,32,104,116,109,108,62,109,101,100,105,97,61,34,115,
+99,114,101,101,110,34,32,60,111,112,116,105,111,110,32,118,97,108,117,101,61,34,
+102,97,118,105,99,111,110,46,105,99,111,34,32,47,62,10,9,9,60,100,105,118,32,99,
+108,97,115,115,61,34,99,104,97,114,97,99,116,101,114,105,115,116,105,99,115,34,
+32,109,101,116,104,111,100,61,34,103,101,116,34,32,47,98,111,100,121,62,10,60,47
+,104,116,109,108,62,10,115,104,111,114,116,99,117,116,32,105,99,111,110,34,32,
+100,111,99,117,109,101,110,116,46,119,114,105,116,101,40,112,97,100,100,105,110,
+103,45,98,111,116,116,111,109,58,114,101,112,114,101,115,101,110,116,97,116,105,
+118,101,115,115,117,98,109,105,116,34,32,118,97,108,117,101,61,34,97,108,105,103
+,110,61,34,99,101,110,116,101,114,34,32,116,104,114,111,117,103,104,111,117,116,
+32,116,104,101,32,115,99,105,101,110,99,101,32,102,105,99,116,105,111,110,10,32,
+32,60,100,105,118,32,99,108,97,115,115,61,34,115,117,98,109,105,116,34,32,99,108
+,97,115,115,61,34,111,110,101,32,111,102,32,116,104,101,32,109,111,115,116,32,
+118,97,108,105,103,110,61,34,116,111,112,34,62,60,119,97,115,32,101,115,116,97,
+98,108,105,115,104,101,100,41,59,13,10,60,47,115,99,114,105,112,116,62,13,10,114
+,101,116,117,114,110,32,102,97,108,115,101,59,34,62,41,46,115,116,121,108,101,46
+,100,105,115,112,108,97,121,98,101,99,97,117,115,101,32,111,102,32,116,104,101,
+32,100,111,99,117,109,101,110,116,46,99,111,111,107,105,101,60,102,111,114,109,
+32,97,99,116,105,111,110,61,34,47,125,98,111,100,121,123,109,97,114,103,105,110,
+58,48,59,69,110,99,121,99,108,111,112,101,100,105,97,32,111,102,118,101,114,115,
+105,111,110,32,111,102,32,116,104,101,32,46,99,114,101,97,116,101,69,108,101,109
+,101,110,116,40,110,97,109,101,34,32,99,111,110,116,101,110,116,61,34,60,47,100,
+105,118,62,10,60,47,100,105,118,62,10,10,97,100,109,105,110,105,115,116,114,97,
+116,105,118,101,32,60,47,98,111,100,121,62,10,60,47,104,116,109,108,62,104,105,
+115,116,111,114,121,32,111,102,32,116,104,101,32,34,62,60,105,110,112,117,116,32
+,116,121,112,101,61,34,112,111,114,116,105,111,110,32,111,102,32,116,104,101,32,
+97,115,32,112,97,114,116,32,111,102,32,116,104,101,32,38,110,98,115,112,59,60,97
+,32,104,114,101,102,61,34,111,116,104,101,114,32,99,111,117,110,116,114,105,101,
+115,34,62,10,60,100,105,118,32,99,108,97,115,115,61,34,60,47,115,112,97,110,62,
+60,47,115,112,97,110,62,60,73,110,32,111,116,104,101,114,32,119,111,114,100,115,
+44,100,105,115,112,108,97,121,58,32,98,108,111,99,107,59,99,111,110,116,114,111,
+108,32,111,102,32,116,104,101,32,105,110,116,114,111,100,117,99,116,105,111,110,
+32,111,102,47,62,10,60,109,101,116,97,32,110,97,109,101,61,34,97,115,32,119,101,
+108,108,32,97,115,32,116,104,101,32,105,110,32,114,101,99,101,110,116,32,121,101
+,97,114,115,13,10,9,60,100,105,118,32,99,108,97,115,115,61,34,60,47,100,105,118,
+62,10,9,60,47,100,105,118,62,10,105,110,115,112,105,114,101,100,32,98,121,32,116
+,104,101,116,104,101,32,101,110,100,32,111,102,32,116,104,101,32,99,111,109,112,
+97,116,105,98,108,101,32,119,105,116,104,98,101,99,97,109,101,32,107,110,111,119
+,110,32,97,115,32,115,116,121,108,101,61,34,109,97,114,103,105,110,58,46,106,115
+,34,62,60,47,115,99,114,105,112,116,62,60,32,73,110,116,101,114,110,97,116,105,
+111,110,97,108,32,116,104,101,114,101,32,104,97,118,101,32,98,101,101,110,71,101
+,114,109,97,110,32,108,97,110,103,117,97,103,101,32,115,116,121,108,101,61,34,99
+,111,108,111,114,58,35,67,111,109,109,117,110,105,115,116,32,80,97,114,116,121,
+99,111,110,115,105,115,116,101,110,116,32,119,105,116,104,98,111,114,100,101,114
+,61,34,48,34,32,99,101,108,108,32,109,97,114,103,105,110,104,101,105,103,104,116
+,61,34,116,104,101,32,109,97,106,111,114,105,116,121,32,111,102,34,32,97,108,105
+,103,110,61,34,99,101,110,116,101,114,114,101,108,97,116,101,100,32,116,111,32,
+116,104,101,32,109,97,110,121,32,100,105,102,102,101,114,101,110,116,32,79,114,
+116,104,111,100,111,120,32,67,104,117,114,99,104,115,105,109,105,108,97,114,32,
+116,111,32,116,104,101,32,47,62,10,60,108,105,110,107,32,114,101,108,61,34,115,
+119,97,115,32,111,110,101,32,111,102,32,116,104,101,32,117,110,116,105,108,32,
+104,105,115,32,100,101,97,116,104,125,41,40,41,59,10,60,47,115,99,114,105,112,
+116,62,111,116,104,101,114,32,108,97,110,103,117,97,103,101,115,99,111,109,112,
+97,114,101,100,32,116,111,32,116,104,101,112,111,114,116,105,111,110,115,32,111,
+102,32,116,104,101,116,104,101,32,78,101,116,104,101,114,108,97,110,100,115,116,
+104,101,32,109,111,115,116,32,99,111,109,109,111,110,98,97,99,107,103,114,111,
+117,110,100,58,117,114,108,40,97,114,103,117,101,100,32,116,104,97,116,32,116,
+104,101,115,99,114,111,108,108,105,110,103,61,34,110,111,34,32,105,110,99,108,
+117,100,101,100,32,105,110,32,116,104,101,78,111,114,116,104,32,65,109,101,114,
+105,99,97,110,32,116,104,101,32,110,97,109,101,32,111,102,32,116,104,101,105,110
+,116,101,114,112,114,101,116,97,116,105,111,110,115,116,104,101,32,116,114,97,
+100,105,116,105,111,110,97,108,100,101,118,101,108,111,112,109,101,110,116,32,
+111,102,32,102,114,101,113,117,101,110,116,108,121,32,117,115,101,100,97,32,99,
+111,108,108,101,99,116,105,111,110,32,111,102,118,101,114,121,32,115,105,109,105
+,108,97,114,32,116,111,115,117,114,114,111,117,110,100,105,110,103,32,116,104,
+101,101,120,97,109,112,108,101,32,111,102,32,116,104,105,115,97,108,105,103,110,
+61,34,99,101,110,116,101,114,34,62,119,111,117,108,100,32,104,97,118,101,32,98,
+101,101,110,105,109,97,103,101,95,99,97,112,116,105,111,110,32,61,97,116,116,97,
+99,104,101,100,32,116,111,32,116,104,101,115,117,103,103,101,115,116,105,110,103
+,32,116,104,97,116,105,110,32,116,104,101,32,102,111,114,109,32,111,102,32,105,
+110,118,111,108,118,101,100,32,105,110,32,116,104,101,105,115,32,100,101,114,105
+,118,101,100,32,102,114,111,109,110,97,109,101,100,32,97,102,116,101,114,32,116,
+104,101,73,110,116,114,111,100,117,99,116,105,111,110,32,116,111,114,101,115,116
+,114,105,99,116,105,111,110,115,32,111,110,32,115,116,121,108,101,61,34,119,105,
+100,116,104,58,32,99,97,110,32,98,101,32,117,115,101,100,32,116,111,32,116,104,
+101,32,99,114,101,97,116,105,111,110,32,111,102,109,111,115,116,32,105,109,112,
+111,114,116,97,110,116,32,105,110,102,111,114,109,97,116,105,111,110,32,97,110,
+100,114,101,115,117,108,116,101,100,32,105,110,32,116,104,101,99,111,108,108,97,
+112,115,101,32,111,102,32,116,104,101,84,104,105,115,32,109,101,97,110,115,32,
+116,104,97,116,101,108,101,109,101,110,116,115,32,111,102,32,116,104,101,119,97,
+115,32,114,101,112,108,97,99,101,100,32,98,121,97,110,97,108,121,115,105,115,32,
+111,102,32,116,104,101,105,110,115,112,105,114,97,116,105,111,110,32,102,111,114
+,114,101,103,97,114,100,101,100,32,97,115,32,116,104,101,109,111,115,116,32,115,
+117,99,99,101,115,115,102,117,108,107,110,111,119,110,32,97,115,32,38,113,117,
+111,116,59,97,32,99,111,109,112,114,101,104,101,110,115,105,118,101,72,105,115,
+116,111,114,121,32,111,102,32,116,104,101,32,119,101,114,101,32,99,111,110,115,
+105,100,101,114,101,100,114,101,116,117,114,110,101,100,32,116,111,32,116,104,
+101,97,114,101,32,114,101,102,101,114,114,101,100,32,116,111,85,110,115,111,117,
+114,99,101,100,32,105,109,97,103,101,62,10,9,60,100,105,118,32,99,108,97,115,115
+,61,34,99,111,110,115,105,115,116,115,32,111,102,32,116,104,101,115,116,111,112,
+80,114,111,112,97,103,97,116,105,111,110,105,110,116,101,114,101,115,116,32,105,
+110,32,116,104,101,97,118,97,105,108,97,98,105,108,105,116,121,32,111,102,97,112
+,112,101,97,114,115,32,116,111,32,104,97,118,101,101,108,101,99,116,114,111,109,
+97,103,110,101,116,105,99,101,110,97,98,108,101,83,101,114,118,105,99,101,115,40
+,102,117,110,99,116,105,111,110,32,111,102,32,116,104,101,73,116,32,105,115,32,
+105,109,112,111,114,116,97,110,116,60,47,115,99,114,105,112,116,62,60,47,100,105
+,118,62,102,117,110,99,116,105,111,110,40,41,123,118,97,114,32,114,101,108,97,
+116,105,118,101,32,116,111,32,116,104,101,97,115,32,97,32,114,101,115,117,108,
+116,32,111,102,32,116,104,101,32,112,111,115,105,116,105,111,110,32,111,102,70,
+111,114,32,101,120,97,109,112,108,101,44,32,105,110,32,109,101,116,104,111,100,
+61,34,112,111,115,116,34,32,119,97,115,32,102,111,108,108,111,119,101,100,32,98,
+121,38,97,109,112,59,109,100,97,115,104,59,32,116,104,101,116,104,101,32,97,112,
+112,108,105,99,97,116,105,111,110,106,115,34,62,60,47,115,99,114,105,112,116,62,
+13,10,117,108,62,60,47,100,105,118,62,60,47,100,105,118,62,97,102,116,101,114,32
+,116,104,101,32,100,101,97,116,104,119,105,116,104,32,114,101,115,112,101,99,116
+,32,116,111,115,116,121,108,101,61,34,112,97,100,100,105,110,103,58,105,115,32,
+112,97,114,116,105,99,117,108,97,114,108,121,100,105,115,112,108,97,121,58,105,
+110,108,105,110,101,59,32,116,121,112,101,61,34,115,117,98,109,105,116,34,32,105
+,115,32,100,105,118,105,100,101,100,32,105,110,116,111,228,184,173,230,150,135,
+32,40,231,174,128,228,189,147,41,114,101,115,112,111,110,115,97,98,105,108,105,
+100,97,100,97,100,109,105,110,105,115,116,114,97,99,105,195,179,110,105,110,116,
+101,114,110,97,99,105,111,110,97,108,101,115,99,111,114,114,101,115,112,111,110,
+100,105,101,110,116,101,224,164,137,224,164,170,224,164,175,224,165,139,224,164,
+151,224,164,170,224,165,130,224,164,176,224,165,141,224,164,181,224,164,185,224,
+164,174,224,164,190,224,164,176,224,165,135,224,164,178,224,165,139,224,164,151,
+224,165,139,224,164,130,224,164,154,224,165,129,224,164,168,224,164,190,224,164,
+181,224,164,178,224,165,135,224,164,149,224,164,191,224,164,168,224,164,184,224,
+164,176,224,164,149,224,164,190,224,164,176,224,164,170,224,165,129,224,164,178,
+224,164,191,224,164,184,224,164,150,224,165,139,224,164,156,224,165,135,224,164,
+130,224,164,154,224,164,190,224,164,185,224,164,191,224,164,143,224,164,173,224,
+165,135,224,164,156,224,165,135,224,164,130,224,164,182,224,164,190,224,164,174,
+224,164,191,224,164,178,224,164,185,224,164,174,224,164,190,224,164,176,224,165,
+128,224,164,156,224,164,190,224,164,151,224,164,176,224,164,163,224,164,172,224,
+164,168,224,164,190,224,164,168,224,165,135,224,164,149,224,165,129,224,164,174,
+224,164,190,224,164,176,224,164,172,224,165,141,224,164,178,224,165,137,224,164,
+151,224,164,174,224,164,190,224,164,178,224,164,191,224,164,149,224,164,174,224,
+164,185,224,164,191,224,164,178,224,164,190,224,164,170,224,165,131,224,164,183,
+224,165,141,224,164,160,224,164,172,224,164,162,224,164,188,224,164,164,224,165,
+135,224,164,173,224,164,190,224,164,156,224,164,170,224,164,190,224,164,149,224,
+165,141,224,164,178,224,164,191,224,164,149,224,164,159,224,165,141,224,164,176,
+224,165,135,224,164,168,224,164,150,224,164,191,224,164,178,224,164,190,224,164,
+171,224,164,166,224,165,140,224,164,176,224,164,190,224,164,168,224,164,174,224,
+164,190,224,164,174,224,164,178,224,165,135,224,164,174,224,164,164,224,164,166,
+224,164,190,224,164,168,224,164,172,224,164,190,224,164,156,224,164,190,224,164,
+176,224,164,181,224,164,191,224,164,149,224,164,190,224,164,184,224,164,149,224,
+165,141,224,164,175,224,165,139,224,164,130,224,164,154,224,164,190,224,164,185,
+224,164,164,224,165,135,224,164,170,224,164,185,224,165,129,224,164,129,224,164,
+154,224,164,172,224,164,164,224,164,190,224,164,175,224,164,190,224,164,184,224,
+164,130,224,164,181,224,164,190,224,164,166,224,164,166,224,165,135,224,164,150,
+224,164,168,224,165,135,224,164,170,224,164,191,224,164,155,224,164,178,224,165,
+135,224,164,181,224,164,191,224,164,182,224,165,135,224,164,183,224,164,176,224,
+164,190,224,164,156,224,165,141,224,164,175,224,164,137,224,164,164,224,165,141,
+224,164,164,224,164,176,224,164,174,224,165,129,224,164,130,224,164,172,224,164,
+136,224,164,166,224,165,139,224,164,168,224,165,139,224,164,130,224,164,137,224,
+164,170,224,164,149,224,164,176,224,164,163,224,164,170,224,164,162,224,164,188,
+224,165,135,224,164,130,224,164,184,224,165,141,224,164,165,224,164,191,224,164,
+164,224,164,171,224,164,191,224,164,178,224,165,141,224,164,174,224,164,174,224,
+165,129,224,164,150,224,165,141,224,164,175,224,164,133,224,164,154,224,165,141,
+224,164,155,224,164,190,224,164,155,224,165,130,224,164,159,224,164,164,224,165,
+128,224,164,184,224,164,130,224,164,151,224,165,128,224,164,164,224,164,156,224,
+164,190,224,164,143,224,164,151,224,164,190,224,164,181,224,164,191,224,164,173,
+224,164,190,224,164,151,224,164,152,224,164,163,224,165,141,224,164,159,224,165,
+135,224,164,166,224,165,130,224,164,184,224,164,176,224,165,135,224,164,166,224,
+164,191,224,164,168,224,165,139,224,164,130,224,164,185,224,164,164,224,165,141,
+224,164,175,224,164,190,224,164,184,224,165,135,224,164,149,224,165,141,224,164,
+184,224,164,151,224,164,190,224,164,130,224,164,167,224,165,128,224,164,181,224,
+164,191,224,164,182,224,165,141,224,164,181,224,164,176,224,164,190,224,164,164,
+224,165,135,224,164,130,224,164,166,224,165,136,224,164,159,224,165,141,224,164,
+184,224,164,168,224,164,149,224,165,141,224,164,182,224,164,190,224,164,184,224,
+164,190,224,164,174,224,164,168,224,165,135,224,164,133,224,164,166,224,164,190,
+224,164,178,224,164,164,224,164,172,224,164,191,224,164,156,224,164,178,224,165,
+128,224,164,170,224,165,129,224,164,176,224,165,130,224,164,183,224,164,185,224,
+164,191,224,164,130,224,164,166,224,165,128,224,164,174,224,164,191,224,164,164,
+224,165,141,224,164,176,224,164,149,224,164,181,224,164,191,224,164,164,224,164,
+190,224,164,176,224,165,129,224,164,170,224,164,175,224,165,135,224,164,184,224,
+165,141,224,164,165,224,164,190,224,164,168,224,164,149,224,164,176,224,165,139,
+224,164,161,224,164,188,224,164,174,224,165,129,224,164,149,224,165,141,224,164,
+164,224,164,175,224,165,139,224,164,156,224,164,168,224,164,190,224,164,149,224,
+165,131,224,164,170,224,164,175,224,164,190,224,164,170,224,165,139,224,164,184,
+224,165,141,224,164,159,224,164,152,224,164,176,224,165,135,224,164,178,224,165,
+130,224,164,149,224,164,190,224,164,176,224,165,141,224,164,175,224,164,181,224,
+164,191,224,164,154,224,164,190,224,164,176,224,164,184,224,165,130,224,164,154,
+224,164,168,224,164,190,224,164,174,224,165,130,224,164,178,224,165,141,224,164,
+175,224,164,166,224,165,135,224,164,150,224,165,135,224,164,130,224,164,185,224,
+164,174,224,165,135,224,164,182,224,164,190,224,164,184,224,165,141,224,164,149,
+224,165,130,224,164,178,224,164,174,224,165,136,224,164,130,224,164,168,224,165,
+135,224,164,164,224,165,136,224,164,175,224,164,190,224,164,176,224,164,156,224,
+164,191,224,164,184,224,164,149,224,165,135,114,115,115,43,120,109,108,34,32,116
+,105,116,108,101,61,34,45,116,121,112,101,34,32,99,111,110,116,101,110,116,61,34
+,116,105,116,108,101,34,32,99,111,110,116,101,110,116,61,34,97,116,32,116,104,
+101,32,115,97,109,101,32,116,105,109,101,46,106,115,34,62,60,47,115,99,114,105,
+112,116,62,10,60,34,32,109,101,116,104,111,100,61,34,112,111,115,116,34,32,60,47
+,115,112,97,110,62,60,47,97,62,60,47,108,105,62,118,101,114,116,105,99,97,108,45
+,97,108,105,103,110,58,116,47,106,113,117,101,114,121,46,109,105,110,46,106,115,
+34,62,46,99,108,105,99,107,40,102,117,110,99,116,105,111,110,40,32,115,116,121,
+108,101,61,34,112,97,100,100,105,110,103,45,125,41,40,41,59,10,60,47,115,99,114,
+105,112,116,62,10,60,47,115,112,97,110,62,60,97,32,104,114,101,102,61,34,60,97,
+32,104,114,101,102,61,34,104,116,116,112,58,47,47,41,59,32,114,101,116,117,114,
+110,32,102,97,108,115,101,59,116,101,120,116,45,100,101,99,111,114,97,116,105,
+111,110,58,32,115,99,114,111,108,108,105,110,103,61,34,110,111,34,32,98,111,114,
+100,101,114,45,99,111,108,108,97,112,115,101,58,97,115,115,111,99,105,97,116,101
+,100,32,119,105,116,104,32,66,97,104,97,115,97,32,73,110,100,111,110,101,115,105
+,97,69,110,103,108,105,115,104,32,108,97,110,103,117,97,103,101,60,116,101,120,
+116,32,120,109,108,58,115,112,97,99,101,61,46,103,105,102,34,32,98,111,114,100,
+101,114,61,34,48,34,60,47,98,111,100,121,62,10,60,47,104,116,109,108,62,10,111,
+118,101,114,102,108,111,119,58,104,105,100,100,101,110,59,105,109,103,32,115,114
+,99,61,34,104,116,116,112,58,47,47,97,100,100,69,118,101,110,116,76,105,115,116,
+101,110,101,114,114,101,115,112,111,110,115,105,98,108,101,32,102,111,114,32,115
+,46,106,115,34,62,60,47,115,99,114,105,112,116,62,10,47,102,97,118,105,99,111,
+110,46,105,99,111,34,32,47,62,111,112,101,114,97,116,105,110,103,32,115,121,115,
+116,101,109,34,32,115,116,121,108,101,61,34,119,105,100,116,104,58,49,116,97,114
+,103,101,116,61,34,95,98,108,97,110,107,34,62,83,116,97,116,101,32,85,110,105,
+118,101,114,115,105,116,121,116,101,120,116,45,97,108,105,103,110,58,108,101,102
+,116,59,10,100,111,99,117,109,101,110,116,46,119,114,105,116,101,40,44,32,105,
+110,99,108,117,100,105,110,103,32,116,104,101,32,97,114,111,117,110,100,32,116,
+104,101,32,119,111,114,108,100,41,59,13,10,60,47,115,99,114,105,112,116,62,13,10
+,60,34,32,115,116,121,108,101,61,34,104,101,105,103,104,116,58,59,111,118,101,
+114,102,108,111,119,58,104,105,100,100,101,110,109,111,114,101,32,105,110,102,
+111,114,109,97,116,105,111,110,97,110,32,105,110,116,101,114,110,97,116,105,111,
+110,97,108,97,32,109,101,109,98,101,114,32,111,102,32,116,104,101,32,111,110,101
+,32,111,102,32,116,104,101,32,102,105,114,115,116,99,97,110,32,98,101,32,102,111
+,117,110,100,32,105,110,32,60,47,100,105,118,62,10,9,9,60,47,100,105,118,62,10,
+100,105,115,112,108,97,121,58,32,110,111,110,101,59,34,62,34,32,47,62,10,60,108,
+105,110,107,32,114,101,108,61,34,10,32,32,40,102,117,110,99,116,105,111,110,40,
+41,32,123,116,104,101,32,49,53,116,104,32,99,101,110,116,117,114,121,46,112,114,
+101,118,101,110,116,68,101,102,97,117,108,116,40,108,97,114,103,101,32,110,117,
+109,98,101,114,32,111,102,32,66,121,122,97,110,116,105,110,101,32,69,109,112,105
+,114,101,46,106,112,103,124,116,104,117,109,98,124,108,101,102,116,124,118,97,
+115,116,32,109,97,106,111,114,105,116,121,32,111,102,109,97,106,111,114,105,116,
+121,32,111,102,32,116,104,101,32,32,97,108,105,103,110,61,34,99,101,110,116,101,
+114,34,62,85,110,105,118,101,114,115,105,116,121,32,80,114,101,115,115,100,111,
+109,105,110,97,116,101,100,32,98,121,32,116,104,101,83,101,99,111,110,100,32,87,
+111,114,108,100,32,87,97,114,100,105,115,116,114,105,98,117,116,105,111,110,32,
+111,102,32,115,116,121,108,101,61,34,112,111,115,105,116,105,111,110,58,116,104,
+101,32,114,101,115,116,32,111,102,32,116,104,101,32,99,104,97,114,97,99,116,101,
+114,105,122,101,100,32,98,121,32,114,101,108,61,34,110,111,102,111,108,108,111,
+119,34,62,100,101,114,105,118,101,115,32,102,114,111,109,32,116,104,101,114,97,
+116,104,101,114,32,116,104,97,110,32,116,104,101,32,97,32,99,111,109,98,105,110,
+97,116,105,111,110,32,111,102,115,116,121,108,101,61,34,119,105,100,116,104,58,
+49,48,48,69,110,103,108,105,115,104,45,115,112,101,97,107,105,110,103,99,111,109
+,112,117,116,101,114,32,115,99,105,101,110,99,101,98,111,114,100,101,114,61,34,
+48,34,32,97,108,116,61,34,116,104,101,32,101,120,105,115,116,101,110,99,101,32,
+111,102,68,101,109,111,99,114,97,116,105,99,32,80,97,114,116,121,34,32,115,116,
+121,108,101,61,34,109,97,114,103,105,110,45,70,111,114,32,116,104,105,115,32,114
+,101,97,115,111,110,44,46,106,115,34,62,60,47,115,99,114,105,112,116,62,10,9,115
+,66,121,84,97,103,78,97,109,101,40,115,41,91,48,93,106,115,34,62,60,47,115,99,
+114,105,112,116,62,13,10,60,46,106,115,34,62,60,47,115,99,114,105,112,116,62,13,
+10,108,105,110,107,32,114,101,108,61,34,105,99,111,110,34,32,39,32,97,108,116,61
+,39,39,32,99,108,97,115,115,61,39,102,111,114,109,97,116,105,111,110,32,111,102,
+32,116,104,101,118,101,114,115,105,111,110,115,32,111,102,32,116,104,101,32,60,
+47,97,62,60,47,100,105,118,62,60,47,100,105,118,62,47,112,97,103,101,62,10,32,32
+,60,112,97,103,101,62,10,60,100,105,118,32,99,108,97,115,115,61,34,99,111,110,
+116,98,101,99,97,109,101,32,116,104,101,32,102,105,114,115,116,98,97,104,97,115,
+97,32,73,110,100,111,110,101,115,105,97,101,110,103,108,105,115,104,32,40,115,
+105,109,112,108,101,41,206,149,206,187,206,187,206,183,206,189,206,185,206,186,
+206,172,209,133,209,128,208,178,208,176,209,130,209,129,208,186,208,184,208,186,
+208,190,208,188,208,191,208,176,208,189,208,184,208,184,209,143,208,178,208,187,
+209,143,208,181,209,130,209,129,209,143,208,148,208,190,208,177,208,176,208,178,
+208,184,209,130,209,140,209,135,208,181,208,187,208,190,208,178,208,181,208,186,
+208,176,209,128,208,176,208,183,208,178,208,184,209,130,208,184,209,143,208,152,
+208,189,209,130,208,181,209,128,208,189,208,181,209,130,208,158,209,130,208,178,
+208,181,209,130,208,184,209,130,209,140,208,189,208,176,208,191,209,128,208,184,
+208,188,208,181,209,128,208,184,208,189,209,130,208,181,209,128,208,189,208,181,
+209,130,208,186,208,190,209,130,208,190,209,128,208,190,208,179,208,190,209,129,
+209,130,209,128,208,176,208,189,208,184,209,134,209,139,208,186,208,176,209,135,
+208,181,209,129,209,130,208,178,208,181,209,131,209,129,208,187,208,190,208,178,
+208,184,209,143,209,133,208,191,209,128,208,190,208,177,208,187,208,181,208,188,
+209,139,208,191,208,190,208,187,209,131,209,135,208,184,209,130,209,140,209,143,
+208,178,208,187,209,143,209,142,209,130,209,129,209,143,208,189,208,176,208,184,
+208,177,208,190,208,187,208,181,208,181,208,186,208,190,208,188,208,191,208,176,
+208,189,208,184,209,143,208,178,208,189,208,184,208,188,208,176,208,189,208,184,
+208,181,209,129,209,128,208,181,208,180,209,129,209,130,208,178,208,176,216,167,
+217,132,217,133,217,136,216,167,216,182,217,138,216,185,216,167,217,132,216,177,
+216,166,217,138,216,179,217,138,216,169,216,167,217,132,216,167,217,134,216,170,
+217,130,216,167,217,132,217,133,216,180,216,167,216,177,217,131,216,167,216,170,
+217,131,216,167,217,132,216,179,217,138,216,167,216,177,216,167,216,170,216,167,
+217,132,217,133,217,131,216,170,217,136,216,168,216,169,216,167,217,132,216,179,
+216,185,217,136,216,175,217,138,216,169,216,167,216,173,216,181,216,167,216,166,
+217,138,216,167,216,170,216,167,217,132,216,185,216,167,217,132,217,133,217,138,
+216,169,216,167,217,132,216,181,217,136,216,170,217,138,216,167,216,170,216,167,
+217,132,216,167,217,134,216,170,216,177,217,134,216,170,216,167,217,132,216,170,
+216,181,216,167,217,133,217,138,217,133,216,167,217,132,216,165,216,179,217,132,
+216,167,217,133,217,138,216,167,217,132,217,133,216,180,216,167,216,177,217,131,
+216,169,216,167,217,132,217,133,216,177,216,166,217,138,216,167,216,170,114,111,
+98,111,116,115,34,32,99,111,110,116,101,110,116,61,34,60,100,105,118,32,105,100,
+61,34,102,111,111,116,101,114,34,62,116,104,101,32,85,110,105,116,101,100,32,83,
+116,97,116,101,115,60,105,109,103,32,115,114,99,61,34,104,116,116,112,58,47,47,
+46,106,112,103,124,114,105,103,104,116,124,116,104,117,109,98,124,46,106,115,34,
+62,60,47,115,99,114,105,112,116,62,13,10,60,108,111,99,97,116,105,111,110,46,112
+,114,111,116,111,99,111,108,102,114,97,109,101,98,111,114,100,101,114,61,34,48,
+34,32,115,34,32,47,62,10,60,109,101,116,97,32,110,97,109,101,61,34,60,47,97,62,
+60,47,100,105,118,62,60,47,100,105,118,62,60,102,111,110,116,45,119,101,105,103,
+104,116,58,98,111,108,100,59,38,113,117,111,116,59,32,97,110,100,32,38,113,117,
+111,116,59,100,101,112,101,110,100,105,110,103,32,111,110,32,116,104,101,32,109,
+97,114,103,105,110,58,48,59,112,97,100,100,105,110,103,58,34,32,114,101,108,61,
+34,110,111,102,111,108,108,111,119,34,32,80,114,101,115,105,100,101,110,116,32,
+111,102,32,116,104,101,32,116,119,101,110,116,105,101,116,104,32,99,101,110,116,
+117,114,121,101,118,105,115,105,111,110,62,10,32,32,60,47,112,97,103,101,73,110,
+116,101,114,110,101,116,32,69,120,112,108,111,114,101,114,97,46,97,115,121,110,
+99,32,61,32,116,114,117,101,59,13,10,105,110,102,111,114,109,97,116,105,111,110,
+32,97,98,111,117,116,60,100,105,118,32,105,100,61,34,104,101,97,100,101,114,34,
+62,34,32,97,99,116,105,111,110,61,34,104,116,116,112,58,47,47,60,97,32,104,114,
+101,102,61,34,104,116,116,112,115,58,47,47,60,100,105,118,32,105,100,61,34,99,
+111,110,116,101,110,116,34,60,47,100,105,118,62,13,10,60,47,100,105,118,62,13,10
+,60,100,101,114,105,118,101,100,32,102,114,111,109,32,116,104,101,32,60,105,109,
+103,32,115,114,99,61,39,104,116,116,112,58,47,47,97,99,99,111,114,100,105,110,
+103,32,116,111,32,116,104,101,32,10,60,47,98,111,100,121,62,10,60,47,104,116,109
+,108,62,10,115,116,121,108,101,61,34,102,111,110,116,45,115,105,122,101,58,115,
+99,114,105,112,116,32,108,97,110,103,117,97,103,101,61,34,65,114,105,97,108,44,
+32,72,101,108,118,101,116,105,99,97,44,60,47,97,62,60,115,112,97,110,32,99,108,
+97,115,115,61,34,60,47,115,99,114,105,112,116,62,60,115,99,114,105,112,116,32,
+112,111,108,105,116,105,99,97,108,32,112,97,114,116,105,101,115,116,100,62,60,47
+,116,114,62,60,47,116,97,98,108,101,62,60,104,114,101,102,61,34,104,116,116,112,
+58,47,47,119,119,119,46,105,110,116,101,114,112,114,101,116,97,116,105,111,110,
+32,111,102,114,101,108,61,34,115,116,121,108,101,115,104,101,101,116,34,32,100,
+111,99,117,109,101,110,116,46,119,114,105,116,101,40,39,60,99,104,97,114,115,101
+,116,61,34,117,116,102,45,56,34,62,10,98,101,103,105,110,110,105,110,103,32,111,
+102,32,116,104,101,32,114,101,118,101,97,108,101,100,32,116,104,97,116,32,116,
+104,101,116,101,108,101,118,105,115,105,111,110,32,115,101,114,105,101,115,34,32
+,114,101,108,61,34,110,111,102,111,108,108,111,119,34,62,32,116,97,114,103,101,
+116,61,34,95,98,108,97,110,107,34,62,99,108,97,105,109,105,110,103,32,116,104,97
+,116,32,116,104,101,104,116,116,112,37,51,65,37,50,70,37,50,70,119,119,119,46,
+109,97,110,105,102,101,115,116,97,116,105,111,110,115,32,111,102,80,114,105,109,
+101,32,77,105,110,105,115,116,101,114,32,111,102,105,110,102,108,117,101,110,99,
+101,100,32,98,121,32,116,104,101,99,108,97,115,115,61,34,99,108,101,97,114,102,
+105,120,34,62,47,100,105,118,62,13,10,60,47,100,105,118,62,13,10,13,10,116,104,
+114,101,101,45,100,105,109,101,110,115,105,111,110,97,108,67,104,117,114,99,104,
+32,111,102,32,69,110,103,108,97,110,100,111,102,32,78,111,114,116,104,32,67,97,
+114,111,108,105,110,97,115,113,117,97,114,101,32,107,105,108,111,109,101,116,114
+,101,115,46,97,100,100,69,118,101,110,116,76,105,115,116,101,110,101,114,100,105
+,115,116,105,110,99,116,32,102,114,111,109,32,116,104,101,99,111,109,109,111,110
+,108,121,32,107,110,111,119,110,32,97,115,80,104,111,110,101,116,105,99,32,65,
+108,112,104,97,98,101,116,100,101,99,108,97,114,101,100,32,116,104,97,116,32,116
+,104,101,99,111,110,116,114,111,108,108,101,100,32,98,121,32,116,104,101,66,101,
+110,106,97,109,105,110,32,70,114,97,110,107,108,105,110,114,111,108,101,45,112,
+108,97,121,105,110,103,32,103,97,109,101,116,104,101,32,85,110,105,118,101,114,
+115,105,116,121,32,111,102,105,110,32,87,101,115,116,101,114,110,32,69,117,114,
+111,112,101,112,101,114,115,111,110,97,108,32,99,111,109,112,117,116,101,114,80,
+114,111,106,101,99,116,32,71,117,116,101,110,98,101,114,103,114,101,103,97,114,
+100,108,101,115,115,32,111,102,32,116,104,101,104,97,115,32,98,101,101,110,32,
+112,114,111,112,111,115,101,100,116,111,103,101,116,104,101,114,32,119,105,116,
+104,32,116,104,101,62,60,47,108,105,62,60,108,105,32,99,108,97,115,115,61,34,105
+,110,32,115,111,109,101,32,99,111,117,110,116,114,105,101,115,109,105,110,46,106
+,115,34,62,60,47,115,99,114,105,112,116,62,111,102,32,116,104,101,32,112,111,112
+,117,108,97,116,105,111,110,111,102,102,105,99,105,97,108,32,108,97,110,103,117,
+97,103,101,60,105,109,103,32,115,114,99,61,34,105,109,97,103,101,115,47,105,100,
+101,110,116,105,102,105,101,100,32,98,121,32,116,104,101,110,97,116,117,114,97,
+108,32,114,101,115,111,117,114,99,101,115,99,108,97,115,115,105,102,105,99,97,
+116,105,111,110,32,111,102,99,97,110,32,98,101,32,99,111,110,115,105,100,101,114
+,101,100,113,117,97,110,116,117,109,32,109,101,99,104,97,110,105,99,115,78,101,
+118,101,114,116,104,101,108,101,115,115,44,32,116,104,101,109,105,108,108,105,
+111,110,32,121,101,97,114,115,32,97,103,111,60,47,98,111,100,121,62,13,10,60,47,
+104,116,109,108,62,13,206,149,206,187,206,187,206,183,206,189,206,185,206,186,
+206,172,10,116,97,107,101,32,97,100,118,97,110,116,97,103,101,32,111,102,97,110,
+100,44,32,97,99,99,111,114,100,105,110,103,32,116,111,97,116,116,114,105,98,117,
+116,101,100,32,116,111,32,116,104,101,77,105,99,114,111,115,111,102,116,32,87,
+105,110,100,111,119,115,116,104,101,32,102,105,114,115,116,32,99,101,110,116,117
+,114,121,117,110,100,101,114,32,116,104,101,32,99,111,110,116,114,111,108,100,
+105,118,32,99,108,97,115,115,61,34,104,101,97,100,101,114,115,104,111,114,116,
+108,121,32,97,102,116,101,114,32,116,104,101,110,111,116,97,98,108,101,32,101,
+120,99,101,112,116,105,111,110,116,101,110,115,32,111,102,32,116,104,111,117,115
+,97,110,100,115,115,101,118,101,114,97,108,32,100,105,102,102,101,114,101,110,
+116,97,114,111,117,110,100,32,116,104,101,32,119,111,114,108,100,46,114,101,97,
+99,104,105,110,103,32,109,105,108,105,116,97,114,121,105,115,111,108,97,116,101,
+100,32,102,114,111,109,32,116,104,101,111,112,112,111,115,105,116,105,111,110,32
+,116,111,32,116,104,101,116,104,101,32,79,108,100,32,84,101,115,116,97,109,101,
+110,116,65,102,114,105,99,97,110,32,65,109,101,114,105,99,97,110,115,105,110,115
+,101,114,116,101,100,32,105,110,116,111,32,116,104,101,115,101,112,97,114,97,116
+,101,32,102,114,111,109,32,116,104,101,109,101,116,114,111,112,111,108,105,116,
+97,110,32,97,114,101,97,109,97,107,101,115,32,105,116,32,112,111,115,115,105,98,
+108,101,97,99,107,110,111,119,108,101,100,103,101,100,32,116,104,97,116,97,114,
+103,117,97,98,108,121,32,116,104,101,32,109,111,115,116,116,121,112,101,61,34,
+116,101,120,116,47,99,115,115,34,62,10,116,104,101,32,73,110,116,101,114,110,97,
+116,105,111,110,97,108,65,99,99,111,114,100,105,110,103,32,116,111,32,116,104,
+101,32,112,101,61,34,116,101,120,116,47,99,115,115,34,32,47,62,10,99,111,105,110
+,99,105,100,101,32,119,105,116,104,32,116,104,101,116,119,111,45,116,104,105,114
+,100,115,32,111,102,32,116,104,101,68,117,114,105,110,103,32,116,104,105,115,32,
+116,105,109,101,44,100,117,114,105,110,103,32,116,104,101,32,112,101,114,105,111
+,100,97,110,110,111,117,110,99,101,100,32,116,104,97,116,32,104,101,116,104,101,
+32,105,110,116,101,114,110,97,116,105,111,110,97,108,97,110,100,32,109,111,114,
+101,32,114,101,99,101,110,116,108,121,98,101,108,105,101,118,101,100,32,116,104,
+97,116,32,116,104,101,99,111,110,115,99,105,111,117,115,110,101,115,115,32,97,
+110,100,102,111,114,109,101,114,108,121,32,107,110,111,119,110,32,97,115,115,117
+,114,114,111,117,110,100,101,100,32,98,121,32,116,104,101,102,105,114,115,116,32
+,97,112,112,101,97,114,101,100,32,105,110,111,99,99,97,115,105,111,110,97,108,
+108,121,32,117,115,101,100,112,111,115,105,116,105,111,110,58,97,98,115,111,108,
+117,116,101,59,34,32,116,97,114,103,101,116,61,34,95,98,108,97,110,107,34,32,112
+,111,115,105,116,105,111,110,58,114,101,108,97,116,105,118,101,59,116,101,120,
+116,45,97,108,105,103,110,58,99,101,110,116,101,114,59,106,97,120,47,108,105,98,
+115,47,106,113,117,101,114,121,47,49,46,98,97,99,107,103,114,111,117,110,100,45,
+99,111,108,111,114,58,35,116,121,112,101,61,34,97,112,112,108,105,99,97,116,105,
+111,110,47,97,110,103,117,97,103,101,34,32,99,111,110,116,101,110,116,61,34,60,
+109,101,116,97,32,104,116,116,112,45,101,113,117,105,118,61,34,80,114,105,118,97
+,99,121,32,80,111,108,105,99,121,60,47,97,62,101,40,34,37,51,67,115,99,114,105,
+112,116,32,115,114,99,61,39,34,32,116,97,114,103,101,116,61,34,95,98,108,97,110,
+107,34,62,79,110,32,116,104,101,32,111,116,104,101,114,32,104,97,110,100,44,46,
+106,112,103,124,116,104,117,109,98,124,114,105,103,104,116,124,50,60,47,100,105,
+118,62,60,100,105,118,32,99,108,97,115,115,61,34,60,100,105,118,32,115,116,121,
+108,101,61,34,102,108,111,97,116,58,110,105,110,101,116,101,101,110,116,104,32,
+99,101,110,116,117,114,121,60,47,98,111,100,121,62,13,10,60,47,104,116,109,108,
+62,13,10,60,105,109,103,32,115,114,99,61,34,104,116,116,112,58,47,47,115,59,116,
+101,120,116,45,97,108,105,103,110,58,99,101,110,116,101,114,102,111,110,116,45,
+119,101,105,103,104,116,58,32,98,111,108,100,59,32,65,99,99,111,114,100,105,110,
+103,32,116,111,32,116,104,101,32,100,105,102,102,101,114,101,110,99,101,32,98,
+101,116,119,101,101,110,34,32,102,114,97,109,101,98,111,114,100,101,114,61,34,48
+,34,32,34,32,115,116,121,108,101,61,34,112,111,115,105,116,105,111,110,58,108,
+105,110,107,32,104,114,101,102,61,34,104,116,116,112,58,47,47,104,116,109,108,52
+,47,108,111,111,115,101,46,100,116,100,34,62,10,100,117,114,105,110,103,32,116,
+104,105,115,32,112,101,114,105,111,100,60,47,116,100,62,60,47,116,114,62,60,47,
+116,97,98,108,101,62,99,108,111,115,101,108,121,32,114,101,108,97,116,101,100,32
+,116,111,102,111,114,32,116,104,101,32,102,105,114,115,116,32,116,105,109,101,59
+,102,111,110,116,45,119,101,105,103,104,116,58,98,111,108,100,59,105,110,112,117
+,116,32,116,121,112,101,61,34,116,101,120,116,34,32,60,115,112,97,110,32,115,116
+,121,108,101,61,34,102,111,110,116,45,111,110,114,101,97,100,121,115,116,97,116,
+101,99,104,97,110,103,101,9,60,100,105,118,32,99,108,97,115,115,61,34,99,108,101
+,97,114,100,111,99,117,109,101,110,116,46,108,111,99,97,116,105,111,110,46,32,70
+,111,114,32,101,120,97,109,112,108,101,44,32,116,104,101,32,97,32,119,105,100,
+101,32,118,97,114,105,101,116,121,32,111,102,32,60,33,68,79,67,84,89,80,69,32,
+104,116,109,108,62,13,10,60,38,110,98,115,112,59,38,110,98,115,112,59,38,110,98,
+115,112,59,34,62,60,97,32,104,114,101,102,61,34,104,116,116,112,58,47,47,115,116
+,121,108,101,61,34,102,108,111,97,116,58,108,101,102,116,59,99,111,110,99,101,
+114,110,101,100,32,119,105,116,104,32,116,104,101,61,104,116,116,112,37,51,65,37
+,50,70,37,50,70,119,119,119,46,105,110,32,112,111,112,117,108,97,114,32,99,117,
+108,116,117,114,101,116,121,112,101,61,34,116,101,120,116,47,99,115,115,34,32,47
+,62,105,116,32,105,115,32,112,111,115,115,105,98,108,101,32,116,111,32,72,97,114
+,118,97,114,100,32,85,110,105,118,101,114,115,105,116,121,116,121,108,101,115,
+104,101,101,116,34,32,104,114,101,102,61,34,47,116,104,101,32,109,97,105,110,32,
+99,104,97,114,97,99,116,101,114,79,120,102,111,114,100,32,85,110,105,118,101,114
+,115,105,116,121,32,32,110,97,109,101,61,34,107,101,121,119,111,114,100,115,34,
+32,99,115,116,121,108,101,61,34,116,101,120,116,45,97,108,105,103,110,58,116,104
+,101,32,85,110,105,116,101,100,32,75,105,110,103,100,111,109,102,101,100,101,114
+,97,108,32,103,111,118,101,114,110,109,101,110,116,60,100,105,118,32,115,116,121
+,108,101,61,34,109,97,114,103,105,110,32,100,101,112,101,110,100,105,110,103,32,
+111,110,32,116,104,101,32,100,101,115,99,114,105,112,116,105,111,110,32,111,102,
+32,116,104,101,60,100,105,118,32,99,108,97,115,115,61,34,104,101,97,100,101,114,
+46,109,105,110,46,106,115,34,62,60,47,115,99,114,105,112,116,62,100,101,115,116,
+114,117,99,116,105,111,110,32,111,102,32,116,104,101,115,108,105,103,104,116,108
+,121,32,100,105,102,102,101,114,101,110,116,105,110,32,97,99,99,111,114,100,97,
+110,99,101,32,119,105,116,104,116,101,108,101,99,111,109,109,117,110,105,99,97,
+116,105,111,110,115,105,110,100,105,99,97,116,101,115,32,116,104,97,116,32,116,
+104,101,115,104,111,114,116,108,121,32,116,104,101,114,101,97,102,116,101,114,
+101,115,112,101,99,105,97,108,108,121,32,105,110,32,116,104,101,32,69,117,114,
+111,112,101,97,110,32,99,111,117,110,116,114,105,101,115,72,111,119,101,118,101,
+114,44,32,116,104,101,114,101,32,97,114,101,115,114,99,61,34,104,116,116,112,58,
+47,47,115,116,97,116,105,99,115,117,103,103,101,115,116,101,100,32,116,104,97,
+116,32,116,104,101,34,32,115,114,99,61,34,104,116,116,112,58,47,47,119,119,119,
+46,97,32,108,97,114,103,101,32,110,117,109,98,101,114,32,111,102,32,84,101,108,
+101,99,111,109,109,117,110,105,99,97,116,105,111,110,115,34,32,114,101,108,61,34
+,110,111,102,111,108,108,111,119,34,32,116,72,111,108,121,32,82,111,109,97,110,
+32,69,109,112,101,114,111,114,97,108,109,111,115,116,32,101,120,99,108,117,115,
+105,118,101,108,121,34,32,98,111,114,100,101,114,61,34,48,34,32,97,108,116,61,34
+,83,101,99,114,101,116,97,114,121,32,111,102,32,83,116,97,116,101,99,117,108,109
+,105,110,97,116,105,110,103,32,105,110,32,116,104,101,67,73,65,32,87,111,114,108
+,100,32,70,97,99,116,98,111,111,107,116,104,101,32,109,111,115,116,32,105,109,
+112,111,114,116,97,110,116,97,110,110,105,118,101,114,115,97,114,121,32,111,102,
+32,116,104,101,115,116,121,108,101,61,34,98,97,99,107,103,114,111,117,110,100,45
+,60,108,105,62,60,101,109,62,60,97,32,104,114,101,102,61,34,47,116,104,101,32,65
+,116,108,97,110,116,105,99,32,79,99,101,97,110,115,116,114,105,99,116,108,121,32
+,115,112,101,97,107,105,110,103,44,115,104,111,114,116,108,121,32,98,101,102,111
+,114,101,32,116,104,101,100,105,102,102,101,114,101,110,116,32,116,121,112,101,
+115,32,111,102,116,104,101,32,79,116,116,111,109,97,110,32,69,109,112,105,114,
+101,62,60,105,109,103,32,115,114,99,61,34,104,116,116,112,58,47,47,65,110,32,73,
+110,116,114,111,100,117,99,116,105,111,110,32,116,111,99,111,110,115,101,113,117
+,101,110,99,101,32,111,102,32,116,104,101,100,101,112,97,114,116,117,114,101,32,
+102,114,111,109,32,116,104,101,67,111,110,102,101,100,101,114,97,116,101,32,83,
+116,97,116,101,115,105,110,100,105,103,101,110,111,117,115,32,112,101,111,112,
+108,101,115,80,114,111,99,101,101,100,105,110,103,115,32,111,102,32,116,104,101,
+105,110,102,111,114,109,97,116,105,111,110,32,111,110,32,116,104,101,116,104,101
+,111,114,105,101,115,32,104,97,118,101,32,98,101,101,110,105,110,118,111,108,118
+,101,109,101,110,116,32,105,110,32,116,104,101,100,105,118,105,100,101,100,32,
+105,110,116,111,32,116,104,114,101,101,97,100,106,97,99,101,110,116,32,99,111,
+117,110,116,114,105,101,115,105,115,32,114,101,115,112,111,110,115,105,98,108,
+101,32,102,111,114,100,105,115,115,111,108,117,116,105,111,110,32,111,102,32,116
+,104,101,99,111,108,108,97,98,111,114,97,116,105,111,110,32,119,105,116,104,119,
+105,100,101,108,121,32,114,101,103,97,114,100,101,100,32,97,115,104,105,115,32,
+99,111,110,116,101,109,112,111,114,97,114,105,101,115,102,111,117,110,100,105,
+110,103,32,109,101,109,98,101,114,32,111,102,68,111,109,105,110,105,99,97,110,32
+,82,101,112,117,98,108,105,99,103,101,110,101,114,97,108,108,121,32,97,99,99,101
+,112,116,101,100,116,104,101,32,112,111,115,115,105,98,105,108,105,116,121,32,
+111,102,97,114,101,32,97,108,115,111,32,97,118,97,105,108,97,98,108,101,117,110,
+100,101,114,32,99,111,110,115,116,114,117,99,116,105,111,110,114,101,115,116,111
+,114,97,116,105,111,110,32,111,102,32,116,104,101,116,104,101,32,103,101,110,101
+,114,97,108,32,112,117,98,108,105,99,105,115,32,97,108,109,111,115,116,32,101,
+110,116,105,114,101,108,121,112,97,115,115,101,115,32,116,104,114,111,117,103,
+104,32,116,104,101,104,97,115,32,98,101,101,110,32,115,117,103,103,101,115,116,
+101,100,99,111,109,112,117,116,101,114,32,97,110,100,32,118,105,100,101,111,71,
+101,114,109,97,110,105,99,32,108,97,110,103,117,97,103,101,115,32,97,99,99,111,
+114,100,105,110,103,32,116,111,32,116,104,101,32,100,105,102,102,101,114,101,110
+,116,32,102,114,111,109,32,116,104,101,115,104,111,114,116,108,121,32,97,102,116
+,101,114,119,97,114,100,115,104,114,101,102,61,34,104,116,116,112,115,58,47,47,
+119,119,119,46,114,101,99,101,110,116,32,100,101,118,101,108,111,112,109,101,110
+,116,66,111,97,114,100,32,111,102,32,68,105,114,101,99,116,111,114,115,60,100,
+105,118,32,99,108,97,115,115,61,34,115,101,97,114,99,104,124,32,60,97,32,104,114
+,101,102,61,34,104,116,116,112,58,47,47,73,110,32,112,97,114,116,105,99,117,108,
+97,114,44,32,116,104,101,77,117,108,116,105,112,108,101,32,102,111,111,116,110,
+111,116,101,115,111,114,32,111,116,104,101,114,32,115,117,98,115,116,97,110,99,
+101,116,104,111,117,115,97,110,100,115,32,111,102,32,121,101,97,114,115,116,114,
+97,110,115,108,97,116,105,111,110,32,111,102,32,116,104,101,60,47,100,105,118,62
+,13,10,60,47,100,105,118,62,13,10,13,10,60,97,32,104,114,101,102,61,34,105,110,
+100,101,120,46,112,104,112,119,97,115,32,101,115,116,97,98,108,105,115,104,101,
+100,32,105,110,109,105,110,46,106,115,34,62,60,47,115,99,114,105,112,116,62,10,
+112,97,114,116,105,99,105,112,97,116,101,32,105,110,32,116,104,101,97,32,115,116
+,114,111,110,103,32,105,110,102,108,117,101,110,99,101,115,116,121,108,101,61,34
+,109,97,114,103,105,110,45,116,111,112,58,114,101,112,114,101,115,101,110,116,
+101,100,32,98,121,32,116,104,101,103,114,97,100,117,97,116,101,100,32,102,114,
+111,109,32,116,104,101,84,114,97,100,105,116,105,111,110,97,108,108,121,44,32,
+116,104,101,69,108,101,109,101,110,116,40,34,115,99,114,105,112,116,34,41,59,72,
+111,119,101,118,101,114,44,32,115,105,110,99,101,32,116,104,101,47,100,105,118,
+62,10,60,47,100,105,118,62,10,60,100,105,118,32,108,101,102,116,59,32,109,97,114
+,103,105,110,45,108,101,102,116,58,112,114,111,116,101,99,116,105,111,110,32,97,
+103,97,105,110,115,116,48,59,32,118,101,114,116,105,99,97,108,45,97,108,105,103,
+110,58,85,110,102,111,114,116,117,110,97,116,101,108,121,44,32,116,104,101,116,
+121,112,101,61,34,105,109,97,103,101,47,120,45,105,99,111,110,47,100,105,118,62,
+10,60,100,105,118,32,99,108,97,115,115,61,34,32,99,108,97,115,115,61,34,99,108,
+101,97,114,102,105,120,34,62,60,100,105,118,32,99,108,97,115,115,61,34,102,111,
+111,116,101,114,9,9,60,47,100,105,118,62,10,9,9,60,47,100,105,118,62,10,116,104,
+101,32,109,111,116,105,111,110,32,112,105,99,116,117,114,101,208,145,209,138,208
+,187,208,179,208,176,209,128,209,129,208,186,208,184,208,177,209,138,208,187,208
+,179,208,176,209,128,209,129,208,186,208,184,208,164,208,181,208,180,208,181,209
+,128,208,176,209,134,208,184,208,184,208,189,208,181,209,129,208,186,208,190,208
+,187,209,140,208,186,208,190,209,129,208,190,208,190,208,177,209,137,208,181,208
+,189,208,184,208,181,209,129,208,190,208,190,208,177,209,137,208,181,208,189,208
+,184,209,143,208,191,209,128,208,190,208,179,209,128,208,176,208,188,208,188,209
+,139,208,158,209,130,208,191,209,128,208,176,208,178,208,184,209,130,209,140,208
+,177,208,181,209,129,208,191,208,187,208,176,209,130,208,189,208,190,208,188,208
+,176,209,130,208,181,209,128,208,184,208,176,208,187,209,139,208,191,208,190,208
+,183,208,178,208,190,208,187,209,143,208,181,209,130,208,191,208,190,209,129,208
+,187,208,181,208,180,208,189,208,184,208,181,209,128,208,176,208,183,208,187,208
+,184,209,135,208,189,209,139,209,133,208,191,209,128,208,190,208,180,209,131,208
+,186,209,134,208,184,208,184,208,191,209,128,208,190,208,179,209,128,208,176,208
+,188,208,188,208,176,208,191,208,190,208,187,208,189,208,190,209,129,209,130,209
+,140,209,142,208,189,208,176,209,133,208,190,208,180,208,184,209,130,209,129,209
+,143,208,184,208,183,208,177,209,128,208,176,208,189,208,189,208,190,208,181,208
+,189,208,176,209,129,208,181,208,187,208,181,208,189,208,184,209,143,208,184,208
+,183,208,188,208,181,208,189,208,181,208,189,208,184,209,143,208,186,208,176,209
+,130,208,181,208,179,208,190,209,128,208,184,208,184,208,144,208,187,208,181,208
+,186,209,129,208,176,208,189,208,180,209,128,224,164,166,224,165,141,224,164,181
+,224,164,190,224,164,176,224,164,190,224,164,174,224,165,136,224,164,168,224,165
+,129,224,164,133,224,164,178,224,164,170,224,165,141,224,164,176,224,164,166,224
+,164,190,224,164,168,224,164,173,224,164,190,224,164,176,224,164,164,224,165,128
+,224,164,175,224,164,133,224,164,168,224,165,129,224,164,166,224,165,135,224,164
+,182,224,164,185,224,164,191,224,164,168,224,165,141,224,164,166,224,165,128,224
+,164,135,224,164,130,224,164,161,224,164,191,224,164,175,224,164,190,224,164,166
+,224,164,191,224,164,178,224,165,141,224,164,178,224,165,128,224,164,133,224,164
+,167,224,164,191,224,164,149,224,164,190,224,164,176,224,164,181,224,165,128,224
+,164,161,224,164,191,224,164,175,224,165,139,224,164,154,224,164,191,224,164,159
+,224,165,141,224,164,160,224,165,135,224,164,184,224,164,174,224,164,190,224,164
+,154,224,164,190,224,164,176,224,164,156,224,164,130,224,164,149,224,165,141,224
+,164,182,224,164,168,224,164,166,224,165,129,224,164,168,224,164,191,224,164,175
+,224,164,190,224,164,170,224,165,141,224,164,176,224,164,175,224,165,139,224,164
+,151,224,164,133,224,164,168,224,165,129,224,164,184,224,164,190,224,164,176,224
+,164,145,224,164,168,224,164,178,224,164,190,224,164,135,224,164,168,224,164,170
+,224,164,190,224,164,176,224,165,141,224,164,159,224,165,128,224,164,182,224,164
+,176,224,165,141,224,164,164,224,165,139,224,164,130,224,164,178,224,165,139,224
+,164,149,224,164,184,224,164,173,224,164,190,224,164,171,224,164,188,224,165,141
+,224,164,178,224,165,136,224,164,182,224,164,182,224,164,176,224,165,141,224,164
+,164,224,165,135,224,164,130,224,164,170,224,165,141,224,164,176,224,164,166,224
+,165,135,224,164,182,224,164,170,224,165,141,224,164,178,224,165,135,224,164,175
+,224,164,176,224,164,149,224,165,135,224,164,130,224,164,166,224,165,141,224,164
+,176,224,164,184,224,165,141,224,164,165,224,164,191,224,164,164,224,164,191,224
+,164,137,224,164,164,224,165,141,224,164,170,224,164,190,224,164,166,224,164,137
+,224,164,168,224,165,141,224,164,185,224,165,135,224,164,130,224,164,154,224,164
+,191,224,164,159,224,165,141,224,164,160,224,164,190,224,164,175,224,164,190,224
+,164,164,224,165,141,224,164,176,224,164,190,224,164,156,224,165,141,224,164,175
+,224,164,190,224,164,166,224,164,190,224,164,170,224,165,129,224,164,176,224,164
+,190,224,164,168,224,165,135,224,164,156,224,165,139,224,164,161,224,164,188,224
+,165,135,224,164,130,224,164,133,224,164,168,224,165,129,224,164,181,224,164,190
+,224,164,166,224,164,182,224,165,141,224,164,176,224,165,135,224,164,163,224,165
+,128,224,164,182,224,164,191,224,164,149,224,165,141,224,164,183,224,164,190,224
+,164,184,224,164,176,224,164,149,224,164,190,224,164,176,224,165,128,224,164,184
+,224,164,130,224,164,151,224,165,141,224,164,176,224,164,185,224,164,170,224,164
+,176,224,164,191,224,164,163,224,164,190,224,164,174,224,164,172,224,165,141,224
+,164,176,224,164,190,224,164,130,224,164,161,224,164,172,224,164,154,224,165,141
+,224,164,154,224,165,139,224,164,130,224,164,137,224,164,170,224,164,178,224,164
+,172,224,165,141,224,164,167,224,164,174,224,164,130,224,164,164,224,165,141,224
+,164,176,224,165,128,224,164,184,224,164,130,224,164,170,224,164,176,224,165,141
+,224,164,149,224,164,137,224,164,174,224,165,141,224,164,174,224,165,128,224,164
+,166,224,164,174,224,164,190,224,164,167,224,165,141,224,164,175,224,164,174,224
+,164,184,224,164,185,224,164,190,224,164,175,224,164,164,224,164,190,224,164,182
+,224,164,172,224,165,141,224,164,166,224,165,139,224,164,130,224,164,174,224,165
+,128,224,164,161,224,164,191,224,164,175,224,164,190,224,164,134,224,164,136,224
+,164,170,224,165,128,224,164,143,224,164,178,224,164,174,224,165,139,224,164,172
+,224,164,190,224,164,135,224,164,178,224,164,184,224,164,130,224,164,150,224,165
+,141,224,164,175,224,164,190,224,164,134,224,164,170,224,164,176,224,165,135,224
+,164,182,224,164,168,224,164,133,224,164,168,224,165,129,224,164,172,224,164,130
+,224,164,167,224,164,172,224,164,190,224,164,156,224,164,188,224,164,190,224,164
+,176,224,164,168,224,164,181,224,165,128,224,164,168,224,164,164,224,164,174,224
+,164,170,224,165,141,224,164,176,224,164,174,224,165,129,224,164,150,224,164,170
+,224,165,141,224,164,176,224,164,182,224,165,141,224,164,168,224,164,170,224,164
+,176,224,164,191,224,164,181,224,164,190,224,164,176,224,164,168,224,165,129,224
+,164,149,224,164,184,224,164,190,224,164,168,224,164,184,224,164,174,224,164,176
+,224,165,141,224,164,165,224,164,168,224,164,134,224,164,175,224,165,139,224,164
+,156,224,164,191,224,164,164,224,164,184,224,165,139,224,164,174,224,164,181,224
+,164,190,224,164,176,216,167,217,132,217,133,216,180,216,167,216,177,217,131,216
+,167,216,170,216,167,217,132,217,133,217,134,216,170,216,175,217,138,216,167,216
+,170,216,167,217,132,217,131,217,133,216,168,217,138,217,136,216,170,216,177,216
+,167,217,132,217,133,216,180,216,167,217,135,216,175,216,167,216,170,216,185,216
+,175,216,175,216,167,217,132,216,178,217,136,216,167,216,177,216,185,216,175,216
+,175,216,167,217,132,216,177,216,175,217,136,216,175,216,167,217,132,216,165,216
+,179,217,132,216,167,217,133,217,138,216,169,216,167,217,132,217,129,217,136,216
+,170,217,136,216,180,217,136,216,168,216,167,217,132,217,133,216,179,216,167,216
+,168,217,130,216,167,216,170,216,167,217,132,217,133,216,185,217,132,217,136,217
+,133,216,167,216,170,216,167,217,132,217,133,216,179,217,132,216,179,217,132,216
+,167,216,170,216,167,217,132,216,172,216,177,216,167,217,129,217,138,217,131,216
+,179,216,167,217,132,216,167,216,179,217,132,216,167,217,133,217,138,216,169,216
+,167,217,132,216,167,216,170,216,181,216,167,217,132,216,167,216,170,107,101,121
+,119,111,114,100,115,34,32,99,111,110,116,101,110,116,61,34,119,51,46,111,114,
+103,47,49,57,57,57,47,120,104,116,109,108,34,62,60,97,32,116,97,114,103,101,116,
+61,34,95,98,108,97,110,107,34,32,116,101,120,116,47,104,116,109,108,59,32,99,104
+,97,114,115,101,116,61,34,32,116,97,114,103,101,116,61,34,95,98,108,97,110,107,
+34,62,60,116,97,98,108,101,32,99,101,108,108,112,97,100,100,105,110,103,61,34,97
+,117,116,111,99,111,109,112,108,101,116,101,61,34,111,102,102,34,32,116,101,120,
+116,45,97,108,105,103,110,58,32,99,101,110,116,101,114,59,116,111,32,108,97,115,
+116,32,118,101,114,115,105,111,110,32,98,121,32,98,97,99,107,103,114,111,117,110
+,100,45,99,111,108,111,114,58,32,35,34,32,104,114,101,102,61,34,104,116,116,112,
+58,47,47,119,119,119,46,47,100,105,118,62,60,47,100,105,118,62,60,100,105,118,32
+,105,100,61,60,97,32,104,114,101,102,61,34,35,34,32,99,108,97,115,115,61,34,34,
+62,60,105,109,103,32,115,114,99,61,34,104,116,116,112,58,47,47,99,114,105,112,
+116,34,32,115,114,99,61,34,104,116,116,112,58,47,47,10,60,115,99,114,105,112,116
+,32,108,97,110,103,117,97,103,101,61,34,47,47,69,78,34,32,34,104,116,116,112,58,
+47,47,119,119,119,46,119,101,110,99,111,100,101,85,82,73,67,111,109,112,111,110,
+101,110,116,40,34,32,104,114,101,102,61,34,106,97,118,97,115,99,114,105,112,116,
+58,60,100,105,118,32,99,108,97,115,115,61,34,99,111,110,116,101,110,116,100,111,
+99,117,109,101,110,116,46,119,114,105,116,101,40,39,60,115,99,112,111,115,105,
+116,105,111,110,58,32,97,98,115,111,108,117,116,101,59,115,99,114,105,112,116,32
+,115,114,99,61,34,104,116,116,112,58,47,47,32,115,116,121,108,101,61,34,109,97,
+114,103,105,110,45,116,111,112,58,46,109,105,110,46,106,115,34,62,60,47,115,99,
+114,105,112,116,62,10,60,47,100,105,118,62,10,60,100,105,118,32,99,108,97,115,
+115,61,34,119,51,46,111,114,103,47,49,57,57,57,47,120,104,116,109,108,34,32,10,
+13,10,60,47,98,111,100,121,62,13,10,60,47,104,116,109,108,62,100,105,115,116,105
+,110,99,116,105,111,110,32,98,101,116,119,101,101,110,47,34,32,116,97,114,103,
+101,116,61,34,95,98,108,97,110,107,34,62,60,108,105,110,107,32,104,114,101,102,
+61,34,104,116,116,112,58,47,47,101,110,99,111,100,105,110,103,61,34,117,116,102,
+45,56,34,63,62,10,119,46,97,100,100,69,118,101,110,116,76,105,115,116,101,110,
+101,114,63,97,99,116,105,111,110,61,34,104,116,116,112,58,47,47,119,119,119,46,
+105,99,111,110,34,32,104,114,101,102,61,34,104,116,116,112,58,47,47,32,115,116,
+121,108,101,61,34,98,97,99,107,103,114,111,117,110,100,58,116,121,112,101,61,34,
+116,101,120,116,47,99,115,115,34,32,47,62,10,109,101,116,97,32,112,114,111,112,
+101,114,116,121,61,34,111,103,58,116,60,105,110,112,117,116,32,116,121,112,101,
+61,34,116,101,120,116,34,32,32,115,116,121,108,101,61,34,116,101,120,116,45,97,
+108,105,103,110,58,116,104,101,32,100,101,118,101,108,111,112,109,101,110,116,32
+,111,102,32,116,121,108,101,115,104,101,101,116,34,32,116,121,112,101,61,34,116,
+101,104,116,109,108,59,32,99,104,97,114,115,101,116,61,117,116,102,45,56,105,115
+,32,99,111,110,115,105,100,101,114,101,100,32,116,111,32,98,101,116,97,98,108,
+101,32,119,105,100,116,104,61,34,49,48,48,37,34,32,73,110,32,97,100,100,105,116,
+105,111,110,32,116,111,32,116,104,101,32,99,111,110,116,114,105,98,117,116,101,
+100,32,116,111,32,116,104,101,32,100,105,102,102,101,114,101,110,99,101,115,32,
+98,101,116,119,101,101,110,100,101,118,101,108,111,112,109,101,110,116,32,111,
+102,32,116,104,101,32,73,116,32,105,115,32,105,109,112,111,114,116,97,110,116,32
+,116,111,32,60,47,115,99,114,105,112,116,62,10,10,60,115,99,114,105,112,116,32,
+32,115,116,121,108,101,61,34,102,111,110,116,45,115,105,122,101,58,49,62,60,47,
+115,112,97,110,62,60,115,112,97,110,32,105,100,61,103,98,76,105,98,114,97,114,
+121,32,111,102,32,67,111,110,103,114,101,115,115,60,105,109,103,32,115,114,99,61
+,34,104,116,116,112,58,47,47,105,109,69,110,103,108,105,115,104,32,116,114,97,
+110,115,108,97,116,105,111,110,65,99,97,100,101,109,121,32,111,102,32,83,99,105,
+101,110,99,101,115,100,105,118,32,115,116,121,108,101,61,34,100,105,115,112,108,
+97,121,58,99,111,110,115,116,114,117,99,116,105,111,110,32,111,102,32,116,104,
+101,46,103,101,116,69,108,101,109,101,110,116,66,121,73,100,40,105,100,41,105,
+110,32,99,111,110,106,117,110,99,116,105,111,110,32,119,105,116,104,69,108,101,
+109,101,110,116,40,39,115,99,114,105,112,116,39,41,59,32,60,109,101,116,97,32,
+112,114,111,112,101,114,116,121,61,34,111,103,58,208,145,209,138,208,187,208,179
+,208,176,209,128,209,129,208,186,208,184,10,32,116,121,112,101,61,34,116,101,120
+,116,34,32,110,97,109,101,61,34,62,80,114,105,118,97,99,121,32,80,111,108,105,99
+,121,60,47,97,62,97,100,109,105,110,105,115,116,101,114,101,100,32,98,121,32,116
+,104,101,101,110,97,98,108,101,83,105,110,103,108,101,82,101,113,117,101,115,116
+,115,116,121,108,101,61,38,113,117,111,116,59,109,97,114,103,105,110,58,60,47,
+100,105,118,62,60,47,100,105,118,62,60,47,100,105,118,62,60,62,60,105,109,103,32
+,115,114,99,61,34,104,116,116,112,58,47,47,105,32,115,116,121,108,101,61,38,113,
+117,111,116,59,102,108,111,97,116,58,114,101,102,101,114,114,101,100,32,116,111,
+32,97,115,32,116,104,101,32,116,111,116,97,108,32,112,111,112,117,108,97,116,105
+,111,110,32,111,102,105,110,32,87,97,115,104,105,110,103,116,111,110,44,32,68,46
+,67,46,32,115,116,121,108,101,61,34,98,97,99,107,103,114,111,117,110,100,45,97,
+109,111,110,103,32,111,116,104,101,114,32,116,104,105,110,103,115,44,111,114,103
+,97,110,105,122,97,116,105,111,110,32,111,102,32,116,104,101,112,97,114,116,105,
+99,105,112,97,116,101,100,32,105,110,32,116,104,101,116,104,101,32,105,110,116,
+114,111,100,117,99,116,105,111,110,32,111,102,105,100,101,110,116,105,102,105,
+101,100,32,119,105,116,104,32,116,104,101,102,105,99,116,105,111,110,97,108,32,
+99,104,97,114,97,99,116,101,114,32,79,120,102,111,114,100,32,85,110,105,118,101,
+114,115,105,116,121,32,109,105,115,117,110,100,101,114,115,116,97,110,100,105,
+110,103,32,111,102,84,104,101,114,101,32,97,114,101,44,32,104,111,119,101,118,
+101,114,44,115,116,121,108,101,115,104,101,101,116,34,32,104,114,101,102,61,34,
+47,67,111,108,117,109,98,105,97,32,85,110,105,118,101,114,115,105,116,121,101,
+120,112,97,110,100,101,100,32,116,111,32,105,110,99,108,117,100,101,117,115,117,
+97,108,108,121,32,114,101,102,101,114,114,101,100,32,116,111,105,110,100,105,99,
+97,116,105,110,103,32,116,104,97,116,32,116,104,101,104,97,118,101,32,115,117,
+103,103,101,115,116,101,100,32,116,104,97,116,97,102,102,105,108,105,97,116,101,
+100,32,119,105,116,104,32,116,104,101,99,111,114,114,101,108,97,116,105,111,110,
+32,98,101,116,119,101,101,110,110,117,109,98,101,114,32,111,102,32,100,105,102,
+102,101,114,101,110,116,62,60,47,116,100,62,60,47,116,114,62,60,47,116,97,98,108
+,101,62,82,101,112,117,98,108,105,99,32,111,102,32,73,114,101,108,97,110,100,10,
+60,47,115,99,114,105,112,116,62,10,60,115,99,114,105,112,116,32,117,110,100,101,
+114,32,116,104,101,32,105,110,102,108,117,101,110,99,101,99,111,110,116,114,105,
+98,117,116,105,111,110,32,116,111,32,116,104,101,79,102,102,105,99,105,97,108,32
+,119,101,98,115,105,116,101,32,111,102,104,101,97,100,113,117,97,114,116,101,114
+,115,32,111,102,32,116,104,101,99,101,110,116,101,114,101,100,32,97,114,111,117,
+110,100,32,116,104,101,105,109,112,108,105,99,97,116,105,111,110,115,32,111,102,
+32,116,104,101,104,97,118,101,32,98,101,101,110,32,100,101,118,101,108,111,112,
+101,100,70,101,100,101,114,97,108,32,82,101,112,117,98,108,105,99,32,111,102,98,
+101,99,97,109,101,32,105,110,99,114,101,97,115,105,110,103,108,121,99,111,110,
+116,105,110,117,97,116,105,111,110,32,111,102,32,116,104,101,78,111,116,101,44,
+32,104,111,119,101,118,101,114,44,32,116,104,97,116,115,105,109,105,108,97,114,
+32,116,111,32,116,104,97,116,32,111,102,32,99,97,112,97,98,105,108,105,116,105,
+101,115,32,111,102,32,116,104,101,97,99,99,111,114,100,97,110,99,101,32,119,105,
+116,104,32,116,104,101,112,97,114,116,105,99,105,112,97,110,116,115,32,105,110,
+32,116,104,101,102,117,114,116,104,101,114,32,100,101,118,101,108,111,112,109,
+101,110,116,117,110,100,101,114,32,116,104,101,32,100,105,114,101,99,116,105,111
+,110,105,115,32,111,102,116,101,110,32,99,111,110,115,105,100,101,114,101,100,
+104,105,115,32,121,111,117,110,103,101,114,32,98,114,111,116,104,101,114,60,47,
+116,100,62,60,47,116,114,62,60,47,116,97,98,108,101,62,60,97,32,104,116,116,112,
+45,101,113,117,105,118,61,34,88,45,85,65,45,112,104,121,115,105,99,97,108,32,112
+,114,111,112,101,114,116,105,101,115,111,102,32,66,114,105,116,105,115,104,32,67
+,111,108,117,109,98,105,97,104,97,115,32,98,101,101,110,32,99,114,105,116,105,99
+,105,122,101,100,40,119,105,116,104,32,116,104,101,32,101,120,99,101,112,116,105
+,111,110,113,117,101,115,116,105,111,110,115,32,97,98,111,117,116,32,116,104,101
+,112,97,115,115,105,110,103,32,116,104,114,111,117,103,104,32,116,104,101,48,34,
+32,99,101,108,108,112,97,100,100,105,110,103,61,34,48,34,32,116,104,111,117,115,
+97,110,100,115,32,111,102,32,112,101,111,112,108,101,114,101,100,105,114,101,99,
+116,115,32,104,101,114,101,46,32,70,111,114,104,97,118,101,32,99,104,105,108,100
+,114,101,110,32,117,110,100,101,114,37,51,69,37,51,67,47,115,99,114,105,112,116,
+37,51,69,34,41,41,59,60,97,32,104,114,101,102,61,34,104,116,116,112,58,47,47,119
+,119,119,46,60,108,105,62,60,97,32,104,114,101,102,61,34,104,116,116,112,58,47,
+47,115,105,116,101,95,110,97,109,101,34,32,99,111,110,116,101,110,116,61,34,116,
+101,120,116,45,100,101,99,111,114,97,116,105,111,110,58,110,111,110,101,115,116,
+121,108,101,61,34,100,105,115,112,108,97,121,58,32,110,111,110,101,60,109,101,
+116,97,32,104,116,116,112,45,101,113,117,105,118,61,34,88,45,110,101,119,32,68,
+97,116,101,40,41,46,103,101,116,84,105,109,101,40,41,32,116,121,112,101,61,34,
+105,109,97,103,101,47,120,45,105,99,111,110,34,60,47,115,112,97,110,62,60,115,
+112,97,110,32,99,108,97,115,115,61,34,108,97,110,103,117,97,103,101,61,34,106,97
+,118,97,115,99,114,105,112,116,119,105,110,100,111,119,46,108,111,99,97,116,105,
+111,110,46,104,114,101,102,60,97,32,104,114,101,102,61,34,106,97,118,97,115,99,
+114,105,112,116,58,45,45,62,13,10,60,115,99,114,105,112,116,32,116,121,112,101,
+61,34,116,60,97,32,104,114,101,102,61,39,104,116,116,112,58,47,47,119,119,119,46
+,104,111,114,116,99,117,116,32,105,99,111,110,34,32,104,114,101,102,61,34,60,47,
+100,105,118,62,13,10,60,100,105,118,32,99,108,97,115,115,61,34,60,115,99,114,105
+,112,116,32,115,114,99,61,34,104,116,116,112,58,47,47,34,32,114,101,108,61,34,
+115,116,121,108,101,115,104,101,101,116,34,32,116,60,47,100,105,118,62,10,60,115
+,99,114,105,112,116,32,116,121,112,101,61,47,97,62,32,60,97,32,104,114,101,102,
+61,34,104,116,116,112,58,47,47,32,97,108,108,111,119,84,114,97,110,115,112,97,
+114,101,110,99,121,61,34,88,45,85,65,45,67,111,109,112,97,116,105,98,108,101,34,
+32,99,111,110,114,101,108,97,116,105,111,110,115,104,105,112,32,98,101,116,119,
+101,101,110,10,60,47,115,99,114,105,112,116,62,13,10,60,115,99,114,105,112,116,
+32,60,47,97,62,60,47,108,105,62,60,47,117,108,62,60,47,100,105,118,62,97,115,115
+,111,99,105,97,116,101,100,32,119,105,116,104,32,116,104,101,32,112,114,111,103,
+114,97,109,109,105,110,103,32,108,97,110,103,117,97,103,101,60,47,97,62,60,97,32
+,104,114,101,102,61,34,104,116,116,112,58,47,47,60,47,97,62,60,47,108,105,62,60,
+108,105,32,99,108,97,115,115,61,34,102,111,114,109,32,97,99,116,105,111,110,61,
+34,104,116,116,112,58,47,47,60,100,105,118,32,115,116,121,108,101,61,34,100,105,
+115,112,108,97,121,58,116,121,112,101,61,34,116,101,120,116,34,32,110,97,109,101
+,61,34,113,34,60,116,97,98,108,101,32,119,105,100,116,104,61,34,49,48,48,37,34,
+32,98,97,99,107,103,114,111,117,110,100,45,112,111,115,105,116,105,111,110,58,34
+,32,98,111,114,100,101,114,61,34,48,34,32,119,105,100,116,104,61,34,114,101,108,
+61,34,115,104,111,114,116,99,117,116,32,105,99,111,110,34,32,104,54,62,60,117,
+108,62,60,108,105,62,60,97,32,104,114,101,102,61,34,32,32,60,109,101,116,97,32,
+104,116,116,112,45,101,113,117,105,118,61,34,99,115,115,34,32,109,101,100,105,97
+,61,34,115,99,114,101,101,110,34,32,114,101,115,112,111,110,115,105,98,108,101,
+32,102,111,114,32,116,104,101,32,34,32,116,121,112,101,61,34,97,112,112,108,105,
+99,97,116,105,111,110,47,34,32,115,116,121,108,101,61,34,98,97,99,107,103,114,
+111,117,110,100,45,104,116,109,108,59,32,99,104,97,114,115,101,116,61,117,116,
+102,45,56,34,32,97,108,108,111,119,116,114,97,110,115,112,97,114,101,110,99,121,
+61,34,115,116,121,108,101,115,104,101,101,116,34,32,116,121,112,101,61,34,116,
+101,13,10,60,109,101,116,97,32,104,116,116,112,45,101,113,117,105,118,61,34,62,
+60,47,115,112,97,110,62,60,115,112,97,110,32,99,108,97,115,115,61,34,48,34,32,99
+,101,108,108,115,112,97,99,105,110,103,61,34,48,34,62,59,10,60,47,115,99,114,105
+,112,116,62,10,60,115,99,114,105,112,116,32,115,111,109,101,116,105,109,101,115,
+32,99,97,108,108,101,100,32,116,104,101,100,111,101,115,32,110,111,116,32,110,
+101,99,101,115,115,97,114,105,108,121,70,111,114,32,109,111,114,101,32,105,110,
+102,111,114,109,97,116,105,111,110,97,116,32,116,104,101,32,98,101,103,105,110,
+110,105,110,103,32,111,102,32,60,33,68,79,67,84,89,80,69,32,104,116,109,108,62,
+60,104,116,109,108,112,97,114,116,105,99,117,108,97,114,108,121,32,105,110,32,
+116,104,101,32,116,121,112,101,61,34,104,105,100,100,101,110,34,32,110,97,109,
+101,61,34,106,97,118,97,115,99,114,105,112,116,58,118,111,105,100,40,48,41,59,34
+,101,102,102,101,99,116,105,118,101,110,101,115,115,32,111,102,32,116,104,101,32
+,97,117,116,111,99,111,109,112,108,101,116,101,61,34,111,102,102,34,32,103,101,
+110,101,114,97,108,108,121,32,99,111,110,115,105,100,101,114,101,100,62,60,105,
+110,112,117,116,32,116,121,112,101,61,34,116,101,120,116,34,32,34,62,60,47,115,
+99,114,105,112,116,62,13,10,60,115,99,114,105,112,116,116,104,114,111,117,103,
+104,111,117,116,32,116,104,101,32,119,111,114,108,100,99,111,109,109,111,110,32,
+109,105,115,99,111,110,99,101,112,116,105,111,110,97,115,115,111,99,105,97,116,
+105,111,110,32,119,105,116,104,32,116,104,101,60,47,100,105,118,62,10,60,47,100,
+105,118,62,10,60,100,105,118,32,99,100,117,114,105,110,103,32,104,105,115,32,108
+,105,102,101,116,105,109,101,44,99,111,114,114,101,115,112,111,110,100,105,110,
+103,32,116,111,32,116,104,101,116,121,112,101,61,34,105,109,97,103,101,47,120,45
+,105,99,111,110,34,32,97,110,32,105,110,99,114,101,97,115,105,110,103,32,110,117
+,109,98,101,114,100,105,112,108,111,109,97,116,105,99,32,114,101,108,97,116,105,
+111,110,115,97,114,101,32,111,102,116,101,110,32,99,111,110,115,105,100,101,114,
+101,100,109,101,116,97,32,99,104,97,114,115,101,116,61,34,117,116,102,45,56,34,
+32,60,105,110,112,117,116,32,116,121,112,101,61,34,116,101,120,116,34,32,101,120
+,97,109,112,108,101,115,32,105,110,99,108,117,100,101,32,116,104,101,34,62,60,
+105,109,103,32,115,114,99,61,34,104,116,116,112,58,47,47,105,112,97,114,116,105,
+99,105,112,97,116,105,111,110,32,105,110,32,116,104,101,116,104,101,32,101,115,
+116,97,98,108,105,115,104,109,101,110,116,32,111,102,10,60,47,100,105,118,62,10,
+60,100,105,118,32,99,108,97,115,115,61,34,38,97,109,112,59,110,98,115,112,59,38,
+97,109,112,59,110,98,115,112,59,116,111,32,100,101,116,101,114,109,105,110,101,
+32,119,104,101,116,104,101,114,113,117,105,116,101,32,100,105,102,102,101,114,
+101,110,116,32,102,114,111,109,109,97,114,107,101,100,32,116,104,101,32,98,101,
+103,105,110,110,105,110,103,100,105,115,116,97,110,99,101,32,98,101,116,119,101,
+101,110,32,116,104,101,99,111,110,116,114,105,98,117,116,105,111,110,115,32,116,
+111,32,116,104,101,99,111,110,102,108,105,99,116,32,98,101,116,119,101,101,110,
+32,116,104,101,119,105,100,101,108,121,32,99,111,110,115,105,100,101,114,101,100
+,32,116,111,119,97,115,32,111,110,101,32,111,102,32,116,104,101,32,102,105,114,
+115,116,119,105,116,104,32,118,97,114,121,105,110,103,32,100,101,103,114,101,101
+,115,104,97,118,101,32,115,112,101,99,117,108,97,116,101,100,32,116,104,97,116,
+40,100,111,99,117,109,101,110,116,46,103,101,116,69,108,101,109,101,110,116,112,
+97,114,116,105,99,105,112,97,116,105,110,103,32,105,110,32,116,104,101,111,114,
+105,103,105,110,97,108,108,121,32,100,101,118,101,108,111,112,101,100,101,116,97
+,32,99,104,97,114,115,101,116,61,34,117,116,102,45,56,34,62,32,116,121,112,101,
+61,34,116,101,120,116,47,99,115,115,34,32,47,62,10,105,110,116,101,114,99,104,97
+,110,103,101,97,98,108,121,32,119,105,116,104,109,111,114,101,32,99,108,111,115,
+101,108,121,32,114,101,108,97,116,101,100,115,111,99,105,97,108,32,97,110,100,32
+,112,111,108,105,116,105,99,97,108,116,104,97,116,32,119,111,117,108,100,32,111,
+116,104,101,114,119,105,115,101,112,101,114,112,101,110,100,105,99,117,108,97,
+114,32,116,111,32,116,104,101,115,116,121,108,101,32,116,121,112,101,61,34,116,
+101,120,116,47,99,115,115,116,121,112,101,61,34,115,117,98,109,105,116,34,32,110
+,97,109,101,61,34,102,97,109,105,108,105,101,115,32,114,101,115,105,100,105,110,
+103,32,105,110,100,101,118,101,108,111,112,105,110,103,32,99,111,117,110,116,114
+,105,101,115,99,111,109,112,117,116,101,114,32,112,114,111,103,114,97,109,109,
+105,110,103,101,99,111,110,111,109,105,99,32,100,101,118,101,108,111,112,109,101
+,110,116,100,101,116,101,114,109,105,110,97,116,105,111,110,32,111,102,32,116,
+104,101,102,111,114,32,109,111,114,101,32,105,110,102,111,114,109,97,116,105,111
+,110,111,110,32,115,101,118,101,114,97,108,32,111,99,99,97,115,105,111,110,115,
+112,111,114,116,117,103,117,195,170,115,32,40,69,117,114,111,112,101,117,41,208,
+163,208,186,209,128,208,176,209,151,208,189,209,129,209,140,208,186,208,176,209,
+131,208,186,209,128,208,176,209,151,208,189,209,129,209,140,208,186,208,176,208,
+160,208,190,209,129,209,129,208,184,208,185,209,129,208,186,208,190,208,185,208,
+188,208,176,209,130,208,181,209,128,208,184,208,176,208,187,208,190,208,178,208,
+184,208,189,209,132,208,190,209,128,208,188,208,176,209,134,208,184,208,184,209,
+131,208,191,209,128,208,176,208,178,208,187,208,181,208,189,208,184,209,143,208,
+189,208,181,208,190,208,177,209,133,208,190,208,180,208,184,208,188,208,190,208,
+184,208,189,209,132,208,190,209,128,208,188,208,176,209,134,208,184,209,143,208,
+152,208,189,209,132,208,190,209,128,208,188,208,176,209,134,208,184,209,143,208,
+160,208,181,209,129,208,191,209,131,208,177,208,187,208,184,208,186,208,184,208,
+186,208,190,208,187,208,184,209,135,208,181,209,129,209,130,208,178,208,190,208,
+184,208,189,209,132,208,190,209,128,208,188,208,176,209,134,208,184,209,142,209,
+130,208,181,209,128,209,128,208,184,209,130,208,190,209,128,208,184,208,184,208,
+180,208,190,209,129,209,130,208,176,209,130,208,190,209,135,208,189,208,190,216,
+167,217,132,217,133,216,170,217,136,216,167,216,172,216,175,217,136,217,134,216,
+167,217,132,216,167,216,180,216,170,216,177,216,167,217,131,216,167,216,170,216,
+167,217,132,216,167,217,130,216,170,216,177,216,167,216,173,216,167,216,170,104,
+116,109,108,59,32,99,104,97,114,115,101,116,61,85,84,70,45,56,34,32,115,101,116,
+84,105,109,101,111,117,116,40,102,117,110,99,116,105,111,110,40,41,100,105,115,
+112,108,97,121,58,105,110,108,105,110,101,45,98,108,111,99,107,59,60,105,110,112
+,117,116,32,116,121,112,101,61,34,115,117,98,109,105,116,34,32,116,121,112,101,
+32,61,32,39,116,101,120,116,47,106,97,118,97,115,99,114,105,60,105,109,103,32,
+115,114,99,61,34,104,116,116,112,58,47,47,119,119,119,46,34,32,34,104,116,116,
+112,58,47,47,119,119,119,46,119,51,46,111,114,103,47,115,104,111,114,116,99,117,
+116,32,105,99,111,110,34,32,104,114,101,102,61,34,34,32,97,117,116,111,99,111,
+109,112,108,101,116,101,61,34,111,102,102,34,32,60,47,97,62,60,47,100,105,118,62
+,60,100,105,118,32,99,108,97,115,115,61,60,47,97,62,60,47,108,105,62,10,60,108,
+105,32,99,108,97,115,115,61,34,99,115,115,34,32,116,121,112,101,61,34,116,101,
+120,116,47,99,115,115,34,32,60,102,111,114,109,32,97,99,116,105,111,110,61,34,
+104,116,116,112,58,47,47,120,116,47,99,115,115,34,32,104,114,101,102,61,34,104,
+116,116,112,58,47,47,108,105,110,107,32,114,101,108,61,34,97,108,116,101,114,110
+,97,116,101,34,32,13,10,60,115,99,114,105,112,116,32,116,121,112,101,61,34,116,
+101,120,116,47,32,111,110,99,108,105,99,107,61,34,106,97,118,97,115,99,114,105,
+112,116,58,40,110,101,119,32,68,97,116,101,41,46,103,101,116,84,105,109,101,40,
+41,125,104,101,105,103,104,116,61,34,49,34,32,119,105,100,116,104,61,34,49,34,32
+,80,101,111,112,108,101,39,115,32,82,101,112,117,98,108,105,99,32,111,102,32,32,
+60,97,32,104,114,101,102,61,34,104,116,116,112,58,47,47,119,119,119,46,116,101,
+120,116,45,100,101,99,111,114,97,116,105,111,110,58,117,110,100,101,114,116,104,
+101,32,98,101,103,105,110,110,105,110,103,32,111,102,32,116,104,101,32,60,47,100
+,105,118,62,10,60,47,100,105,118,62,10,60,47,100,105,118,62,10,101,115,116,97,98
+,108,105,115,104,109,101,110,116,32,111,102,32,116,104,101,32,60,47,100,105,118,
+62,60,47,100,105,118,62,60,47,100,105,118,62,60,47,100,35,118,105,101,119,112,
+111,114,116,123,109,105,110,45,104,101,105,103,104,116,58,10,60,115,99,114,105,
+112,116,32,115,114,99,61,34,104,116,116,112,58,47,47,111,112,116,105,111,110,62,
+60,111,112,116,105,111,110,32,118,97,108,117,101,61,111,102,116,101,110,32,114,
+101,102,101,114,114,101,100,32,116,111,32,97,115,32,47,111,112,116,105,111,110,
+62,10,60,111,112,116,105,111,110,32,118,97,108,117,60,33,68,79,67,84,89,80,69,32
+,104,116,109,108,62,10,60,33,45,45,91,73,110,116,101,114,110,97,116,105,111,110,
+97,108,32,65,105,114,112,111,114,116,62,10,60,97,32,104,114,101,102,61,34,104,
+116,116,112,58,47,47,119,119,119,60,47,97,62,60,97,32,104,114,101,102,61,34,104,
+116,116,112,58,47,47,119,224,184,160,224,184,178,224,184,169,224,184,178,224,185
+,132,224,184,151,224,184,162,225,131,165,225,131,144,225,131,160,225,131,151,225
+,131,163,225,131,154,225,131,152,230,173,163,233,171,148,228,184,173,230,150,135
+,32,40,231,185,129,233,171,148,41,224,164,168,224,164,191,224,164,176,224,165,
+141,224,164,166,224,165,135,224,164,182,224,164,161,224,164,190,224,164,137,224,
+164,168,224,164,178,224,165,139,224,164,161,224,164,149,224,165,141,224,164,183,
+224,165,135,224,164,164,224,165,141,224,164,176,224,164,156,224,164,190,224,164,
+168,224,164,149,224,164,190,224,164,176,224,165,128,224,164,184,224,164,130,224,
+164,172,224,164,130,224,164,167,224,164,191,224,164,164,224,164,184,224,165,141,
+224,164,165,224,164,190,224,164,170,224,164,168,224,164,190,224,164,184,224,165,
+141,224,164,181,224,165,128,224,164,149,224,164,190,224,164,176,224,164,184,224,
+164,130,224,164,184,224,165,141,224,164,149,224,164,176,224,164,163,224,164,184,
+224,164,190,224,164,174,224,164,151,224,165,141,224,164,176,224,165,128,224,164,
+154,224,164,191,224,164,159,224,165,141,224,164,160,224,165,139,224,164,130,224,
+164,181,224,164,191,224,164,156,224,165,141,224,164,158,224,164,190,224,164,168,
+224,164,133,224,164,174,224,165,135,224,164,176,224,164,191,224,164,149,224,164,
+190,224,164,181,224,164,191,224,164,173,224,164,191,224,164,168,224,165,141,224,
+164,168,224,164,151,224,164,190,224,164,161,224,164,191,224,164,175,224,164,190,
+224,164,129,224,164,149,224,165,141,224,164,175,224,165,139,224,164,130,224,164,
+149,224,164,191,224,164,184,224,165,129,224,164,176,224,164,149,224,165,141,224,
+164,183,224,164,190,224,164,170,224,164,185,224,165,129,224,164,129,224,164,154,
+224,164,164,224,165,128,224,164,170,224,165,141,224,164,176,224,164,172,224,164,
+130,224,164,167,224,164,168,224,164,159,224,164,191,224,164,170,224,165,141,224,
+164,170,224,164,163,224,165,128,224,164,149,224,165,141,224,164,176,224,164,191,
+224,164,149,224,165,135,224,164,159,224,164,170,224,165,141,224,164,176,224,164,
+190,224,164,176,224,164,130,224,164,173,224,164,170,224,165,141,224,164,176,224,
+164,190,224,164,170,224,165,141,224,164,164,224,164,174,224,164,190,224,164,178,
+224,164,191,224,164,149,224,165,139,224,164,130,224,164,176,224,164,171,224,164,
+188,224,165,141,224,164,164,224,164,190,224,164,176,224,164,168,224,164,191,224,
+164,176,224,165,141,224,164,174,224,164,190,224,164,163,224,164,178,224,164,191,
+224,164,174,224,164,191,224,164,159,224,165,135,224,164,161,100,101,115,99,114,
+105,112,116,105,111,110,34,32,99,111,110,116,101,110,116,61,34,100,111,99,117,
+109,101,110,116,46,108,111,99,97,116,105,111,110,46,112,114,111,116,46,103,101,
+116,69,108,101,109,101,110,116,115,66,121,84,97,103,78,97,109,101,40,60,33,68,79
+,67,84,89,80,69,32,104,116,109,108,62,10,60,104,116,109,108,32,60,109,101,116,97
+,32,99,104,97,114,115,101,116,61,34,117,116,102,45,56,34,62,58,117,114,108,34,32
+,99,111,110,116,101,110,116,61,34,104,116,116,112,58,47,47,46,99,115,115,34,32,
+114,101,108,61,34,115,116,121,108,101,115,104,101,101,116,34,115,116,121,108,101
+,32,116,121,112,101,61,34,116,101,120,116,47,99,115,115,34,62,116,121,112,101,61
+,34,116,101,120,116,47,99,115,115,34,32,104,114,101,102,61,34,119,51,46,111,114,
+103,47,49,57,57,57,47,120,104,116,109,108,34,32,120,109,108,116,121,112,101,61,
+34,116,101,120,116,47,106,97,118,97,115,99,114,105,112,116,34,32,109,101,116,104
+,111,100,61,34,103,101,116,34,32,97,99,116,105,111,110,61,34,108,105,110,107,32,
+114,101,108,61,34,115,116,121,108,101,115,104,101,101,116,34,32,32,61,32,100,111
+,99,117,109,101,110,116,46,103,101,116,69,108,101,109,101,110,116,116,121,112,
+101,61,34,105,109,97,103,101,47,120,45,105,99,111,110,34,32,47,62,99,101,108,108
+,112,97,100,100,105,110,103,61,34,48,34,32,99,101,108,108,115,112,46,99,115,115,
+34,32,116,121,112,101,61,34,116,101,120,116,47,99,115,115,34,32,60,47,97,62,60,
+47,108,105,62,60,108,105,62,60,97,32,104,114,101,102,61,34,34,32,119,105,100,116
+,104,61,34,49,34,32,104,101,105,103,104,116,61,34,49,34,34,62,60,97,32,104,114,
+101,102,61,34,104,116,116,112,58,47,47,119,119,119,46,115,116,121,108,101,61,34,
+100,105,115,112,108,97,121,58,110,111,110,101,59,34,62,97,108,116,101,114,110,97
+,116,101,34,32,116,121,112,101,61,34,97,112,112,108,105,45,47,47,87,51,67,47,47,
+68,84,68,32,88,72,84,77,76,32,49,46,48,32,101,108,108,115,112,97,99,105,110,103,
+61,34,48,34,32,99,101,108,108,112,97,100,32,116,121,112,101,61,34,104,105,100,
+100,101,110,34,32,118,97,108,117,101,61,34,47,97,62,38,110,98,115,112,59,60,115,
+112,97,110,32,114,111,108,101,61,34,115,10,60,105,110,112,117,116,32,116,121,112
+,101,61,34,104,105,100,100,101,110,34,32,108,97,110,103,117,97,103,101,61,34,74,
+97,118,97,83,99,114,105,112,116,34,32,32,100,111,99,117,109,101,110,116,46,103,
+101,116,69,108,101,109,101,110,116,115,66,103,61,34,48,34,32,99,101,108,108,115,
+112,97,99,105,110,103,61,34,48,34,32,121,112,101,61,34,116,101,120,116,47,99,115
+,115,34,32,109,101,100,105,97,61,34,116,121,112,101,61,39,116,101,120,116,47,106
+,97,118,97,115,99,114,105,112,116,39,119,105,116,104,32,116,104,101,32,101,120,
+99,101,112,116,105,111,110,32,111,102,32,121,112,101,61,34,116,101,120,116,47,99
+,115,115,34,32,114,101,108,61,34,115,116,32,104,101,105,103,104,116,61,34,49,34,
+32,119,105,100,116,104,61,34,49,34,32,61,39,43,101,110,99,111,100,101,85,82,73,
+67,111,109,112,111,110,101,110,116,40,60,108,105,110,107,32,114,101,108,61,34,97
+,108,116,101,114,110,97,116,101,34,32,10,98,111,100,121,44,32,116,114,44,32,105,
+110,112,117,116,44,32,116,101,120,116,109,101,116,97,32,110,97,109,101,61,34,114
+,111,98,111,116,115,34,32,99,111,110,109,101,116,104,111,100,61,34,112,111,115,
+116,34,32,97,99,116,105,111,110,61,34,62,10,60,97,32,104,114,101,102,61,34,104,
+116,116,112,58,47,47,119,119,119,46,99,115,115,34,32,114,101,108,61,34,115,116,
+121,108,101,115,104,101,101,116,34,32,60,47,100,105,118,62,60,47,100,105,118,62,
+60,100,105,118,32,99,108,97,115,115,108,97,110,103,117,97,103,101,61,34,106,97,
+118,97,115,99,114,105,112,116,34,62,97,114,105,97,45,104,105,100,100,101,110,61,
+34,116,114,117,101,34,62,194,183,60,114,105,112,116,34,32,116,121,112,101,61,34,
+116,101,120,116,47,106,97,118,97,115,108,61,48,59,125,41,40,41,59,10,40,102,117,
+110,99,116,105,111,110,40,41,123,98,97,99,107,103,114,111,117,110,100,45,105,109
+,97,103,101,58,32,117,114,108,40,47,97,62,60,47,108,105,62,60,108,105,62,60,97,
+32,104,114,101,102,61,34,104,9,9,60,108,105,62,60,97,32,104,114,101,102,61,34,
+104,116,116,112,58,47,47,97,116,111,114,34,32,97,114,105,97,45,104,105,100,100,
+101,110,61,34,116,114,117,62,32,60,97,32,104,114,101,102,61,34,104,116,116,112,
+58,47,47,119,119,119,46,108,97,110,103,117,97,103,101,61,34,106,97,118,97,115,99
+,114,105,112,116,34,32,47,111,112,116,105,111,110,62,10,60,111,112,116,105,111,
+110,32,118,97,108,117,101,47,100,105,118,62,60,47,100,105,118,62,60,100,105,118,
+32,99,108,97,115,115,61,114,97,116,111,114,34,32,97,114,105,97,45,104,105,100,
+100,101,110,61,34,116,114,101,61,40,110,101,119,32,68,97,116,101,41,46,103,101,
+116,84,105,109,101,40,41,112,111,114,116,117,103,117,195,170,115,32,40,100,111,
+32,66,114,97,115,105,108,41,208,190,209,128,208,179,208,176,208,189,208,184,208,
+183,208,176,209,134,208,184,208,184,208,178,208,190,208,183,208,188,208,190,208,
+182,208,189,208,190,209,129,209,130,209,140,208,190,208,177,209,128,208,176,208,
+183,208,190,208,178,208,176,208,189,208,184,209,143,209,128,208,181,208,179,208,
+184,209,129,209,130,209,128,208,176,209,134,208,184,208,184,208,178,208,190,208,
+183,208,188,208,190,208,182,208,189,208,190,209,129,209,130,208,184,208,190,208,
+177,209,143,208,183,208,176,209,130,208,181,208,187,209,140,208,189,208,176,60,
+33,68,79,67,84,89,80,69,32,104,116,109,108,32,80,85,66,76,73,67,32,34,110,116,45
+,84,121,112,101,34,32,99,111,110,116,101,110,116,61,34,116,101,120,116,47,60,109
+,101,116,97,32,104,116,116,112,45,101,113,117,105,118,61,34,67,111,110,116,101,
+114,97,110,115,105,116,105,111,110,97,108,47,47,69,78,34,32,34,104,116,116,112,
+58,60,104,116,109,108,32,120,109,108,110,115,61,34,104,116,116,112,58,47,47,119,
+119,119,45,47,47,87,51,67,47,47,68,84,68,32,88,72,84,77,76,32,49,46,48,32,84,68,
+84,68,47,120,104,116,109,108,49,45,116,114,97,110,115,105,116,105,111,110,97,108
+,47,47,119,119,119,46,119,51,46,111,114,103,47,84,82,47,120,104,116,109,108,49,
+47,112,101,32,61,32,39,116,101,120,116,47,106,97,118,97,115,99,114,105,112,116,
+39,59,60,109,101,116,97,32,110,97,109,101,61,34,100,101,115,99,114,105,112,116,
+105,111,110,112,97,114,101,110,116,78,111,100,101,46,105,110,115,101,114,116,66,
+101,102,111,114,101,60,105,110,112,117,116,32,116,121,112,101,61,34,104,105,100,
+100,101,110,34,32,110,97,106,115,34,32,116,121,112,101,61,34,116,101,120,116,47,
+106,97,118,97,115,99,114,105,40,100,111,99,117,109,101,110,116,41,46,114,101,97,
+100,121,40,102,117,110,99,116,105,115,99,114,105,112,116,32,116,121,112,101,61,
+34,116,101,120,116,47,106,97,118,97,115,105,109,97,103,101,34,32,99,111,110,116,
+101,110,116,61,34,104,116,116,112,58,47,47,85,65,45,67,111,109,112,97,116,105,98
+,108,101,34,32,99,111,110,116,101,110,116,61,116,109,108,59,32,99,104,97,114,115
+,101,116,61,117,116,102,45,56,34,32,47,62,10,108,105,110,107,32,114,101,108,61,
+34,115,104,111,114,116,99,117,116,32,105,99,111,110,60,108,105,110,107,32,114,
+101,108,61,34,115,116,121,108,101,115,104,101,101,116,34,32,60,47,115,99,114,105
+,112,116,62,10,60,115,99,114,105,112,116,32,116,121,112,101,61,61,32,100,111,99,
+117,109,101,110,116,46,99,114,101,97,116,101,69,108,101,109,101,110,60,97,32,116
+,97,114,103,101,116,61,34,95,98,108,97,110,107,34,32,104,114,101,102,61,32,100,
+111,99,117,109,101,110,116,46,103,101,116,69,108,101,109,101,110,116,115,66,105,
+110,112,117,116,32,116,121,112,101,61,34,116,101,120,116,34,32,110,97,109,101,61
+,97,46,116,121,112,101,32,61,32,39,116,101,120,116,47,106,97,118,97,115,99,114,
+105,110,112,117,116,32,116,121,112,101,61,34,104,105,100,100,101,110,34,32,110,
+97,109,101,104,116,109,108,59,32,99,104,97,114,115,101,116,61,117,116,102,45,56,
+34,32,47,62,100,116,100,34,62,10,60,104,116,109,108,32,120,109,108,110,115,61,34
+,104,116,116,112,45,47,47,87,51,67,47,47,68,84,68,32,72,84,77,76,32,52,46,48,49,
+32,84,101,110,116,115,66,121,84,97,103,78,97,109,101,40,39,115,99,114,105,112,
+116,39,41,105,110,112,117,116,32,116,121,112,101,61,34,104,105,100,100,101,110,
+34,32,110,97,109,60,115,99,114,105,112,116,32,116,121,112,101,61,34,116,101,120,
+116,47,106,97,118,97,115,34,32,115,116,121,108,101,61,34,100,105,115,112,108,97,
+121,58,110,111,110,101,59,34,62,100,111,99,117,109,101,110,116,46,103,101,116,69
+,108,101,109,101,110,116,66,121,73,100,40,61,100,111,99,117,109,101,110,116,46,
+99,114,101,97,116,101,69,108,101,109,101,110,116,40,39,32,116,121,112,101,61,39,
+116,101,120,116,47,106,97,118,97,115,99,114,105,112,116,39,105,110,112,117,116,
+32,116,121,112,101,61,34,116,101,120,116,34,32,110,97,109,101,61,34,100,46,103,
+101,116,69,108,101,109,101,110,116,115,66,121,84,97,103,78,97,109,101,40,115,110
+,105,99,97,108,34,32,104,114,101,102,61,34,104,116,116,112,58,47,47,119,119,119,
+46,67,47,47,68,84,68,32,72,84,77,76,32,52,46,48,49,32,84,114,97,110,115,105,116,
+60,115,116,121,108,101,32,116,121,112,101,61,34,116,101,120,116,47,99,115,115,34
+,62,10,10,60,115,116,121,108,101,32,116,121,112,101,61,34,116,101,120,116,47,99,
+115,115,34,62,105,111,110,97,108,46,100,116,100,34,62,10,60,104,116,109,108,32,
+120,109,108,110,115,61,104,116,116,112,45,101,113,117,105,118,61,34,67,111,110,
+116,101,110,116,45,84,121,112,101,100,105,110,103,61,34,48,34,32,99,101,108,108,
+115,112,97,99,105,110,103,61,34,48,34,104,116,109,108,59,32,99,104,97,114,115,
+101,116,61,117,116,102,45,56,34,32,47,62,10,32,115,116,121,108,101,61,34,100,105
+,115,112,108,97,121,58,110,111,110,101,59,34,62,60,60,108,105,62,60,97,32,104,
+114,101,102,61,34,104,116,116,112,58,47,47,119,119,119,46,32,116,121,112,101,61,
+39,116,101,120,116,47,106,97,118,97,115,99,114,105,112,116,39,62,208,180,208,181
+,209,143,209,130,208,181,208,187,209,140,208,189,208,190,209,129,209,130,208,184
+,209,129,208,190,208,190,209,130,208,178,208,181,209,130,209,129,209,130,208,178
+,208,184,208,184,208,191,209,128,208,190,208,184,208,183,208,178,208,190,208,180
+,209,129,209,130,208,178,208,176,208,177,208,181,208,183,208,190,208,191,208,176
+,209,129,208,189,208,190,209,129,209,130,208,184,224,164,170,224,165,129,224,164
+,184,224,165,141,224,164,164,224,164,191,224,164,149,224,164,190,224,164,149,224
+,164,190,224,164,130,224,164,151,224,165,141,224,164,176,224,165,135,224,164,184
+,224,164,137,224,164,168,224,165,141,224,164,185,224,165,139,224,164,130,224,164
+,168,224,165,135,224,164,181,224,164,191,224,164,167,224,164,190,224,164,168,224
+,164,184,224,164,173,224,164,190,224,164,171,224,164,191,224,164,149,224,165,141
+,224,164,184,224,164,191,224,164,130,224,164,151,224,164,184,224,165,129,224,164
+,176,224,164,149,224,165,141,224,164,183,224,164,191,224,164,164,224,164,149,224
+,165,137,224,164,170,224,165,128,224,164,176,224,164,190,224,164,135,224,164,159
+,224,164,181,224,164,191,224,164,156,224,165,141,224,164,158,224,164,190,224,164
+,170,224,164,168,224,164,149,224,164,190,224,164,176,224,165,141,224,164,176,224
+,164,181,224,164,190,224,164,136,224,164,184,224,164,149,224,165,141,224,164,176
+,224,164,191,224,164,175,224,164,164,224,164,190
+}
+;
+#endif /* !BROTLI_EXTERNAL_DICTIONARY_DATA */
+
+static BrotliDictionary kBrotliDictionary = {
+ /* size_bits_by_length */
+ {
+ 0, 0, 0, 0, 10, 10, 11, 11,
+ 10, 10, 10, 10, 10, 9, 9, 8,
+ 7, 7, 8, 7, 7, 6, 6, 5,
+ 5, 0, 0, 0, 0, 0, 0, 0
+ },
+
+ /* offsets_by_length */
+ {
+ 0, 0, 0, 0, 0, 4096, 9216, 21504,
+ 35840, 44032, 53248, 63488, 74752, 87040, 93696, 100864,
+ 104704, 106752, 108928, 113536, 115968, 118528, 119872, 121280,
+ 122016, 122784, 122784, 122784, 122784, 122784, 122784, 122784
+ },
+
+ /* data_size == sizeof(kBrotliDictionaryData) */
+ 122784,
+
+ /* data */
+#ifdef BROTLI_EXTERNAL_DICTIONARY_DATA
+ NULL
+#else
+ kBrotliDictionaryData
+#endif
+};
+
+const BrotliDictionary* BrotliGetDictionary() {
+ return &kBrotliDictionary;
+}
+
+void BrotliSetDictionaryData(const uint8_t* data) {
+ if (!!data && !kBrotliDictionary.data) {
+ kBrotliDictionary.data = data;
+ }
+}
+
+#if defined(__cplusplus) || defined(c_plusplus)
+} /* extern "C" */
+#endif
diff --git a/Source/ThirdParty/brotli/common/dictionary.h b/Source/ThirdParty/brotli/common/dictionary.h
new file mode 100644
index 000000000..46fe533cc
--- /dev/null
+++ b/Source/ThirdParty/brotli/common/dictionary.h
@@ -0,0 +1,64 @@
+/* Copyright 2013 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/* Collection of static dictionary words. */
+
+#ifndef BROTLI_COMMON_DICTIONARY_H_
+#define BROTLI_COMMON_DICTIONARY_H_
+
+#include <brotli/port.h>
+#include <brotli/types.h>
+
+#if defined(__cplusplus) || defined(c_plusplus)
+extern "C" {
+#endif
+
+typedef struct BrotliDictionary {
+ /**
+ * Number of bits to encode index of dictionary word in a bucket.
+ *
+ * Specification: Appendix A. Static Dictionary Data
+ *
+ * Words in a dictionary are bucketed by length.
+ * @c 0 means that there are no words of a given length.
+ * Dictionary consists of words with length of [4..24] bytes.
+ * Values at [0..3] and [25..31] indices should not be addressed.
+ */
+ const uint8_t size_bits_by_length[32];
+
+ /* assert(offset[i + 1] == offset[i] + (bits[i] ? (i << bits[i]) : 0)) */
+ const uint32_t offsets_by_length[32];
+
+ /* assert(data_size == offsets_by_length[31]) */
+ const size_t data_size;
+
+ /* Data array is not bound, and should obey to size_bits_by_length values.
+ Specified size matches default (RFC 7932) dictionary. Its size is
+ defined by data_size */
+ const uint8_t* data;
+} BrotliDictionary;
+
+BROTLI_COMMON_API extern const BrotliDictionary* BrotliGetDictionary(void);
+
+/**
+ * Sets dictionary data.
+ *
+ * When dictionary data is already set / present, this method is no-op.
+ *
+ * Dictionary data MUST be provided before BrotliGetDictionary is invoked.
+ * This method is used ONLY in multi-client environment (e.g. C + Java),
+ * to reduce storage by sharing single dictionary between implementations.
+ */
+BROTLI_COMMON_API void BrotliSetDictionaryData(const uint8_t* data);
+
+#define BROTLI_MIN_DICTIONARY_WORD_LENGTH 4
+#define BROTLI_MAX_DICTIONARY_WORD_LENGTH 24
+
+#if defined(__cplusplus) || defined(c_plusplus)
+} /* extern "C" */
+#endif
+
+#endif /* BROTLI_COMMON_DICTIONARY_H_ */
diff --git a/Source/ThirdParty/brotli/common/version.h b/Source/ThirdParty/brotli/common/version.h
new file mode 100755
index 000000000..c63f685ce
--- /dev/null
+++ b/Source/ThirdParty/brotli/common/version.h
@@ -0,0 +1,19 @@
+/* Copyright 2016 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/* Version definition. */
+
+#ifndef BROTLI_COMMON_VERSION_H_
+#define BROTLI_COMMON_VERSION_H_
+
+/* This macro should only be used when library is compiled together with client.
+ If library is dynamically linked, use BrotliDecoderVersion and
+ BrotliEncoderVersion methods. */
+
+/* Semantic version, calculated as (MAJOR << 24) | (MINOR << 12) | PATCH */
+#define BROTLI_VERSION 0x1000001
+
+#endif /* BROTLI_COMMON_VERSION_H_ */
diff --git a/Source/ThirdParty/brotli/dec/bit_reader.c b/Source/ThirdParty/brotli/dec/bit_reader.c
index cde90af56..9925ba4b3 100644
--- a/Source/ThirdParty/brotli/dec/bit_reader.c
+++ b/Source/ThirdParty/brotli/dec/bit_reader.c
@@ -8,8 +8,8 @@
#include "./bit_reader.h"
+#include <brotli/types.h>
#include "./port.h"
-#include "./types.h"
#if defined(__cplusplus) || defined(c_plusplus)
extern "C" {
@@ -20,27 +20,27 @@ void BrotliInitBitReader(BrotliBitReader* const br) {
br->bit_pos_ = sizeof(br->val_) << 3;
}
-int BrotliWarmupBitReader(BrotliBitReader* const br) {
+BROTLI_BOOL BrotliWarmupBitReader(BrotliBitReader* const br) {
size_t aligned_read_mask = (sizeof(br->val_) >> 1) - 1;
/* Fixing alignment after unaligned BrotliFillWindow would result accumulator
overflow. If unalignment is caused by BrotliSafeReadBits, then there is
- enough space in accumulator to fix aligment. */
+ enough space in accumulator to fix alignment. */
if (!BROTLI_ALIGNED_READ) {
aligned_read_mask = 0;
}
if (BrotliGetAvailableBits(br) == 0) {
if (!BrotliPullByte(br)) {
- return 0;
+ return BROTLI_FALSE;
}
}
while ((((size_t)br->next_in) & aligned_read_mask) != 0) {
if (!BrotliPullByte(br)) {
/* If we consumed all the input, we don't care about the alignment. */
- return 1;
+ return BROTLI_TRUE;
}
}
- return 1;
+ return BROTLI_TRUE;
}
#if defined(__cplusplus) || defined(c_plusplus)
diff --git a/Source/ThirdParty/brotli/dec/bit_reader.h b/Source/ThirdParty/brotli/dec/bit_reader.h
index 7096afaa3..30e6761b2 100644
--- a/Source/ThirdParty/brotli/dec/bit_reader.h
+++ b/Source/ThirdParty/brotli/dec/bit_reader.h
@@ -11,20 +11,14 @@
#include <string.h> /* memcpy */
+#include <brotli/types.h>
#include "./port.h"
-#include "./types.h"
#if defined(__cplusplus) || defined(c_plusplus)
extern "C" {
#endif
-#if (BROTLI_64_BITS)
-#define BROTLI_SHORT_FILL_BIT_WINDOW_READ 4
-typedef uint64_t reg_t;
-#else
-#define BROTLI_SHORT_FILL_BIT_WINDOW_READ 2
-typedef uint32_t reg_t;
-#endif
+#define BROTLI_SHORT_FILL_BIT_WINDOW_READ (sizeof(reg_t) >> 1)
static const uint32_t kBitMask[33] = { 0x0000,
0x00000001, 0x00000003, 0x00000007, 0x0000000F,
@@ -61,14 +55,14 @@ typedef struct {
size_t avail_in;
} BrotliBitReaderState;
-/* Initializes the bitreader fields. */
+/* Initializes the BrotliBitReader fields. */
BROTLI_INTERNAL void BrotliInitBitReader(BrotliBitReader* const br);
/* Ensures that accumulator is not empty. May consume one byte of input.
Returns 0 if data is required but there is no input available.
For BROTLI_ALIGNED_READ this function also prepares bit reader for aligned
reading. */
-BROTLI_INTERNAL int BrotliWarmupBitReader(BrotliBitReader* const br);
+BROTLI_INTERNAL BROTLI_BOOL BrotliWarmupBitReader(BrotliBitReader* const br);
static BROTLI_INLINE void BrotliBitReaderSaveState(
BrotliBitReader* const from, BrotliBitReaderState* to) {
@@ -97,11 +91,11 @@ static BROTLI_INLINE size_t BrotliGetRemainingBytes(BrotliBitReader* br) {
return br->avail_in + (BrotliGetAvailableBits(br) >> 3);
}
-/* Checks if there is at least num bytes left in the input ringbuffer (excluding
- the bits remaining in br->val_). */
-static BROTLI_INLINE int BrotliCheckInputAmount(
+/* Checks if there is at least |num| bytes left in the input ring-buffer
+ (excluding the bits remaining in br->val_). */
+static BROTLI_INLINE BROTLI_BOOL BrotliCheckInputAmount(
BrotliBitReader* const br, size_t num) {
- return br->avail_in >= num;
+ return TO_BROTLI_BOOL(br->avail_in >= num);
}
static BROTLI_INLINE uint16_t BrotliLoad16LE(const uint8_t* in) {
@@ -163,7 +157,7 @@ static BROTLI_INLINE uint64_t BrotliLoad64LE(const uint8_t* in) {
/* Guarantees that there are at least n_bits + 1 bits in accumulator.
Precondition: accumulator contains at least 1 bit.
n_bits should be in the range [1..24] for regular build. For portable
- non-64-bit little endian build only 16 bits are safe to request. */
+ non-64-bit little-endian build only 16 bits are safe to request. */
static BROTLI_INLINE void BrotliFillBitWindow(
BrotliBitReader* const br, uint32_t n_bits) {
#if (BROTLI_64_BITS)
@@ -213,16 +207,16 @@ static BROTLI_INLINE void BrotliFillBitWindow(
#endif
}
-/* Mosltly like BrotliFillBitWindow, but guarantees only 16 bits and reads no
+/* Mostly like BrotliFillBitWindow, but guarantees only 16 bits and reads no
more than BROTLI_SHORT_FILL_BIT_WINDOW_READ bytes of input. */
static BROTLI_INLINE void BrotliFillBitWindow16(BrotliBitReader* const br) {
BrotliFillBitWindow(br, 17);
}
/* Pulls one byte of input to accumulator. */
-static BROTLI_INLINE int BrotliPullByte(BrotliBitReader* const br) {
+static BROTLI_INLINE BROTLI_BOOL BrotliPullByte(BrotliBitReader* const br) {
if (br->avail_in == 0) {
- return 0;
+ return BROTLI_FALSE;
}
br->val_ >>= 8;
#if (BROTLI_64_BITS)
@@ -233,11 +227,11 @@ static BROTLI_INLINE int BrotliPullByte(BrotliBitReader* const br) {
br->bit_pos_ -= 8;
--br->avail_in;
++br->next_in;
- return 1;
+ return BROTLI_TRUE;
}
/* Returns currently available bits.
- The number of valid bits could be calclulated by BrotliGetAvailableBits. */
+ The number of valid bits could be calculated by BrotliGetAvailableBits. */
static BROTLI_INLINE reg_t BrotliGetBitsUnmasked(BrotliBitReader* const br) {
return br->val_ >> br->bit_pos_;
}
@@ -250,7 +244,7 @@ static BROTLI_INLINE uint32_t BrotliGet16BitsUnmasked(
return (uint32_t)BrotliGetBitsUnmasked(br);
}
-/* Returns the specified number of bits from br without advancing bit pos. */
+/* Returns the specified number of bits from |br| without advancing bit pos. */
static BROTLI_INLINE uint32_t BrotliGetBits(
BrotliBitReader* const br, uint32_t n_bits) {
BrotliFillBitWindow(br, n_bits);
@@ -259,15 +253,15 @@ static BROTLI_INLINE uint32_t BrotliGetBits(
/* Tries to peek the specified amount of bits. Returns 0, if there is not
enough input. */
-static BROTLI_INLINE int BrotliSafeGetBits(
+static BROTLI_INLINE BROTLI_BOOL BrotliSafeGetBits(
BrotliBitReader* const br, uint32_t n_bits, uint32_t* val) {
while (BrotliGetAvailableBits(br) < n_bits) {
if (!BrotliPullByte(br)) {
- return 0;
+ return BROTLI_FALSE;
}
}
*val = (uint32_t)BrotliGetBitsUnmasked(br) & BitMask(n_bits);
- return 1;
+ return BROTLI_TRUE;
}
/* Advances the bit pos by n_bits. */
@@ -289,7 +283,7 @@ static BROTLI_INLINE void BrotliBitReaderUnload(BrotliBitReader* br) {
br->bit_pos_ += unused_bits;
}
-/* Reads the specified number of bits from br and advances the bit pos.
+/* Reads the specified number of bits from |br| and advances the bit pos.
Precondition: accumulator MUST contain at least n_bits. */
static BROTLI_INLINE void BrotliTakeBits(
BrotliBitReader* const br, uint32_t n_bits, uint32_t* val) {
@@ -299,7 +293,7 @@ static BROTLI_INLINE void BrotliTakeBits(
BrotliDropBits(br, n_bits);
}
-/* Reads the specified number of bits from br and advances the bit pos.
+/* Reads the specified number of bits from |br| and advances the bit pos.
Assumes that there is enough input to perform BrotliFillBitWindow. */
static BROTLI_INLINE uint32_t BrotliReadBits(
BrotliBitReader* const br, uint32_t n_bits) {
@@ -321,43 +315,26 @@ static BROTLI_INLINE uint32_t BrotliReadBits(
/* Tries to read the specified amount of bits. Returns 0, if there is not
enough input. n_bits MUST be positive. */
-static BROTLI_INLINE int BrotliSafeReadBits(
+static BROTLI_INLINE BROTLI_BOOL BrotliSafeReadBits(
BrotliBitReader* const br, uint32_t n_bits, uint32_t* val) {
while (BrotliGetAvailableBits(br) < n_bits) {
if (!BrotliPullByte(br)) {
- return 0;
+ return BROTLI_FALSE;
}
}
BrotliTakeBits(br, n_bits, val);
- return 1;
+ return BROTLI_TRUE;
}
/* Advances the bit reader position to the next byte boundary and verifies
that any skipped bits are set to zero. */
-static BROTLI_INLINE int BrotliJumpToByteBoundary(BrotliBitReader* br) {
+static BROTLI_INLINE BROTLI_BOOL BrotliJumpToByteBoundary(BrotliBitReader* br) {
uint32_t pad_bits_count = BrotliGetAvailableBits(br) & 0x7;
uint32_t pad_bits = 0;
if (pad_bits_count != 0) {
BrotliTakeBits(br, pad_bits_count, &pad_bits);
}
- return pad_bits == 0;
-}
-
-/* Peeks a byte at specified offset.
- Precondition: bit reader is parked to a byte boundary.
- Returns -1 if operation is not feasible. */
-static BROTLI_INLINE int BrotliPeekByte(BrotliBitReader* br, size_t offset) {
- uint32_t available_bits = BrotliGetAvailableBits(br);
- size_t bytes_left = available_bits >> 3;
- BROTLI_DCHECK((available_bits & 7) == 0);
- if (offset < bytes_left) {
- return (BrotliGetBitsUnmasked(br) >> (unsigned)(offset << 3)) & 0xFF;
- }
- offset -= bytes_left;
- if (offset < br->avail_in) {
- return br->next_in[offset];
- }
- return -1;
+ return TO_BROTLI_BOOL(pad_bits == 0);
}
/* Copies remaining input bytes stored in the bit reader to the output. Value
diff --git a/Source/ThirdParty/brotli/dec/context.h b/Source/ThirdParty/brotli/dec/context.h
index 37ebe6aeb..9402cbedf 100644
--- a/Source/ThirdParty/brotli/dec/context.h
+++ b/Source/ThirdParty/brotli/dec/context.h
@@ -99,7 +99,7 @@
#ifndef BROTLI_DEC_CONTEXT_H_
#define BROTLI_DEC_CONTEXT_H_
-#include "./types.h"
+#include <brotli/types.h>
enum ContextType {
CONTEXT_LSB6 = 0,
diff --git a/Source/ThirdParty/brotli/dec/decode.c b/Source/ThirdParty/brotli/dec/decode.c
index d184f24cb..be8de42fb 100644
--- a/Source/ThirdParty/brotli/dec/decode.c
+++ b/Source/ThirdParty/brotli/dec/decode.c
@@ -4,7 +4,7 @@
See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
*/
-#include "./decode.h"
+#include <brotli/decode.h>
#ifdef __ARM_NEON__
#include <arm_neon.h>
@@ -13,9 +13,11 @@
#include <stdlib.h> /* free, malloc */
#include <string.h> /* memcpy, memset */
+#include "../common/constants.h"
+#include "../common/dictionary.h"
+#include "../common/version.h"
#include "./bit_reader.h"
#include "./context.h"
-#include "./dictionary.h"
#include "./huffman.h"
#include "./port.h"
#include "./prefix.h"
@@ -34,19 +36,15 @@ extern "C" {
BROTLI_LOG(("[%s] %s[%lu] = %lu\n", __func__, #array_name, \
(unsigned long)(idx), (unsigned long)array_name[idx]))
-static const uint32_t kDefaultCodeLength = 8;
-static const uint32_t kCodeLengthRepeatCode = 16;
-static const uint32_t kNumLiteralCodes = 256;
-static const uint32_t kNumInsertAndCopyCodes = 704;
-static const uint32_t kNumBlockLengthCodes = 26;
-static const int kLiteralContextBits = 6;
-static const int kDistanceContextBits = 2;
-
#define HUFFMAN_TABLE_BITS 8U
#define HUFFMAN_TABLE_MASK 0xff
-#define CODE_LENGTH_CODES 18
-static const uint8_t kCodeLengthCodeOrder[CODE_LENGTH_CODES] = {
+/* We need the slack region for the following reasons:
+ - doing up to two 16-byte copies for fast backward copying
+ - inserting transformed dictionary word (5 prefix + 24 base + 8 suffix) */
+static const uint32_t kRingBufferWriteAheadSlack = 42;
+
+static const uint8_t kCodeLengthCodeOrder[BROTLI_CODE_LENGTH_CODES] = {
1, 2, 3, 4, 0, 5, 17, 6, 16, 7, 8, 9, 10, 11, 12, 13, 14, 15,
};
@@ -59,46 +57,59 @@ static const uint8_t kCodeLengthPrefixValue[16] = {
0, 4, 3, 2, 0, 4, 3, 1, 0, 4, 3, 2, 0, 4, 3, 5,
};
-#define NUM_DISTANCE_SHORT_CODES 16
+BROTLI_BOOL BrotliDecoderSetParameter(
+ BrotliDecoderState* state, BrotliDecoderParameter p, uint32_t value) {
+ switch (p) {
+ case BROTLI_DECODER_PARAM_DISABLE_RING_BUFFER_REALLOCATION:
+ state->canny_ringbuffer_allocation = !!value ? 0 : 1;
+ return BROTLI_TRUE;
+
+ default: return BROTLI_FALSE;
+ }
+}
-BrotliState* BrotliCreateState(
+BrotliDecoderState* BrotliDecoderCreateInstance(
brotli_alloc_func alloc_func, brotli_free_func free_func, void* opaque) {
- BrotliState* state = 0;
+ BrotliDecoderState* state = 0;
if (!alloc_func && !free_func) {
- state = (BrotliState*)malloc(sizeof(BrotliState));
+ state = (BrotliDecoderState*)malloc(sizeof(BrotliDecoderState));
} else if (alloc_func && free_func) {
- state = (BrotliState*)alloc_func(opaque, sizeof(BrotliState));
+ state = (BrotliDecoderState*)alloc_func(opaque, sizeof(BrotliDecoderState));
}
if (state == 0) {
BROTLI_DUMP();
return 0;
}
- BrotliStateInitWithCustomAllocators(state, alloc_func, free_func, opaque);
- state->error_code = BROTLI_NO_ERROR;
+ BrotliDecoderStateInitWithCustomAllocators(
+ state, alloc_func, free_func, opaque);
return state;
}
-/* Deinitializes and frees BrotliState instance. */
-void BrotliDestroyState(BrotliState* state) {
+/* Deinitializes and frees BrotliDecoderState instance. */
+void BrotliDecoderDestroyInstance(BrotliDecoderState* state) {
if (!state) {
return;
} else {
brotli_free_func free_func = state->free_func;
void* opaque = state->memory_manager_opaque;
- BrotliStateCleanup(state);
+ BrotliDecoderStateCleanup(state);
free_func(opaque, state);
}
}
-/* Saves error code and converts it to BrotliResult */
-static BROTLI_NOINLINE BrotliResult SaveErrorCode(
- BrotliState* s, BrotliErrorCode e) {
+/* Saves error code and converts it to BrotliDecoderResult */
+static BROTLI_NOINLINE BrotliDecoderResult SaveErrorCode(
+ BrotliDecoderState* s, BrotliDecoderErrorCode e) {
s->error_code = (int)e;
switch (e) {
- case BROTLI_SUCCESS: return BROTLI_RESULT_SUCCESS;
- case BROTLI_NEEDS_MORE_INPUT: return BROTLI_RESULT_NEEDS_MORE_INPUT;
- case BROTLI_NEEDS_MORE_OUTPUT: return BROTLI_RESULT_NEEDS_MORE_OUTPUT;
- default: return BROTLI_RESULT_ERROR;
+ case BROTLI_DECODER_SUCCESS:
+ return BROTLI_DECODER_RESULT_SUCCESS;
+ case BROTLI_DECODER_NEEDS_MORE_INPUT:
+ return BROTLI_DECODER_RESULT_NEEDS_MORE_INPUT;
+ case BROTLI_DECODER_NEEDS_MORE_OUTPUT:
+ return BROTLI_DECODER_RESULT_NEEDS_MORE_OUTPUT;
+ default:
+ return BROTLI_DECODER_RESULT_ERROR;
}
}
@@ -132,60 +143,61 @@ static BROTLI_INLINE void memmove16(uint8_t* dst, uint8_t* src) {
}
/* Decodes a number in the range [0..255], by reading 1 - 11 bits. */
-static BROTLI_NOINLINE BrotliErrorCode DecodeVarLenUint8(BrotliState* s,
- BrotliBitReader* br, uint32_t* value) {
+static BROTLI_NOINLINE BrotliDecoderErrorCode DecodeVarLenUint8(
+ BrotliDecoderState* s, BrotliBitReader* br, uint32_t* value) {
uint32_t bits;
switch (s->substate_decode_uint8) {
case BROTLI_STATE_DECODE_UINT8_NONE:
- if (PREDICT_FALSE(!BrotliSafeReadBits(br, 1, &bits))) {
- return BROTLI_NEEDS_MORE_INPUT;
+ if (BROTLI_PREDICT_FALSE(!BrotliSafeReadBits(br, 1, &bits))) {
+ return BROTLI_DECODER_NEEDS_MORE_INPUT;
}
if (bits == 0) {
*value = 0;
- return BROTLI_SUCCESS;
+ return BROTLI_DECODER_SUCCESS;
}
/* No break, transit to the next state. */
case BROTLI_STATE_DECODE_UINT8_SHORT:
- if (PREDICT_FALSE(!BrotliSafeReadBits(br, 3, &bits))) {
+ if (BROTLI_PREDICT_FALSE(!BrotliSafeReadBits(br, 3, &bits))) {
s->substate_decode_uint8 = BROTLI_STATE_DECODE_UINT8_SHORT;
- return BROTLI_NEEDS_MORE_INPUT;
+ return BROTLI_DECODER_NEEDS_MORE_INPUT;
}
if (bits == 0) {
*value = 1;
s->substate_decode_uint8 = BROTLI_STATE_DECODE_UINT8_NONE;
- return BROTLI_SUCCESS;
+ return BROTLI_DECODER_SUCCESS;
}
/* Use output value as a temporary storage. It MUST be persisted. */
*value = bits;
/* No break, transit to the next state. */
case BROTLI_STATE_DECODE_UINT8_LONG:
- if (PREDICT_FALSE(!BrotliSafeReadBits(br, *value, &bits))) {
+ if (BROTLI_PREDICT_FALSE(!BrotliSafeReadBits(br, *value, &bits))) {
s->substate_decode_uint8 = BROTLI_STATE_DECODE_UINT8_LONG;
- return BROTLI_NEEDS_MORE_INPUT;
+ return BROTLI_DECODER_NEEDS_MORE_INPUT;
}
*value = (1U << *value) + bits;
s->substate_decode_uint8 = BROTLI_STATE_DECODE_UINT8_NONE;
- return BROTLI_SUCCESS;
+ return BROTLI_DECODER_SUCCESS;
default:
- return BROTLI_FAILURE(BROTLI_ERROR_UNREACHABLE);
+ return
+ BROTLI_FAILURE(BROTLI_DECODER_ERROR_UNREACHABLE);
}
}
/* Decodes a metablock length and flags by reading 2 - 31 bits. */
-static BrotliErrorCode BROTLI_NOINLINE DecodeMetaBlockLength(
- BrotliState* s, BrotliBitReader* br) {
+static BrotliDecoderErrorCode BROTLI_NOINLINE DecodeMetaBlockLength(
+ BrotliDecoderState* s, BrotliBitReader* br) {
uint32_t bits;
int i;
for (;;) {
switch (s->substate_metablock_header) {
case BROTLI_STATE_METABLOCK_HEADER_NONE:
if (!BrotliSafeReadBits(br, 1, &bits)) {
- return BROTLI_NEEDS_MORE_INPUT;
+ return BROTLI_DECODER_NEEDS_MORE_INPUT;
}
- s->is_last_metablock = (uint8_t)bits;
+ s->is_last_metablock = bits ? 1 : 0;
s->meta_block_remaining_len = 0;
s->is_uncompressed = 0;
s->is_metadata = 0;
@@ -198,18 +210,18 @@ static BrotliErrorCode BROTLI_NOINLINE DecodeMetaBlockLength(
case BROTLI_STATE_METABLOCK_HEADER_EMPTY:
if (!BrotliSafeReadBits(br, 1, &bits)) {
- return BROTLI_NEEDS_MORE_INPUT;
+ return BROTLI_DECODER_NEEDS_MORE_INPUT;
}
if (bits) {
s->substate_metablock_header = BROTLI_STATE_METABLOCK_HEADER_NONE;
- return BROTLI_SUCCESS;
+ return BROTLI_DECODER_SUCCESS;
}
s->substate_metablock_header = BROTLI_STATE_METABLOCK_HEADER_NIBBLES;
/* No break, transit to the next state. */
case BROTLI_STATE_METABLOCK_HEADER_NIBBLES:
if (!BrotliSafeReadBits(br, 2, &bits)) {
- return BROTLI_NEEDS_MORE_INPUT;
+ return BROTLI_DECODER_NEEDS_MORE_INPUT;
}
s->size_nibbles = (uint8_t)(bits + 4);
s->loop_counter = 0;
@@ -223,13 +235,13 @@ static BrotliErrorCode BROTLI_NOINLINE DecodeMetaBlockLength(
case BROTLI_STATE_METABLOCK_HEADER_SIZE:
i = s->loop_counter;
- for (; i < s->size_nibbles; ++i) {
+ for (; i < (int)s->size_nibbles; ++i) {
if (!BrotliSafeReadBits(br, 4, &bits)) {
s->loop_counter = i;
- return BROTLI_NEEDS_MORE_INPUT;
+ return BROTLI_DECODER_NEEDS_MORE_INPUT;
}
if (i + 1 == s->size_nibbles && s->size_nibbles > 4 && bits == 0) {
- return BROTLI_FAILURE(BROTLI_ERROR_FORMAT_EXUBERANT_NIBBLE);
+ return BROTLI_FAILURE(BROTLI_DECODER_ERROR_FORMAT_EXUBERANT_NIBBLE);
}
s->meta_block_remaining_len |= (int)(bits << (i * 4));
}
@@ -240,31 +252,31 @@ static BrotliErrorCode BROTLI_NOINLINE DecodeMetaBlockLength(
case BROTLI_STATE_METABLOCK_HEADER_UNCOMPRESSED:
if (!s->is_last_metablock) {
if (!BrotliSafeReadBits(br, 1, &bits)) {
- return BROTLI_NEEDS_MORE_INPUT;
+ return BROTLI_DECODER_NEEDS_MORE_INPUT;
}
- s->is_uncompressed = (uint8_t)bits;
+ s->is_uncompressed = bits ? 1 : 0;
}
++s->meta_block_remaining_len;
s->substate_metablock_header = BROTLI_STATE_METABLOCK_HEADER_NONE;
- return BROTLI_SUCCESS;
+ return BROTLI_DECODER_SUCCESS;
case BROTLI_STATE_METABLOCK_HEADER_RESERVED:
if (!BrotliSafeReadBits(br, 1, &bits)) {
- return BROTLI_NEEDS_MORE_INPUT;
+ return BROTLI_DECODER_NEEDS_MORE_INPUT;
}
if (bits != 0) {
- return BROTLI_FAILURE(BROTLI_ERROR_FORMAT_RESERVED);
+ return BROTLI_FAILURE(BROTLI_DECODER_ERROR_FORMAT_RESERVED);
}
s->substate_metablock_header = BROTLI_STATE_METABLOCK_HEADER_BYTES;
/* No break, transit to the next state. */
case BROTLI_STATE_METABLOCK_HEADER_BYTES:
if (!BrotliSafeReadBits(br, 2, &bits)) {
- return BROTLI_NEEDS_MORE_INPUT;
+ return BROTLI_DECODER_NEEDS_MORE_INPUT;
}
if (bits == 0) {
s->substate_metablock_header = BROTLI_STATE_METABLOCK_HEADER_NONE;
- return BROTLI_SUCCESS;
+ return BROTLI_DECODER_SUCCESS;
}
s->size_nibbles = (uint8_t)bits;
s->substate_metablock_header = BROTLI_STATE_METABLOCK_HEADER_METADATA;
@@ -272,22 +284,24 @@ static BrotliErrorCode BROTLI_NOINLINE DecodeMetaBlockLength(
case BROTLI_STATE_METABLOCK_HEADER_METADATA:
i = s->loop_counter;
- for (; i < s->size_nibbles; ++i) {
+ for (; i < (int)s->size_nibbles; ++i) {
if (!BrotliSafeReadBits(br, 8, &bits)) {
s->loop_counter = i;
- return BROTLI_NEEDS_MORE_INPUT;
+ return BROTLI_DECODER_NEEDS_MORE_INPUT;
}
if (i + 1 == s->size_nibbles && s->size_nibbles > 1 && bits == 0) {
- return BROTLI_FAILURE(BROTLI_ERROR_FORMAT_EXUBERANT_META_NIBBLE);
+ return BROTLI_FAILURE(
+ BROTLI_DECODER_ERROR_FORMAT_EXUBERANT_META_NIBBLE);
}
s->meta_block_remaining_len |= (int)(bits << (i * 8));
}
++s->meta_block_remaining_len;
s->substate_metablock_header = BROTLI_STATE_METABLOCK_HEADER_NONE;
- return BROTLI_SUCCESS;
+ return BROTLI_DECODER_SUCCESS;
default:
- return BROTLI_FAILURE(BROTLI_ERROR_UNREACHABLE);
+ return
+ BROTLI_FAILURE(BROTLI_DECODER_ERROR_UNREACHABLE);
}
}
}
@@ -319,17 +333,16 @@ static BROTLI_INLINE uint32_t ReadSymbol(const HuffmanCode* table,
/* Same as DecodeSymbol, but it is known that there is less than 15 bits of
input are currently available. */
-static BROTLI_NOINLINE int SafeDecodeSymbol(const HuffmanCode* table,
- BrotliBitReader* br,
- uint32_t* result) {
+static BROTLI_NOINLINE BROTLI_BOOL SafeDecodeSymbol(
+ const HuffmanCode* table, BrotliBitReader* br, uint32_t* result) {
uint32_t val;
uint32_t available_bits = BrotliGetAvailableBits(br);
if (available_bits == 0) {
if (table->bits == 0) {
*result = table->value;
- return 1;
+ return BROTLI_TRUE;
}
- return 0; /* No valid bits at all. */
+ return BROTLI_FALSE; /* No valid bits at all. */
}
val = (uint32_t)BrotliGetBitsUnmasked(br);
table += val & HUFFMAN_TABLE_MASK;
@@ -337,13 +350,13 @@ static BROTLI_NOINLINE int SafeDecodeSymbol(const HuffmanCode* table,
if (table->bits <= available_bits) {
BrotliDropBits(br, table->bits);
*result = table->value;
- return 1;
+ return BROTLI_TRUE;
} else {
- return 0; /* Not enough bits for the first level. */
+ return BROTLI_FALSE; /* Not enough bits for the first level. */
}
}
if (available_bits <= HUFFMAN_TABLE_BITS) {
- return 0; /* Not enough bits to move to the second level. */
+ return BROTLI_FALSE; /* Not enough bits to move to the second level. */
}
/* Speculatively drop HUFFMAN_TABLE_BITS. */
@@ -351,21 +364,20 @@ static BROTLI_NOINLINE int SafeDecodeSymbol(const HuffmanCode* table,
available_bits -= HUFFMAN_TABLE_BITS;
table += table->value + val;
if (available_bits < table->bits) {
- return 0; /* Not enough bits for the second level. */
+ return BROTLI_FALSE; /* Not enough bits for the second level. */
}
BrotliDropBits(br, HUFFMAN_TABLE_BITS + table->bits);
*result = table->value;
- return 1;
+ return BROTLI_TRUE;
}
-static BROTLI_INLINE int SafeReadSymbol(const HuffmanCode* table,
- BrotliBitReader* br,
- uint32_t* result) {
+static BROTLI_INLINE BROTLI_BOOL SafeReadSymbol(
+ const HuffmanCode* table, BrotliBitReader* br, uint32_t* result) {
uint32_t val;
- if (PREDICT_TRUE(BrotliSafeGetBits(br, 15, &val))) {
+ if (BROTLI_PREDICT_TRUE(BrotliSafeGetBits(br, 15, &val))) {
*result = DecodeSymbol(val, table, br);
- return 1;
+ return BROTLI_TRUE;
}
return SafeDecodeSymbol(table, br, result);
}
@@ -391,7 +403,7 @@ static BROTLI_INLINE uint32_t ReadPreloadedSymbol(const HuffmanCode* table,
uint32_t* bits,
uint32_t* value) {
uint32_t result = *value;
- if (PREDICT_FALSE(*bits > HUFFMAN_TABLE_BITS)) {
+ if (BROTLI_PREDICT_FALSE(*bits > HUFFMAN_TABLE_BITS)) {
uint32_t val = BrotliGet16BitsUnmasked(br);
const HuffmanCode* ext = table + (val & HUFFMAN_TABLE_MASK) + *value;
uint32_t mask = BitMask((*bits - HUFFMAN_TABLE_BITS));
@@ -419,8 +431,8 @@ static BROTLI_INLINE uint32_t Log2Floor(uint32_t x) {
Totally 1..4 symbols are read, 1..10 bits each.
The list of symbols MUST NOT contain duplicates.
*/
-static BrotliErrorCode ReadSimpleHuffmanSymbols(uint32_t alphabet_size,
- BrotliState* s) {
+static BrotliDecoderErrorCode ReadSimpleHuffmanSymbols(
+ uint32_t alphabet_size, BrotliDecoderState* s) {
/* max_bits == 1..10; symbol == 0..3; 1..40 bits will be read. */
BrotliBitReader* br = &s->br;
uint32_t max_bits = Log2Floor(alphabet_size - 1);
@@ -428,13 +440,14 @@ static BrotliErrorCode ReadSimpleHuffmanSymbols(uint32_t alphabet_size,
uint32_t num_symbols = s->symbol;
while (i <= num_symbols) {
uint32_t v;
- if (PREDICT_FALSE(!BrotliSafeReadBits(br, max_bits, &v))) {
+ if (BROTLI_PREDICT_FALSE(!BrotliSafeReadBits(br, max_bits, &v))) {
s->sub_loop_counter = i;
s->substate_huffman = BROTLI_STATE_HUFFMAN_SIMPLE_READ;
- return BROTLI_NEEDS_MORE_INPUT;
+ return BROTLI_DECODER_NEEDS_MORE_INPUT;
}
if (v >= alphabet_size) {
- return BROTLI_FAILURE(BROTLI_ERROR_FORMAT_SIMPLE_HUFFMAN_ALPHABET);
+ return
+ BROTLI_FAILURE(BROTLI_DECODER_ERROR_FORMAT_SIMPLE_HUFFMAN_ALPHABET);
}
s->symbols_lists_array[i] = (uint16_t)v;
BROTLI_LOG_UINT(s->symbols_lists_array[i]);
@@ -445,19 +458,19 @@ static BrotliErrorCode ReadSimpleHuffmanSymbols(uint32_t alphabet_size,
uint32_t k = i + 1;
for (; k <= num_symbols; ++k) {
if (s->symbols_lists_array[i] == s->symbols_lists_array[k]) {
- return BROTLI_FAILURE(BROTLI_ERROR_FORMAT_SIMPLE_HUFFMAN_SAME);
+ return BROTLI_FAILURE(BROTLI_DECODER_ERROR_FORMAT_SIMPLE_HUFFMAN_SAME);
}
}
}
- return BROTLI_SUCCESS;
+ return BROTLI_DECODER_SUCCESS;
}
/* Process single decoded symbol code length:
A) reset the repeat variable
B) remember code length (if it is not 0)
- C) extend corredponding index-chain
- D) reduce the huffman space
+ C) extend corresponding index-chain
+ D) reduce the Huffman space
E) update the histogram
*/
static BROTLI_INLINE void ProcessSingleCodeLength(uint32_t code_len,
@@ -478,12 +491,14 @@ static BROTLI_INLINE void ProcessSingleCodeLength(uint32_t code_len,
/* Process repeated symbol code length.
A) Check if it is the extension of previous repeat sequence; if the decoded
- value is not kCodeLengthRepeatCode, then it is a new symbol-skip
+ value is not BROTLI_REPEAT_PREVIOUS_CODE_LENGTH, then it is a new
+ symbol-skip
B) Update repeat variable
- C) Check if operation is feasible (fits alphapet)
+ C) Check if operation is feasible (fits alphabet)
D) For each symbol do the same operations as in ProcessSingleCodeLength
- PRECONDITION: code_len == kCodeLengthRepeatCode or kCodeLengthRepeatCode + 1
+ PRECONDITION: code_len == BROTLI_REPEAT_PREVIOUS_CODE_LENGTH or
+ code_len == BROTLI_REPEAT_ZERO_CODE_LENGTH
*/
static BROTLI_INLINE void ProcessRepeatedCodeLength(uint32_t code_len,
uint32_t repeat_delta, uint32_t alphabet_size, uint32_t* symbol,
@@ -491,9 +506,11 @@ static BROTLI_INLINE void ProcessRepeatedCodeLength(uint32_t code_len,
uint32_t* repeat_code_len, uint16_t* symbol_lists,
uint16_t* code_length_histo, int* next_symbol) {
uint32_t old_repeat;
- uint32_t new_len = 0;
- if (code_len == kCodeLengthRepeatCode) {
+ uint32_t extra_bits = 3; /* for BROTLI_REPEAT_ZERO_CODE_LENGTH */
+ uint32_t new_len = 0; /* for BROTLI_REPEAT_ZERO_CODE_LENGTH */
+ if (code_len == BROTLI_REPEAT_PREVIOUS_CODE_LENGTH) {
new_len = *prev_code_len;
+ extra_bits = 2;
}
if (*repeat_code_len != new_len) {
*repeat = 0;
@@ -502,7 +519,7 @@ static BROTLI_INLINE void ProcessRepeatedCodeLength(uint32_t code_len,
old_repeat = *repeat;
if (*repeat > 0) {
*repeat -= 2;
- *repeat <<= code_len - 14U;
+ *repeat <<= extra_bits;
}
*repeat += repeat_delta + 3U;
repeat_delta = *repeat - old_repeat;
@@ -531,8 +548,8 @@ static BROTLI_INLINE void ProcessRepeatedCodeLength(uint32_t code_len,
}
/* Reads and decodes symbol codelengths. */
-static BrotliErrorCode ReadSymbolCodeLengths(
- uint32_t alphabet_size, BrotliState* s) {
+static BrotliDecoderErrorCode ReadSymbolCodeLengths(
+ uint32_t alphabet_size, BrotliDecoderState* s) {
BrotliBitReader* br = &s->br;
uint32_t symbol = s->symbol;
uint32_t repeat = s->repeat;
@@ -543,7 +560,7 @@ static BrotliErrorCode ReadSymbolCodeLengths(
uint16_t* code_length_histo = s->code_length_histo;
int* next_symbol = s->next_symbol;
if (!BrotliWarmupBitReader(br)) {
- return BROTLI_NEEDS_MORE_INPUT;
+ return BROTLI_DECODER_NEEDS_MORE_INPUT;
}
while (symbol < alphabet_size && space > 0) {
const HuffmanCode* p = s->table;
@@ -554,44 +571,53 @@ static BrotliErrorCode ReadSymbolCodeLengths(
s->prev_code_len = prev_code_len;
s->repeat_code_len = repeat_code_len;
s->space = space;
- return BROTLI_NEEDS_MORE_INPUT;
+ return BROTLI_DECODER_NEEDS_MORE_INPUT;
}
BrotliFillBitWindow16(br);
p += BrotliGetBitsUnmasked(br) &
BitMask(BROTLI_HUFFMAN_MAX_CODE_LENGTH_CODE_LENGTH);
BrotliDropBits(br, p->bits); /* Use 1..5 bits */
code_len = p->value; /* code_len == 0..17 */
- if (code_len < kCodeLengthRepeatCode) {
+ if (code_len < BROTLI_REPEAT_PREVIOUS_CODE_LENGTH) {
ProcessSingleCodeLength(code_len, &symbol, &repeat, &space,
&prev_code_len, symbol_lists, code_length_histo, next_symbol);
} else { /* code_len == 16..17, extra_bits == 2..3 */
+ uint32_t extra_bits =
+ (code_len == BROTLI_REPEAT_PREVIOUS_CODE_LENGTH) ? 2 : 3;
uint32_t repeat_delta =
- (uint32_t)BrotliGetBitsUnmasked(br) & BitMask(code_len - 14U);
- BrotliDropBits(br, code_len - 14U);
+ (uint32_t)BrotliGetBitsUnmasked(br) & BitMask(extra_bits);
+ BrotliDropBits(br, extra_bits);
ProcessRepeatedCodeLength(code_len, repeat_delta, alphabet_size,
&symbol, &repeat, &space, &prev_code_len, &repeat_code_len,
symbol_lists, code_length_histo, next_symbol);
}
}
s->space = space;
- return BROTLI_SUCCESS;
+ return BROTLI_DECODER_SUCCESS;
}
-static BrotliErrorCode SafeReadSymbolCodeLengths(
- uint32_t alphabet_size, BrotliState* s) {
+static BrotliDecoderErrorCode SafeReadSymbolCodeLengths(
+ uint32_t alphabet_size, BrotliDecoderState* s) {
BrotliBitReader* br = &s->br;
+ BROTLI_BOOL get_byte = BROTLI_FALSE;
while (s->symbol < alphabet_size && s->space > 0) {
const HuffmanCode* p = s->table;
uint32_t code_len;
+ uint32_t available_bits;
uint32_t bits = 0;
- uint32_t available_bits = BrotliGetAvailableBits(br);
+ if (get_byte && !BrotliPullByte(br)) return BROTLI_DECODER_NEEDS_MORE_INPUT;
+ get_byte = BROTLI_FALSE;
+ available_bits = BrotliGetAvailableBits(br);
if (available_bits != 0) {
bits = (uint32_t)BrotliGetBitsUnmasked(br);
}
p += bits & BitMask(BROTLI_HUFFMAN_MAX_CODE_LENGTH_CODE_LENGTH);
- if (p->bits > available_bits) goto pullMoreInput;
+ if (p->bits > available_bits) {
+ get_byte = BROTLI_TRUE;
+ continue;
+ }
code_len = p->value; /* code_len == 0..17 */
- if (code_len < kCodeLengthRepeatCode) {
+ if (code_len < BROTLI_REPEAT_PREVIOUS_CODE_LENGTH) {
BrotliDropBits(br, p->bits);
ProcessSingleCodeLength(code_len, &s->symbol, &s->repeat, &s->space,
&s->prev_code_len, s->symbol_lists, s->code_length_histo,
@@ -599,35 +625,32 @@ static BrotliErrorCode SafeReadSymbolCodeLengths(
} else { /* code_len == 16..17, extra_bits == 2..3 */
uint32_t extra_bits = code_len - 14U;
uint32_t repeat_delta = (bits >> p->bits) & BitMask(extra_bits);
- if (available_bits < p->bits + extra_bits) goto pullMoreInput;
+ if (available_bits < p->bits + extra_bits) {
+ get_byte = BROTLI_TRUE;
+ continue;
+ }
BrotliDropBits(br, p->bits + extra_bits);
ProcessRepeatedCodeLength(code_len, repeat_delta, alphabet_size,
&s->symbol, &s->repeat, &s->space, &s->prev_code_len,
&s->repeat_code_len, s->symbol_lists, s->code_length_histo,
s->next_symbol);
}
- continue;
-
-pullMoreInput:
- if (!BrotliPullByte(br)) {
- return BROTLI_NEEDS_MORE_INPUT;
- }
}
- return BROTLI_SUCCESS;
+ return BROTLI_DECODER_SUCCESS;
}
/* Reads and decodes 15..18 codes using static prefix code.
Each code is 2..4 bits long. In total 30..72 bits are used. */
-static BrotliErrorCode ReadCodeLengthCodeLengths(BrotliState* s) {
+static BrotliDecoderErrorCode ReadCodeLengthCodeLengths(BrotliDecoderState* s) {
BrotliBitReader* br = &s->br;
uint32_t num_codes = s->repeat;
unsigned space = s->space;
uint32_t i = s->sub_loop_counter;
- for (; i < CODE_LENGTH_CODES; ++i) {
+ for (; i < BROTLI_CODE_LENGTH_CODES; ++i) {
const uint8_t code_len_idx = kCodeLengthCodeOrder[i];
uint32_t ix;
uint32_t v;
- if (PREDICT_FALSE(!BrotliSafeGetBits(br, 4, &ix))) {
+ if (BROTLI_PREDICT_FALSE(!BrotliSafeGetBits(br, 4, &ix))) {
uint32_t available_bits = BrotliGetAvailableBits(br);
if (available_bits != 0) {
ix = BrotliGetBitsUnmasked(br) & 0xF;
@@ -639,7 +662,7 @@ static BrotliErrorCode ReadCodeLengthCodeLengths(BrotliState* s) {
s->repeat = num_codes;
s->space = space;
s->substate_huffman = BROTLI_STATE_HUFFMAN_COMPLEX;
- return BROTLI_NEEDS_MORE_INPUT;
+ return BROTLI_DECODER_NEEDS_MORE_INPUT;
}
}
v = kCodeLengthPrefixValue[ix];
@@ -657,9 +680,9 @@ static BrotliErrorCode ReadCodeLengthCodeLengths(BrotliState* s) {
}
}
if (!(num_codes == 1 || space == 0)) {
- return BROTLI_FAILURE(BROTLI_ERROR_FORMAT_CL_SPACE);
+ return BROTLI_FAILURE(BROTLI_DECODER_ERROR_FORMAT_CL_SPACE);
}
- return BROTLI_SUCCESS;
+ return BROTLI_DECODER_SUCCESS;
}
/* Decodes the Huffman tables.
@@ -674,119 +697,123 @@ static BrotliErrorCode ReadCodeLengthCodeLengths(BrotliState* s) {
B.2) Decoded table is used to decode code lengths of symbols in resulting
Huffman table. In worst case 3520 bits are read.
*/
-static BrotliErrorCode ReadHuffmanCode(uint32_t alphabet_size,
- HuffmanCode* table,
- uint32_t* opt_table_size,
- BrotliState* s) {
+static BrotliDecoderErrorCode ReadHuffmanCode(uint32_t alphabet_size,
+ HuffmanCode* table,
+ uint32_t* opt_table_size,
+ BrotliDecoderState* s) {
BrotliBitReader* br = &s->br;
/* Unnecessary masking, but might be good for safety. */
alphabet_size &= 0x3ff;
/* State machine */
- switch (s->substate_huffman) {
- case BROTLI_STATE_HUFFMAN_NONE:
- if (!BrotliSafeReadBits(br, 2, &s->sub_loop_counter)) {
- return BROTLI_NEEDS_MORE_INPUT;
- }
- BROTLI_LOG_UINT(s->sub_loop_counter);
- /* The value is used as follows:
- 1 for simple code;
- 0 for no skipping, 2 skips 2 code lengths, 3 skips 3 code lengths */
- if (s->sub_loop_counter != 1) {
- s->space = 32;
- s->repeat = 0; /* num_codes */
- memset(&s->code_length_histo[0], 0, sizeof(s->code_length_histo[0]) *
- (BROTLI_HUFFMAN_MAX_CODE_LENGTH_CODE_LENGTH + 1));
- memset(&s->code_length_code_lengths[0], 0,
- sizeof(s->code_length_code_lengths));
- s->substate_huffman = BROTLI_STATE_HUFFMAN_COMPLEX;
- goto Complex;
- }
- /* No break, transit to the next state. */
+ for (;;) {
+ switch (s->substate_huffman) {
+ case BROTLI_STATE_HUFFMAN_NONE:
+ if (!BrotliSafeReadBits(br, 2, &s->sub_loop_counter)) {
+ return BROTLI_DECODER_NEEDS_MORE_INPUT;
+ }
+ BROTLI_LOG_UINT(s->sub_loop_counter);
+ /* The value is used as follows:
+ 1 for simple code;
+ 0 for no skipping, 2 skips 2 code lengths, 3 skips 3 code lengths */
+ if (s->sub_loop_counter != 1) {
+ s->space = 32;
+ s->repeat = 0; /* num_codes */
+ memset(&s->code_length_histo[0], 0, sizeof(s->code_length_histo[0]) *
+ (BROTLI_HUFFMAN_MAX_CODE_LENGTH_CODE_LENGTH + 1));
+ memset(&s->code_length_code_lengths[0], 0,
+ sizeof(s->code_length_code_lengths));
+ s->substate_huffman = BROTLI_STATE_HUFFMAN_COMPLEX;
+ continue;
+ }
+ /* No break, transit to the next state. */
- case BROTLI_STATE_HUFFMAN_SIMPLE_SIZE:
- /* Read symbols, codes & code lengths directly. */
- if (!BrotliSafeReadBits(br, 2, &s->symbol)) { /* num_symbols */
- s->substate_huffman = BROTLI_STATE_HUFFMAN_SIMPLE_SIZE;
- return BROTLI_NEEDS_MORE_INPUT;
- }
- s->sub_loop_counter = 0;
- /* No break, transit to the next state. */
- case BROTLI_STATE_HUFFMAN_SIMPLE_READ: {
- BrotliErrorCode result = ReadSimpleHuffmanSymbols(alphabet_size, s);
- if (result != BROTLI_SUCCESS) {
- return result;
- }
- /* No break, transit to the next state. */
- }
- case BROTLI_STATE_HUFFMAN_SIMPLE_BUILD: {
- uint32_t table_size;
- if (s->symbol == 3) {
- uint32_t bits;
- if (!BrotliSafeReadBits(br, 1, &bits)) {
- s->substate_huffman = BROTLI_STATE_HUFFMAN_SIMPLE_BUILD;
- return BROTLI_NEEDS_MORE_INPUT;
+ case BROTLI_STATE_HUFFMAN_SIMPLE_SIZE:
+ /* Read symbols, codes & code lengths directly. */
+ if (!BrotliSafeReadBits(br, 2, &s->symbol)) { /* num_symbols */
+ s->substate_huffman = BROTLI_STATE_HUFFMAN_SIMPLE_SIZE;
+ return BROTLI_DECODER_NEEDS_MORE_INPUT;
}
- s->symbol += bits;
+ s->sub_loop_counter = 0;
+ /* No break, transit to the next state. */
+ case BROTLI_STATE_HUFFMAN_SIMPLE_READ: {
+ BrotliDecoderErrorCode result =
+ ReadSimpleHuffmanSymbols(alphabet_size, s);
+ if (result != BROTLI_DECODER_SUCCESS) {
+ return result;
+ }
+ /* No break, transit to the next state. */
}
- BROTLI_LOG_UINT(s->symbol);
- table_size = BrotliBuildSimpleHuffmanTable(
- table, HUFFMAN_TABLE_BITS, s->symbols_lists_array, s->symbol);
- if (opt_table_size) {
- *opt_table_size = table_size;
+ case BROTLI_STATE_HUFFMAN_SIMPLE_BUILD: {
+ uint32_t table_size;
+ if (s->symbol == 3) {
+ uint32_t bits;
+ if (!BrotliSafeReadBits(br, 1, &bits)) {
+ s->substate_huffman = BROTLI_STATE_HUFFMAN_SIMPLE_BUILD;
+ return BROTLI_DECODER_NEEDS_MORE_INPUT;
+ }
+ s->symbol += bits;
+ }
+ BROTLI_LOG_UINT(s->symbol);
+ table_size = BrotliBuildSimpleHuffmanTable(
+ table, HUFFMAN_TABLE_BITS, s->symbols_lists_array, s->symbol);
+ if (opt_table_size) {
+ *opt_table_size = table_size;
+ }
+ s->substate_huffman = BROTLI_STATE_HUFFMAN_NONE;
+ return BROTLI_DECODER_SUCCESS;
}
- s->substate_huffman = BROTLI_STATE_HUFFMAN_NONE;
- return BROTLI_SUCCESS;
- }
-Complex: /* Decode Huffman-coded code lengths. */
- case BROTLI_STATE_HUFFMAN_COMPLEX: {
- uint32_t i;
- BrotliErrorCode result = ReadCodeLengthCodeLengths(s);
- if (result != BROTLI_SUCCESS) {
- return result;
- }
- BrotliBuildCodeLengthsHuffmanTable(s->table,
- s->code_length_code_lengths,
- s->code_length_histo);
- memset(&s->code_length_histo[0], 0, sizeof(s->code_length_histo));
- for (i = 0; i <= BROTLI_HUFFMAN_MAX_CODE_LENGTH; ++i) {
- s->next_symbol[i] = (int)i - (BROTLI_HUFFMAN_MAX_CODE_LENGTH + 1);
- s->symbol_lists[(int)i - (BROTLI_HUFFMAN_MAX_CODE_LENGTH + 1)] = 0xFFFF;
- }
+ /* Decode Huffman-coded code lengths. */
+ case BROTLI_STATE_HUFFMAN_COMPLEX: {
+ uint32_t i;
+ BrotliDecoderErrorCode result = ReadCodeLengthCodeLengths(s);
+ if (result != BROTLI_DECODER_SUCCESS) {
+ return result;
+ }
+ BrotliBuildCodeLengthsHuffmanTable(s->table,
+ s->code_length_code_lengths,
+ s->code_length_histo);
+ memset(&s->code_length_histo[0], 0, sizeof(s->code_length_histo));
+ for (i = 0; i <= BROTLI_HUFFMAN_MAX_CODE_LENGTH; ++i) {
+ s->next_symbol[i] = (int)i - (BROTLI_HUFFMAN_MAX_CODE_LENGTH + 1);
+ s->symbol_lists[s->next_symbol[i]] = 0xFFFF;
+ }
- s->symbol = 0;
- s->prev_code_len = kDefaultCodeLength;
- s->repeat = 0;
- s->repeat_code_len = 0;
- s->space = 32768;
- s->substate_huffman = BROTLI_STATE_HUFFMAN_LENGTH_SYMBOLS;
- /* No break, transit to the next state. */
- }
- case BROTLI_STATE_HUFFMAN_LENGTH_SYMBOLS: {
- uint32_t table_size;
- BrotliErrorCode result = ReadSymbolCodeLengths(alphabet_size, s);
- if (result == BROTLI_NEEDS_MORE_INPUT) {
- result = SafeReadSymbolCodeLengths(alphabet_size, s);
- }
- if (result != BROTLI_SUCCESS) {
- return result;
+ s->symbol = 0;
+ s->prev_code_len = BROTLI_INITIAL_REPEATED_CODE_LENGTH;
+ s->repeat = 0;
+ s->repeat_code_len = 0;
+ s->space = 32768;
+ s->substate_huffman = BROTLI_STATE_HUFFMAN_LENGTH_SYMBOLS;
+ /* No break, transit to the next state. */
}
+ case BROTLI_STATE_HUFFMAN_LENGTH_SYMBOLS: {
+ uint32_t table_size;
+ BrotliDecoderErrorCode result = ReadSymbolCodeLengths(alphabet_size, s);
+ if (result == BROTLI_DECODER_NEEDS_MORE_INPUT) {
+ result = SafeReadSymbolCodeLengths(alphabet_size, s);
+ }
+ if (result != BROTLI_DECODER_SUCCESS) {
+ return result;
+ }
- if (s->space != 0) {
- BROTLI_LOG(("[ReadHuffmanCode] space = %d\n", s->space));
- return BROTLI_FAILURE(BROTLI_ERROR_FORMAT_HUFFMAN_SPACE);
- }
- table_size = BrotliBuildHuffmanTable(
- table, HUFFMAN_TABLE_BITS, s->symbol_lists, s->code_length_histo);
- if (opt_table_size) {
- *opt_table_size = table_size;
+ if (s->space != 0) {
+ BROTLI_LOG(("[ReadHuffmanCode] space = %d\n", s->space));
+ return BROTLI_FAILURE(BROTLI_DECODER_ERROR_FORMAT_HUFFMAN_SPACE);
+ }
+ table_size = BrotliBuildHuffmanTable(
+ table, HUFFMAN_TABLE_BITS, s->symbol_lists, s->code_length_histo);
+ if (opt_table_size) {
+ *opt_table_size = table_size;
+ }
+ s->substate_huffman = BROTLI_STATE_HUFFMAN_NONE;
+ return BROTLI_DECODER_SUCCESS;
}
- s->substate_huffman = BROTLI_STATE_HUFFMAN_NONE;
- return BROTLI_SUCCESS;
- }
- default:
- return BROTLI_FAILURE(BROTLI_ERROR_UNREACHABLE);
+ default:
+ return
+ BROTLI_FAILURE(BROTLI_DECODER_ERROR_UNREACHABLE);
+ }
}
}
@@ -802,14 +829,13 @@ static BROTLI_INLINE uint32_t ReadBlockLength(const HuffmanCode* table,
/* WARNING: if state is not BROTLI_STATE_READ_BLOCK_LENGTH_NONE, then
reading can't be continued with ReadBlockLength. */
-static BROTLI_INLINE int SafeReadBlockLength(BrotliState* s,
- uint32_t* result,
- const HuffmanCode* table,
- BrotliBitReader* br) {
+static BROTLI_INLINE BROTLI_BOOL SafeReadBlockLength(
+ BrotliDecoderState* s, uint32_t* result, const HuffmanCode* table,
+ BrotliBitReader* br) {
uint32_t index;
if (s->substate_read_block_length == BROTLI_STATE_READ_BLOCK_LENGTH_NONE) {
if (!SafeReadSymbol(table, br, &index)) {
- return 0;
+ return BROTLI_FALSE;
}
} else {
index = s->block_length_index;
@@ -820,11 +846,11 @@ static BROTLI_INLINE int SafeReadBlockLength(BrotliState* s,
if (!BrotliSafeReadBits(br, nbits, &bits)) {
s->block_length_index = index;
s->substate_read_block_length = BROTLI_STATE_READ_BLOCK_LENGTH_SUFFIX;
- return 0;
+ return BROTLI_FALSE;
}
*result = kBlockLengthPrefixCode[index].offset + bits;
s->substate_read_block_length = BROTLI_STATE_READ_BLOCK_LENGTH_NONE;
- return 1;
+ return BROTLI_TRUE;
}
}
@@ -843,45 +869,46 @@ static BROTLI_INLINE int SafeReadBlockLength(BrotliState* s,
Most of input values are 0 and 1. To reduce number of branches, we replace
inner for loop with do-while.
*/
-static BROTLI_NOINLINE void InverseMoveToFrontTransform(uint8_t* v,
- uint32_t v_len, BrotliState* state) {
+static BROTLI_NOINLINE void InverseMoveToFrontTransform(
+ uint8_t* v, uint32_t v_len, BrotliDecoderState* state) {
/* Reinitialize elements that could have been changed. */
- uint32_t i = 4;
+ uint32_t i = 1;
uint32_t upper_bound = state->mtf_upper_bound;
- uint8_t* mtf = &state->mtf[4]; /* Make mtf[-1] addressable. */
+ uint32_t* mtf = &state->mtf[1]; /* Make mtf[-1] addressable. */
+ uint8_t* mtf_u8 = (uint8_t*)mtf;
/* Load endian-aware constant. */
const uint8_t b0123[4] = {0, 1, 2, 3};
uint32_t pattern;
memcpy(&pattern, &b0123, 4);
/* Initialize list using 4 consequent values pattern. */
- *(uint32_t*)mtf = pattern;
+ mtf[0] = pattern;
do {
pattern += 0x04040404; /* Advance all 4 values by 4. */
- *(uint32_t*)(mtf + i) = pattern;
- i += 4;
+ mtf[i] = pattern;
+ i++;
} while (i <= upper_bound);
/* Transform the input. */
upper_bound = 0;
for (i = 0; i < v_len; ++i) {
int index = v[i];
- uint8_t value = mtf[index];
+ uint8_t value = mtf_u8[index];
upper_bound |= v[i];
v[i] = value;
- mtf[-1] = value;
+ mtf_u8[-1] = value;
do {
index--;
- mtf[index + 1] = mtf[index];
+ mtf_u8[index + 1] = mtf_u8[index];
} while (index >= 0);
}
/* Remember amount of elements to be reinitialized. */
- state->mtf_upper_bound = upper_bound;
+ state->mtf_upper_bound = upper_bound >> 2;
}
/* Decodes a series of Huffman table using ReadHuffmanCode function. */
-static BrotliErrorCode HuffmanTreeGroupDecode(HuffmanTreeGroup* group,
- BrotliState* s) {
+static BrotliDecoderErrorCode HuffmanTreeGroupDecode(
+ HuffmanTreeGroup* group, BrotliDecoderState* s) {
if (s->substate_tree_group != BROTLI_STATE_TREE_GROUP_LOOP) {
s->next = group->codes;
s->htree_index = 0;
@@ -889,15 +916,15 @@ static BrotliErrorCode HuffmanTreeGroupDecode(HuffmanTreeGroup* group,
}
while (s->htree_index < group->num_htrees) {
uint32_t table_size;
- BrotliErrorCode result =
+ BrotliDecoderErrorCode result =
ReadHuffmanCode(group->alphabet_size, s->next, &table_size, s);
- if (result != BROTLI_SUCCESS) return result;
+ if (result != BROTLI_DECODER_SUCCESS) return result;
group->htrees[s->htree_index] = s->next;
s->next += table_size;
++s->htree_index;
}
s->substate_tree_group = BROTLI_STATE_TREE_GROUP_NONE;
- return BROTLI_SUCCESS;
+ return BROTLI_DECODER_SUCCESS;
}
/* Decodes a context map.
@@ -909,17 +936,17 @@ static BrotliErrorCode HuffmanTreeGroupDecode(HuffmanTreeGroup* group,
3) Read context map items; "0" values could be run-length encoded.
4) Optionally, apply InverseMoveToFront transform to the resulting map.
*/
-static BrotliErrorCode DecodeContextMap(uint32_t context_map_size,
- uint32_t* num_htrees,
- uint8_t** context_map_arg,
- BrotliState* s) {
+static BrotliDecoderErrorCode DecodeContextMap(uint32_t context_map_size,
+ uint32_t* num_htrees,
+ uint8_t** context_map_arg,
+ BrotliDecoderState* s) {
BrotliBitReader* br = &s->br;
- BrotliErrorCode result = BROTLI_SUCCESS;
+ BrotliDecoderErrorCode result = BROTLI_DECODER_SUCCESS;
switch ((int)s->substate_context_map) {
case BROTLI_STATE_CONTEXT_MAP_NONE:
result = DecodeVarLenUint8(s, br, num_htrees);
- if (result != BROTLI_SUCCESS) {
+ if (result != BROTLI_DECODER_SUCCESS) {
return result;
}
(*num_htrees)++;
@@ -928,11 +955,11 @@ static BrotliErrorCode DecodeContextMap(uint32_t context_map_size,
BROTLI_LOG_UINT(*num_htrees);
*context_map_arg = (uint8_t*)BROTLI_ALLOC(s, (size_t)context_map_size);
if (*context_map_arg == 0) {
- return BROTLI_FAILURE(BROTLI_ERROR_ALLOC_CONTEXT_MAP);
+ return BROTLI_FAILURE(BROTLI_DECODER_ERROR_ALLOC_CONTEXT_MAP);
}
if (*num_htrees <= 1) {
memset(*context_map_arg, 0, (size_t)context_map_size);
- return BROTLI_SUCCESS;
+ return BROTLI_DECODER_SUCCESS;
}
s->substate_context_map = BROTLI_STATE_CONTEXT_MAP_READ_PREFIX;
/* No break, continue to next state. */
@@ -941,9 +968,9 @@ static BrotliErrorCode DecodeContextMap(uint32_t context_map_size,
/* In next stage ReadHuffmanCode uses at least 4 bits, so it is safe
to peek 4 bits ahead. */
if (!BrotliSafeGetBits(br, 5, &bits)) {
- return BROTLI_NEEDS_MORE_INPUT;
+ return BROTLI_DECODER_NEEDS_MORE_INPUT;
}
- if ((bits & 1) != 0) { /* Use RLE for zeroes. */
+ if ((bits & 1) != 0) { /* Use RLE for zeros. */
s->max_run_length_prefix = (bits >> 1) + 1;
BrotliDropBits(br, 5);
} else {
@@ -957,7 +984,7 @@ static BrotliErrorCode DecodeContextMap(uint32_t context_map_size,
case BROTLI_STATE_CONTEXT_MAP_HUFFMAN:
result = ReadHuffmanCode(*num_htrees + s->max_run_length_prefix,
s->context_map_table, NULL, s);
- if (result != BROTLI_SUCCESS) return result;
+ if (result != BROTLI_DECODER_SUCCESS) return result;
s->code = 0xFFFF;
s->substate_context_map = BROTLI_STATE_CONTEXT_MAP_DECODE;
/* No break, continue to next state. */
@@ -966,38 +993,41 @@ static BrotliErrorCode DecodeContextMap(uint32_t context_map_size,
uint32_t max_run_length_prefix = s->max_run_length_prefix;
uint8_t* context_map = *context_map_arg;
uint32_t code = s->code;
- if (code != 0xFFFF) {
- goto rleCode;
- }
- while (context_index < context_map_size) {
- if (!SafeReadSymbol(s->context_map_table, br, &code)) {
- s->code = 0xFFFF;
- s->context_index = context_index;
- return BROTLI_NEEDS_MORE_INPUT;
- }
- BROTLI_LOG_UINT(code);
+ BROTLI_BOOL skip_preamble = (code != 0xFFFF);
+ while (context_index < context_map_size || skip_preamble) {
+ if (!skip_preamble) {
+ if (!SafeReadSymbol(s->context_map_table, br, &code)) {
+ s->code = 0xFFFF;
+ s->context_index = context_index;
+ return BROTLI_DECODER_NEEDS_MORE_INPUT;
+ }
+ BROTLI_LOG_UINT(code);
- if (code == 0) {
- context_map[context_index++] = 0;
- continue;
- }
- if (code > max_run_length_prefix) {
- context_map[context_index++] =
- (uint8_t)(code - max_run_length_prefix);
- continue;
+ if (code == 0) {
+ context_map[context_index++] = 0;
+ continue;
+ }
+ if (code > max_run_length_prefix) {
+ context_map[context_index++] =
+ (uint8_t)(code - max_run_length_prefix);
+ continue;
+ }
+ } else {
+ skip_preamble = BROTLI_FALSE;
}
-rleCode:
+ /* RLE sub-stage. */
{
uint32_t reps;
if (!BrotliSafeReadBits(br, code, &reps)) {
s->code = code;
s->context_index = context_index;
- return BROTLI_NEEDS_MORE_INPUT;
+ return BROTLI_DECODER_NEEDS_MORE_INPUT;
}
reps += 1U << code;
BROTLI_LOG_UINT(reps);
if (context_index + reps > context_map_size) {
- return BROTLI_FAILURE(BROTLI_ERROR_FORMAT_CONTEXT_MAP_REPEAT);
+ return
+ BROTLI_FAILURE(BROTLI_DECODER_ERROR_FORMAT_CONTEXT_MAP_REPEAT);
}
do {
context_map[context_index++] = 0;
@@ -1010,23 +1040,24 @@ rleCode:
uint32_t bits;
if (!BrotliSafeReadBits(br, 1, &bits)) {
s->substate_context_map = BROTLI_STATE_CONTEXT_MAP_TRANSFORM;
- return BROTLI_NEEDS_MORE_INPUT;
+ return BROTLI_DECODER_NEEDS_MORE_INPUT;
}
if (bits != 0) {
InverseMoveToFrontTransform(*context_map_arg, context_map_size, s);
}
s->substate_context_map = BROTLI_STATE_CONTEXT_MAP_NONE;
- return BROTLI_SUCCESS;
+ return BROTLI_DECODER_SUCCESS;
}
default:
- return BROTLI_FAILURE(BROTLI_ERROR_UNREACHABLE);
+ return
+ BROTLI_FAILURE(BROTLI_DECODER_ERROR_UNREACHABLE);
}
}
-/* Decodes a command or literal and updates block type ringbuffer.
+/* Decodes a command or literal and updates block type ring-buffer.
Reads 3..54 bits. */
-static BROTLI_INLINE int DecodeBlockTypeAndLength(int safe,
- BrotliState* s, int tree_type) {
+static BROTLI_INLINE BROTLI_BOOL DecodeBlockTypeAndLength(
+ int safe, BrotliDecoderState* s, int tree_type) {
uint32_t max_block_type = s->num_block_types[tree_type];
const HuffmanCode* type_tree = &s->block_type_trees[
tree_type * BROTLI_HUFFMAN_MAX_SIZE_258];
@@ -1043,11 +1074,11 @@ static BROTLI_INLINE int DecodeBlockTypeAndLength(int safe,
} else {
BrotliBitReaderState memento;
BrotliBitReaderSaveState(br, &memento);
- if (!SafeReadSymbol(type_tree, br, &block_type)) return 0;
+ if (!SafeReadSymbol(type_tree, br, &block_type)) return BROTLI_FALSE;
if (!SafeReadBlockLength(s, &s->block_length[tree_type], len_tree, br)) {
s->substate_read_block_length = BROTLI_STATE_READ_BLOCK_LENGTH_NONE;
BrotliBitReaderRestoreState(br, &memento);
- return 0;
+ return BROTLI_FALSE;
}
}
@@ -1063,18 +1094,19 @@ static BROTLI_INLINE int DecodeBlockTypeAndLength(int safe,
}
ringbuffer[0] = ringbuffer[1];
ringbuffer[1] = block_type;
- return 1;
+ return BROTLI_TRUE;
}
-static BROTLI_INLINE void DetectTrivialLiteralBlockTypes(BrotliState* s) {
+static BROTLI_INLINE void DetectTrivialLiteralBlockTypes(
+ BrotliDecoderState* s) {
size_t i;
for (i = 0; i < 8; ++i) s->trivial_literal_contexts[i] = 0;
for (i = 0; i < s->num_block_types[0]; i++) {
- size_t offset = i << kLiteralContextBits;
+ size_t offset = i << BROTLI_LITERAL_CONTEXT_BITS;
size_t error = 0;
size_t sample = s->context_map[offset];
size_t j;
- for (j = 0; j < (1u << kLiteralContextBits);) {
+ for (j = 0; j < (1u << BROTLI_LITERAL_CONTEXT_BITS);) {
BROTLI_REPEAT(4, error |= s->context_map[offset + j++] ^ sample;)
}
if (error == 0) {
@@ -1083,11 +1115,11 @@ static BROTLI_INLINE void DetectTrivialLiteralBlockTypes(BrotliState* s) {
}
}
-static BROTLI_INLINE void PrepareLiteralDecoding(BrotliState* s) {
+static BROTLI_INLINE void PrepareLiteralDecoding(BrotliDecoderState* s) {
uint8_t context_mode;
size_t trivial;
uint32_t block_type = s->block_type_rb[1];
- uint32_t context_offset = block_type << kLiteralContextBits;
+ uint32_t context_offset = block_type << BROTLI_LITERAL_CONTEXT_BITS;
s->context_map_slice = s->context_map + context_offset;
trivial = s->trivial_literal_contexts[block_type >> 5];
s->trivial_literal_context = (trivial >> (block_type & 31)) & 1;
@@ -1099,135 +1131,171 @@ static BROTLI_INLINE void PrepareLiteralDecoding(BrotliState* s) {
/* Decodes the block type and updates the state for literal context.
Reads 3..54 bits. */
-static BROTLI_INLINE int DecodeLiteralBlockSwitchInternal(int safe,
- BrotliState* s) {
+static BROTLI_INLINE BROTLI_BOOL DecodeLiteralBlockSwitchInternal(
+ int safe, BrotliDecoderState* s) {
if (!DecodeBlockTypeAndLength(safe, s, 0)) {
- return 0;
+ return BROTLI_FALSE;
}
PrepareLiteralDecoding(s);
- return 1;
+ return BROTLI_TRUE;
}
-static void BROTLI_NOINLINE DecodeLiteralBlockSwitch(BrotliState* s) {
+static void BROTLI_NOINLINE DecodeLiteralBlockSwitch(BrotliDecoderState* s) {
DecodeLiteralBlockSwitchInternal(0, s);
}
-static int BROTLI_NOINLINE SafeDecodeLiteralBlockSwitch(BrotliState* s) {
+static BROTLI_BOOL BROTLI_NOINLINE SafeDecodeLiteralBlockSwitch(
+ BrotliDecoderState* s) {
return DecodeLiteralBlockSwitchInternal(1, s);
}
/* Block switch for insert/copy length.
Reads 3..54 bits. */
-static BROTLI_INLINE int DecodeCommandBlockSwitchInternal(int safe,
- BrotliState* s) {
+static BROTLI_INLINE BROTLI_BOOL DecodeCommandBlockSwitchInternal(
+ int safe, BrotliDecoderState* s) {
if (!DecodeBlockTypeAndLength(safe, s, 1)) {
- return 0;
+ return BROTLI_FALSE;
}
s->htree_command = s->insert_copy_hgroup.htrees[s->block_type_rb[3]];
- return 1;
+ return BROTLI_TRUE;
}
-static void BROTLI_NOINLINE DecodeCommandBlockSwitch(BrotliState* s) {
+static void BROTLI_NOINLINE DecodeCommandBlockSwitch(BrotliDecoderState* s) {
DecodeCommandBlockSwitchInternal(0, s);
}
-static int BROTLI_NOINLINE SafeDecodeCommandBlockSwitch(BrotliState* s) {
+static BROTLI_BOOL BROTLI_NOINLINE SafeDecodeCommandBlockSwitch(
+ BrotliDecoderState* s) {
return DecodeCommandBlockSwitchInternal(1, s);
}
/* Block switch for distance codes.
Reads 3..54 bits. */
-static BROTLI_INLINE int DecodeDistanceBlockSwitchInternal(int safe,
- BrotliState* s) {
+static BROTLI_INLINE BROTLI_BOOL DecodeDistanceBlockSwitchInternal(
+ int safe, BrotliDecoderState* s) {
if (!DecodeBlockTypeAndLength(safe, s, 2)) {
- return 0;
+ return BROTLI_FALSE;
}
- s->dist_context_map_slice =
- s->dist_context_map + (s->block_type_rb[5] << kDistanceContextBits);
+ s->dist_context_map_slice = s->dist_context_map +
+ (s->block_type_rb[5] << BROTLI_DISTANCE_CONTEXT_BITS);
s->dist_htree_index = s->dist_context_map_slice[s->distance_context];
- return 1;
+ return BROTLI_TRUE;
}
-static void BROTLI_NOINLINE DecodeDistanceBlockSwitch(BrotliState* s) {
+static void BROTLI_NOINLINE DecodeDistanceBlockSwitch(BrotliDecoderState* s) {
DecodeDistanceBlockSwitchInternal(0, s);
}
-static int BROTLI_NOINLINE SafeDecodeDistanceBlockSwitch(BrotliState* s) {
+static BROTLI_BOOL BROTLI_NOINLINE SafeDecodeDistanceBlockSwitch(
+ BrotliDecoderState* s) {
return DecodeDistanceBlockSwitchInternal(1, s);
}
-static BrotliErrorCode BROTLI_NOINLINE WriteRingBuffer(size_t* available_out,
- uint8_t** next_out, size_t* total_out, BrotliState* s) {
- size_t pos = (s->pos > s->ringbuffer_size) ? (size_t)s->ringbuffer_size
- : (size_t)(s->pos);
+static size_t UnwrittenBytes(const BrotliDecoderState* s, BROTLI_BOOL wrap) {
+ size_t pos = wrap && s->pos > s->ringbuffer_size ?
+ (size_t)s->ringbuffer_size : (size_t)(s->pos);
+ size_t partial_pos_rb = (s->rb_roundtrips * (size_t)s->ringbuffer_size) + pos;
+ return partial_pos_rb - s->partial_pos_out;
+}
+
+/* Dumps output.
+ Returns BROTLI_DECODER_NEEDS_MORE_OUTPUT only if there is more output to push
+ and either ring-buffer is as big as window size, or |force| is true.
+ */
+static BrotliDecoderErrorCode BROTLI_NOINLINE WriteRingBuffer(
+ BrotliDecoderState* s, size_t* available_out, uint8_t** next_out,
+ size_t* total_out, BROTLI_BOOL force) {
uint8_t* start =
s->ringbuffer + (s->partial_pos_out & (size_t)s->ringbuffer_mask);
- size_t partial_pos_rb = (s->rb_roundtrips * (size_t)s->ringbuffer_size) + pos;
- size_t to_write = (partial_pos_rb - s->partial_pos_out);
+ size_t to_write = UnwrittenBytes(s, BROTLI_TRUE);
size_t num_written = *available_out;
if (num_written > to_write) {
num_written = to_write;
}
if (s->meta_block_remaining_len < 0) {
- return BROTLI_FAILURE(BROTLI_ERROR_FORMAT_BLOCK_LENGTH_1);
+ return BROTLI_FAILURE(BROTLI_DECODER_ERROR_FORMAT_BLOCK_LENGTH_1);
+ }
+ if (next_out && !*next_out) {
+ *next_out = start;
+ } else {
+ if (next_out) {
+ memcpy(*next_out, start, num_written);
+ *next_out += num_written;
+ }
}
- memcpy(*next_out, start, num_written);
- *next_out += num_written;
*available_out -= num_written;
BROTLI_LOG_UINT(to_write);
BROTLI_LOG_UINT(num_written);
s->partial_pos_out += num_written;
- if (total_out) *total_out = s->partial_pos_out;
+ if (total_out) {
+ *total_out = s->partial_pos_out;
+ }
if (num_written < to_write) {
- return BROTLI_NEEDS_MORE_OUTPUT;
+ if (s->ringbuffer_size == (1 << s->window_bits) || force) {
+ return BROTLI_DECODER_NEEDS_MORE_OUTPUT;
+ } else {
+ return BROTLI_DECODER_SUCCESS;
+ }
}
-
- if (s->pos >= s->ringbuffer_size) {
+ /* Wrap ring buffer only if it has reached its maximal size. */
+ if (s->ringbuffer_size == (1 << s->window_bits) &&
+ s->pos >= s->ringbuffer_size) {
s->pos -= s->ringbuffer_size;
s->rb_roundtrips++;
+ s->should_wrap_ringbuffer = (size_t)s->pos != 0 ? 1 : 0;
}
- return BROTLI_SUCCESS;
+ return BROTLI_DECODER_SUCCESS;
}
-/* Allocates ringbuffer.
+static void BROTLI_NOINLINE WrapRingBuffer(BrotliDecoderState* s) {
+ if (s->should_wrap_ringbuffer) {
+ memcpy(s->ringbuffer, s->ringbuffer_end, (size_t)s->pos);
+ s->should_wrap_ringbuffer = 0;
+ }
+}
- s->ringbuffer_size MUST be updated by BrotliCalculateRingBufferSize before
- this function is called.
+/* Allocates ring-buffer.
- Last two bytes of ringbuffer are initialized to 0, so context calculation
- could be done uniformly for the first two and all other positions.
+ s->ringbuffer_size MUST be updated by BrotliCalculateRingBufferSize before
+ this function is called.
- Custom dictionary, if any, is copied to the end of ringbuffer.
+ Last two bytes of ring-buffer are initialized to 0, so context calculation
+ could be done uniformly for the first two and all other positions.
*/
-static int BROTLI_NOINLINE BrotliAllocateRingBuffer(BrotliState* s) {
- /* We need the slack region for the following reasons:
- - doing up to two 16-byte copies for fast backward copying
- - inserting transformed dictionary word (5 prefix + 24 base + 8 suffix) */
- static const int kRingBufferWriteAheadSlack = 42;
- s->ringbuffer = (uint8_t*)BROTLI_ALLOC(s, (size_t)(s->ringbuffer_size +
- kRingBufferWriteAheadSlack));
- if (s->ringbuffer == 0) {
- return 0;
+static BROTLI_BOOL BROTLI_NOINLINE BrotliEnsureRingBuffer(
+ BrotliDecoderState* s) {
+ uint8_t* old_ringbuffer = s->ringbuffer;
+ if (s->ringbuffer_size == s->new_ringbuffer_size) {
+ return BROTLI_TRUE;
}
- s->ringbuffer_end = s->ringbuffer + s->ringbuffer_size;
-
- s->ringbuffer[s->ringbuffer_size - 2] = 0;
- s->ringbuffer[s->ringbuffer_size - 1] = 0;
+ s->ringbuffer = (uint8_t*)BROTLI_ALLOC(s, (size_t)(s->new_ringbuffer_size) +
+ kRingBufferWriteAheadSlack);
+ if (s->ringbuffer == 0) {
+ /* Restore previous value. */
+ s->ringbuffer = old_ringbuffer;
+ return BROTLI_FALSE;
+ }
+ s->ringbuffer[s->new_ringbuffer_size - 2] = 0;
+ s->ringbuffer[s->new_ringbuffer_size - 1] = 0;
- if (s->custom_dict) {
- memcpy(&s->ringbuffer[(-s->custom_dict_size) & s->ringbuffer_mask],
- s->custom_dict, (size_t)s->custom_dict_size);
+ if (!!old_ringbuffer) {
+ memcpy(s->ringbuffer, old_ringbuffer, (size_t)s->pos);
+ BROTLI_FREE(s, old_ringbuffer);
}
- return 1;
+ s->ringbuffer_size = s->new_ringbuffer_size;
+ s->ringbuffer_mask = s->new_ringbuffer_size - 1;
+ s->ringbuffer_end = s->ringbuffer + s->ringbuffer_size;
+
+ return BROTLI_TRUE;
}
-static BrotliErrorCode BROTLI_NOINLINE CopyUncompressedBlockToOutput(
+static BrotliDecoderErrorCode BROTLI_NOINLINE CopyUncompressedBlockToOutput(
size_t* available_out, uint8_t** next_out, size_t* total_out,
- BrotliState* s) {
+ BrotliDecoderState* s) {
/* TODO: avoid allocation for single uncompressed block. */
- if (!s->ringbuffer && !BrotliAllocateRingBuffer(s)) {
- return BROTLI_FAILURE(BROTLI_ERROR_ALLOC_RING_BUFFER_1);
+ if (!BrotliEnsureRingBuffer(s)) {
+ return BROTLI_FAILURE(BROTLI_DECODER_ERROR_ALLOC_RING_BUFFER_1);
}
/* State machine */
@@ -1241,26 +1309,29 @@ static BrotliErrorCode BROTLI_NOINLINE CopyUncompressedBlockToOutput(
if (s->pos + nbytes > s->ringbuffer_size) {
nbytes = s->ringbuffer_size - s->pos;
}
- /* Copy remaining bytes from s->br.buf_ to ringbuffer. */
+ /* Copy remaining bytes from s->br.buf_ to ring-buffer. */
BrotliCopyBytes(&s->ringbuffer[s->pos], &s->br, (size_t)nbytes);
s->pos += nbytes;
s->meta_block_remaining_len -= nbytes;
- if (s->pos < s->ringbuffer_size) {
+ if (s->pos < 1 << s->window_bits) {
if (s->meta_block_remaining_len == 0) {
- return BROTLI_SUCCESS;
+ return BROTLI_DECODER_SUCCESS;
}
- return BROTLI_NEEDS_MORE_INPUT;
+ return BROTLI_DECODER_NEEDS_MORE_INPUT;
}
s->substate_uncompressed = BROTLI_STATE_UNCOMPRESSED_WRITE;
/* No break, continue to next state */
}
case BROTLI_STATE_UNCOMPRESSED_WRITE: {
- BrotliErrorCode result =
- WriteRingBuffer(available_out, next_out, total_out, s);
- if (result != BROTLI_SUCCESS) {
+ BrotliDecoderErrorCode result;
+ result = WriteRingBuffer(
+ s, available_out, next_out, total_out, BROTLI_FALSE);
+ if (result != BROTLI_DECODER_SUCCESS) {
return result;
}
- s->max_distance = s->max_backward_distance;
+ if (s->ringbuffer_size == 1 << s->window_bits) {
+ s->max_distance = s->max_backward_distance;
+ }
s->substate_uncompressed = BROTLI_STATE_UNCOMPRESSED_NONE;
break;
}
@@ -1269,69 +1340,54 @@ static BrotliErrorCode BROTLI_NOINLINE CopyUncompressedBlockToOutput(
BROTLI_DCHECK(0); /* Unreachable */
}
-int BrotliDecompressedSize(size_t encoded_size,
- const uint8_t* encoded_buffer,
- size_t* decoded_size) {
- BrotliState s;
- int next_block_header;
- BrotliStateInit(&s);
- s.br.next_in = encoded_buffer;
- s.br.avail_in = encoded_size;
- if (!BrotliWarmupBitReader(&s.br)) {
- return 0;
- }
- DecodeWindowBits(&s.br);
- if (DecodeMetaBlockLength(&s, &s.br) != BROTLI_SUCCESS) {
- return 0;
- }
- *decoded_size = (size_t)s.meta_block_remaining_len;
- if (s.is_last_metablock) {
- return 1;
- }
- if (!s.is_uncompressed || !BrotliJumpToByteBoundary(&s.br)) {
- return 0;
- }
- next_block_header = BrotliPeekByte(&s.br, (size_t)s.meta_block_remaining_len);
- return (next_block_header != -1) && ((next_block_header & 3) == 3);
-}
-
/* Calculates the smallest feasible ring buffer.
- If we know the data size is small, do not allocate more ringbuffer
+ If we know the data size is small, do not allocate more ring buffer
size than needed to reduce memory usage.
When this method is called, metablock size and flags MUST be decoded.
*/
-static void BROTLI_NOINLINE BrotliCalculateRingBufferSize(BrotliState* s,
- BrotliBitReader* br) {
- int is_last = s->is_last_metablock;
+static void BROTLI_NOINLINE BrotliCalculateRingBufferSize(
+ BrotliDecoderState* s) {
int window_size = 1 << s->window_bits;
- s->ringbuffer_size = window_size;
-
- if (s->is_uncompressed) {
- int next_block_header =
- BrotliPeekByte(br, (size_t)s->meta_block_remaining_len);
- if (next_block_header != -1) { /* Peek succeeded */
- if ((next_block_header & 3) == 3) { /* ISLAST and ISEMPTY */
- is_last = 1;
- }
- }
- }
-
+ int new_ringbuffer_size = window_size;
/* We need at least 2 bytes of ring buffer size to get the last two
bytes for context from there */
- if (is_last) {
- int min_size_x2 = (s->meta_block_remaining_len + s->custom_dict_size) * 2;
- while (s->ringbuffer_size >= min_size_x2 && s->ringbuffer_size > 32) {
- s->ringbuffer_size >>= 1;
+ int min_size = s->ringbuffer_size ? s->ringbuffer_size : 1024;
+ int output_size;
+
+ /* If maximum is already reached, no further extension is retired. */
+ if (s->ringbuffer_size == window_size) {
+ return;
+ }
+
+ /* Metadata blocks does not touch ring buffer. */
+ if (s->is_metadata) {
+ return;
+ }
+
+ if (!s->ringbuffer) {
+ output_size = 0;
+ } else {
+ output_size = s->pos;
+ }
+ output_size += s->meta_block_remaining_len;
+ min_size = min_size < output_size ? output_size : min_size;
+
+ if (!!s->canny_ringbuffer_allocation) {
+ /* Reduce ring buffer size to save memory when server is unscrupulous.
+ In worst case memory usage might be 1.5x bigger for a short period of
+ ring buffer reallocation.*/
+ while ((new_ringbuffer_size >> 1) >= min_size) {
+ new_ringbuffer_size >>= 1;
}
}
- s->ringbuffer_mask = s->ringbuffer_size - 1;
+ s->new_ringbuffer_size = new_ringbuffer_size;
}
/* Reads 1..256 2-bit context modes. */
-static BrotliErrorCode ReadContextModes(BrotliState* s) {
+static BrotliDecoderErrorCode ReadContextModes(BrotliDecoderState* s) {
BrotliBitReader* br = &s->br;
int i = s->loop_counter;
@@ -1339,19 +1395,21 @@ static BrotliErrorCode ReadContextModes(BrotliState* s) {
uint32_t bits;
if (!BrotliSafeReadBits(br, 2, &bits)) {
s->loop_counter = i;
- return BROTLI_NEEDS_MORE_INPUT;
+ return BROTLI_DECODER_NEEDS_MORE_INPUT;
}
s->context_modes[i] = (uint8_t)(bits << 1);
BROTLI_LOG_ARRAY_INDEX(s->context_modes, i);
i++;
}
- return BROTLI_SUCCESS;
+ return BROTLI_DECODER_SUCCESS;
}
-static BROTLI_INLINE void TakeDistanceFromRingBuffer(BrotliState* s) {
+static BROTLI_INLINE void TakeDistanceFromRingBuffer(BrotliDecoderState* s) {
if (s->distance_code == 0) {
--s->dist_rb_idx;
s->distance_code = s->dist_rb[s->dist_rb_idx & 3];
+ /* Compensate double distance-ring-buffer roll for dictionary items. */
+ s->distance_context = 1;
} else {
int distance_code = s->distance_code << 1;
/* kDistanceShortCodeIndexOffset has 2-bit values from LSB: */
@@ -1377,19 +1435,19 @@ static BROTLI_INLINE void TakeDistanceFromRingBuffer(BrotliState* s) {
}
}
-static BROTLI_INLINE int SafeReadBits(
+static BROTLI_INLINE BROTLI_BOOL SafeReadBits(
BrotliBitReader* const br, uint32_t n_bits, uint32_t* val) {
if (n_bits != 0) {
return BrotliSafeReadBits(br, n_bits, val);
} else {
*val = 0;
- return 1;
+ return BROTLI_TRUE;
}
}
/* Precondition: s->distance_code < 0 */
-static BROTLI_INLINE int ReadDistanceInternal(int safe,
- BrotliState* s, BrotliBitReader* br) {
+static BROTLI_INLINE BROTLI_BOOL ReadDistanceInternal(
+ int safe, BrotliDecoderState* s, BrotliBitReader* br) {
int distval;
BrotliBitReaderState memento;
HuffmanCode* distance_tree = s->distance_hgroup.htrees[s->dist_htree_index];
@@ -1399,16 +1457,17 @@ static BROTLI_INLINE int ReadDistanceInternal(int safe,
uint32_t code;
BrotliBitReaderSaveState(br, &memento);
if (!SafeReadSymbol(distance_tree, br, &code)) {
- return 0;
+ return BROTLI_FALSE;
}
s->distance_code = (int)code;
}
/* Convert the distance code to the actual distance by possibly */
/* looking up past distances from the s->ringbuffer. */
+ s->distance_context = 0;
if ((s->distance_code & ~0xf) == 0) {
TakeDistanceFromRingBuffer(s);
--s->block_length[2];
- return 1;
+ return BROTLI_TRUE;
}
distval = s->distance_code - (int)s->num_direct_distance_codes;
if (distval >= 0) {
@@ -1430,7 +1489,7 @@ static BROTLI_INLINE int ReadDistanceInternal(int safe,
if (!SafeReadBits(br, nbits, &bits)) {
s->distance_code = -1; /* Restore precondition. */
BrotliBitReaderRestoreState(br, &memento);
- return 0;
+ return BROTLI_FALSE;
}
} else {
bits = BrotliReadBits(br, nbits);
@@ -1440,21 +1499,23 @@ static BROTLI_INLINE int ReadDistanceInternal(int safe,
((offset + (int)bits) << s->distance_postfix_bits) + postfix;
}
}
- s->distance_code = s->distance_code - NUM_DISTANCE_SHORT_CODES + 1;
+ s->distance_code = s->distance_code - BROTLI_NUM_DISTANCE_SHORT_CODES + 1;
--s->block_length[2];
- return 1;
+ return BROTLI_TRUE;
}
-static BROTLI_INLINE void ReadDistance(BrotliState* s, BrotliBitReader* br) {
+static BROTLI_INLINE void ReadDistance(
+ BrotliDecoderState* s, BrotliBitReader* br) {
ReadDistanceInternal(0, s, br);
}
-static BROTLI_INLINE int SafeReadDistance(BrotliState* s, BrotliBitReader* br) {
+static BROTLI_INLINE BROTLI_BOOL SafeReadDistance(
+ BrotliDecoderState* s, BrotliBitReader* br) {
return ReadDistanceInternal(1, s, br);
}
-static BROTLI_INLINE int ReadCommandInternal(int safe,
- BrotliState* s, BrotliBitReader* br, int* insert_length) {
+static BROTLI_INLINE BROTLI_BOOL ReadCommandInternal(
+ int safe, BrotliDecoderState* s, BrotliBitReader* br, int* insert_length) {
uint32_t cmd_code;
uint32_t insert_len_extra = 0;
uint32_t copy_length;
@@ -1465,7 +1526,7 @@ static BROTLI_INLINE int ReadCommandInternal(int safe,
} else {
BrotliBitReaderSaveState(br, &memento);
if (!SafeReadSymbol(s->htree_command, br, &cmd_code)) {
- return 0;
+ return BROTLI_FALSE;
}
}
v = kCmdLut[cmd_code];
@@ -1474,7 +1535,7 @@ static BROTLI_INLINE int ReadCommandInternal(int safe,
s->dist_htree_index = s->dist_context_map_slice[s->distance_context];
*insert_length = v.insert_len_offset;
if (!safe) {
- if (PREDICT_FALSE(v.insert_len_extra_bits != 0)) {
+ if (BROTLI_PREDICT_FALSE(v.insert_len_extra_bits != 0)) {
insert_len_extra = BrotliReadBits(br, v.insert_len_extra_bits);
}
copy_length = BrotliReadBits(br, v.copy_len_extra_bits);
@@ -1482,54 +1543,54 @@ static BROTLI_INLINE int ReadCommandInternal(int safe,
if (!SafeReadBits(br, v.insert_len_extra_bits, &insert_len_extra) ||
!SafeReadBits(br, v.copy_len_extra_bits, &copy_length)) {
BrotliBitReaderRestoreState(br, &memento);
- return 0;
+ return BROTLI_FALSE;
}
}
s->copy_length = (int)copy_length + v.copy_len_offset;
--s->block_length[1];
*insert_length += (int)insert_len_extra;
- return 1;
+ return BROTLI_TRUE;
}
-static BROTLI_INLINE void ReadCommand(BrotliState* s, BrotliBitReader* br,
- int* insert_length) {
+static BROTLI_INLINE void ReadCommand(
+ BrotliDecoderState* s, BrotliBitReader* br, int* insert_length) {
ReadCommandInternal(0, s, br, insert_length);
}
-static BROTLI_INLINE int SafeReadCommand(BrotliState* s, BrotliBitReader* br,
- int* insert_length) {
+static BROTLI_INLINE BROTLI_BOOL SafeReadCommand(
+ BrotliDecoderState* s, BrotliBitReader* br, int* insert_length) {
return ReadCommandInternal(1, s, br, insert_length);
}
-static BROTLI_INLINE int CheckInputAmount(int safe,
- BrotliBitReader* const br, size_t num) {
+static BROTLI_INLINE BROTLI_BOOL CheckInputAmount(
+ int safe, BrotliBitReader* const br, size_t num) {
if (safe) {
- return 1;
+ return BROTLI_TRUE;
}
return BrotliCheckInputAmount(br, num);
}
-#define BROTLI_SAFE(METHOD) \
- { \
- if (safe) { \
- if (!Safe##METHOD) { \
- result = BROTLI_NEEDS_MORE_INPUT; \
- goto saveStateAndReturn; \
- } \
- } else { \
- METHOD; \
- } \
+#define BROTLI_SAFE(METHOD) \
+ { \
+ if (safe) { \
+ if (!Safe##METHOD) { \
+ result = BROTLI_DECODER_NEEDS_MORE_INPUT; \
+ goto saveStateAndReturn; \
+ } \
+ } else { \
+ METHOD; \
+ } \
}
-static BROTLI_INLINE BrotliErrorCode ProcessCommandsInternal(int safe,
- BrotliState* s) {
+static BROTLI_INLINE BrotliDecoderErrorCode ProcessCommandsInternal(
+ int safe, BrotliDecoderState* s) {
int pos = s->pos;
int i = s->loop_counter;
- BrotliErrorCode result = BROTLI_SUCCESS;
+ BrotliDecoderErrorCode result = BROTLI_DECODER_SUCCESS;
BrotliBitReader* br = &s->br;
if (!CheckInputAmount(safe, br, 28)) {
- result = BROTLI_NEEDS_MORE_INPUT;
+ result = BROTLI_DECODER_NEEDS_MORE_INPUT;
goto saveStateAndReturn;
}
if (!safe) {
@@ -1546,7 +1607,7 @@ static BROTLI_INLINE BrotliErrorCode ProcessCommandsInternal(int safe,
} else if (s->state == BROTLI_STATE_COMMAND_POST_WRAP_COPY) {
goto CommandPostWrapCopy;
} else {
- return BROTLI_FAILURE(BROTLI_ERROR_UNREACHABLE);
+ return BROTLI_FAILURE(BROTLI_DECODER_ERROR_UNREACHABLE);
}
CommandBegin:
@@ -1555,10 +1616,10 @@ CommandBegin:
}
if (!CheckInputAmount(safe, br, 28)) { /* 156 bits + 7 bytes */
s->state = BROTLI_STATE_COMMAND_BEGIN;
- result = BROTLI_NEEDS_MORE_INPUT;
+ result = BROTLI_DECODER_NEEDS_MORE_INPUT;
goto saveStateAndReturn;
}
- if (PREDICT_FALSE(s->block_length[1] == 0)) {
+ if (BROTLI_PREDICT_FALSE(s->block_length[1] == 0)) {
BROTLI_SAFE(DecodeCommandBlockSwitch(s));
goto CommandBegin;
}
@@ -1583,10 +1644,10 @@ CommandInner:
do {
if (!CheckInputAmount(safe, br, 28)) { /* 162 bits + 7 bytes */
s->state = BROTLI_STATE_COMMAND_INNER;
- result = BROTLI_NEEDS_MORE_INPUT;
+ result = BROTLI_DECODER_NEEDS_MORE_INPUT;
goto saveStateAndReturn;
}
- if (PREDICT_FALSE(s->block_length[0] == 0)) {
+ if (BROTLI_PREDICT_FALSE(s->block_length[0] == 0)) {
BROTLI_SAFE(DecodeLiteralBlockSwitch(s));
PreloadSymbol(safe, s->literal_htree, br, &bits, &value);
if (!s->trivial_literal_context) goto CommandInner;
@@ -1597,7 +1658,7 @@ CommandInner:
} else {
uint32_t literal;
if (!SafeReadSymbol(s->literal_htree, br, &literal)) {
- result = BROTLI_NEEDS_MORE_INPUT;
+ result = BROTLI_DECODER_NEEDS_MORE_INPUT;
goto saveStateAndReturn;
}
s->ringbuffer[pos] = (uint8_t)literal;
@@ -1605,7 +1666,7 @@ CommandInner:
--s->block_length[0];
BROTLI_LOG_ARRAY_INDEX(s->ringbuffer, pos);
++pos;
- if (PREDICT_FALSE(pos == s->ringbuffer_size)) {
+ if (BROTLI_PREDICT_FALSE(pos == s->ringbuffer_size)) {
s->state = BROTLI_STATE_COMMAND_INNER_WRITE;
--i;
goto saveStateAndReturn;
@@ -1619,10 +1680,10 @@ CommandInner:
uint8_t context;
if (!CheckInputAmount(safe, br, 28)) { /* 162 bits + 7 bytes */
s->state = BROTLI_STATE_COMMAND_INNER;
- result = BROTLI_NEEDS_MORE_INPUT;
+ result = BROTLI_DECODER_NEEDS_MORE_INPUT;
goto saveStateAndReturn;
}
- if (PREDICT_FALSE(s->block_length[0] == 0)) {
+ if (BROTLI_PREDICT_FALSE(s->block_length[0] == 0)) {
BROTLI_SAFE(DecodeLiteralBlockSwitch(s));
if (s->trivial_literal_context) goto CommandInner;
}
@@ -1635,7 +1696,7 @@ CommandInner:
} else {
uint32_t literal;
if (!SafeReadSymbol(hc, br, &literal)) {
- result = BROTLI_NEEDS_MORE_INPUT;
+ result = BROTLI_DECODER_NEEDS_MORE_INPUT;
goto saveStateAndReturn;
}
p1 = (uint8_t)literal;
@@ -1645,7 +1706,7 @@ CommandInner:
BROTLI_LOG_UINT(s->context_map_slice[context]);
BROTLI_LOG_ARRAY_INDEX(s->ringbuffer, pos & s->ringbuffer_mask);
++pos;
- if (PREDICT_FALSE(pos == s->ringbuffer_size)) {
+ if (BROTLI_PREDICT_FALSE(pos == s->ringbuffer_size)) {
s->state = BROTLI_STATE_COMMAND_INNER_WRITE;
--i;
goto saveStateAndReturn;
@@ -1653,7 +1714,7 @@ CommandInner:
} while (--i != 0);
}
BROTLI_LOG_UINT(s->meta_block_remaining_len);
- if (PREDICT_FALSE(s->meta_block_remaining_len <= 0)) {
+ if (BROTLI_PREDICT_FALSE(s->meta_block_remaining_len <= 0)) {
s->state = BROTLI_STATE_METABLOCK_DONE;
goto saveStateAndReturn;
}
@@ -1663,46 +1724,54 @@ CommandPostDecodeLiterals:
s->state = BROTLI_STATE_COMMAND_POST_DECODE_LITERALS;
}
if (s->distance_code >= 0) {
+ /* Implicit distance case. */
+ s->distance_context = s->distance_code ? 0 : 1;
--s->dist_rb_idx;
s->distance_code = s->dist_rb[s->dist_rb_idx & 3];
- goto postReadDistance; /* We already have the implicit distance */
- }
- /* Read distance code in the command, unless it was implicitly zero. */
- if (PREDICT_FALSE(s->block_length[2] == 0)) {
- BROTLI_SAFE(DecodeDistanceBlockSwitch(s));
+ } else {
+ /* Read distance code in the command, unless it was implicitly zero. */
+ if (BROTLI_PREDICT_FALSE(s->block_length[2] == 0)) {
+ BROTLI_SAFE(DecodeDistanceBlockSwitch(s));
+ }
+ BROTLI_SAFE(ReadDistance(s, br));
}
- BROTLI_SAFE(ReadDistance(s, br));
-postReadDistance:
BROTLI_LOG(("[ProcessCommandsInternal] pos = %d distance = %d\n",
pos, s->distance_code));
if (s->max_distance != s->max_backward_distance) {
- if (pos < s->max_backward_distance_minus_custom_dict_size) {
- s->max_distance = pos + s->custom_dict_size;
- } else {
- s->max_distance = s->max_backward_distance;
- }
+ s->max_distance =
+ (pos < s->max_backward_distance) ? pos : s->max_backward_distance;
}
i = s->copy_length;
/* Apply copy of LZ77 back-reference, or static dictionary reference if
the distance is larger than the max LZ77 distance */
if (s->distance_code > s->max_distance) {
- if (i >= kBrotliMinDictionaryWordLength &&
- i <= kBrotliMaxDictionaryWordLength) {
- int offset = (int)kBrotliDictionaryOffsetsByLength[i];
- int word_id = s->distance_code - s->max_distance - 1;
- uint32_t shift = kBrotliDictionarySizeBitsByLength[i];
+ int address = s->distance_code - s->max_distance - 1;
+ if (i >= BROTLI_MIN_DICTIONARY_WORD_LENGTH &&
+ i <= BROTLI_MAX_DICTIONARY_WORD_LENGTH) {
+ int offset = (int)s->dictionary->offsets_by_length[i];
+ uint32_t shift = s->dictionary->size_bits_by_length[i];
int mask = (int)BitMask(shift);
- int word_idx = word_id & mask;
- int transform_idx = word_id >> shift;
+ int word_idx = address & mask;
+ int transform_idx = address >> shift;
+ /* Compensate double distance-ring-buffer roll. */
+ s->dist_rb_idx += s->distance_context;
offset += word_idx * i;
+ if (BROTLI_PREDICT_FALSE(!s->dictionary->data)) {
+ return BROTLI_FAILURE(BROTLI_DECODER_ERROR_DICTIONARY_NOT_SET);
+ }
if (transform_idx < kNumTransforms) {
- const uint8_t* word = &kBrotliDictionary[offset];
+ const uint8_t* word = &s->dictionary->data[offset];
int len = i;
if (transform_idx == 0) {
memcpy(&s->ringbuffer[pos], word, (size_t)len);
+ BROTLI_LOG(("[ProcessCommandsInternal] dictionary word: [%.*s]\n",
+ len, word));
} else {
len = TransformDictionaryWord(
&s->ringbuffer[pos], word, len, transform_idx);
+ BROTLI_LOG(("[ProcessCommandsInternal] dictionary word: [%.*s],"
+ " transform_idx = %d, transformed: [%.*s]\n",
+ i, word, transform_idx, len, &s->ringbuffer[pos]));
}
pos += len;
s->meta_block_remaining_len -= len;
@@ -1715,13 +1784,13 @@ postReadDistance:
BROTLI_LOG(("Invalid backward reference. pos: %d distance: %d "
"len: %d bytes left: %d\n",
pos, s->distance_code, i, s->meta_block_remaining_len));
- return BROTLI_FAILURE(BROTLI_ERROR_FORMAT_TRANSFORM);
+ return BROTLI_FAILURE(BROTLI_DECODER_ERROR_FORMAT_TRANSFORM);
}
} else {
BROTLI_LOG(("Invalid backward reference. pos: %d distance: %d "
"len: %d bytes left: %d\n",
pos, s->distance_code, i, s->meta_block_remaining_len));
- return BROTLI_FAILURE(BROTLI_ERROR_FORMAT_DICTIONARY);
+ return BROTLI_FAILURE(BROTLI_DECODER_ERROR_FORMAT_DICTIONARY);
}
} else {
int src_start = (pos - s->distance_code) & s->ringbuffer_mask;
@@ -1733,9 +1802,9 @@ postReadDistance:
s->dist_rb[s->dist_rb_idx & 3] = s->distance_code;
++s->dist_rb_idx;
s->meta_block_remaining_len -= i;
- /* There are 32+ bytes of slack in the ringbuffer allocation.
+ /* There are 32+ bytes of slack in the ring-buffer allocation.
Also, we have 16 short codes, that make these 16 bytes irrelevant
- in the ringbuffer. Let's copy over them as a first guess.
+ in the ring-buffer. Let's copy over them as a first guess.
*/
memmove16(copy_dst, copy_src);
if (src_end > pos && dst_end > src_start) {
@@ -1772,7 +1841,7 @@ CommandPostWrapCopy:
s->ringbuffer[pos] =
s->ringbuffer[(pos - s->distance_code) & s->ringbuffer_mask];
++pos;
- if (PREDICT_FALSE(--wrap_guard == 0)) {
+ if (BROTLI_PREDICT_FALSE(--wrap_guard == 0)) {
s->state = BROTLI_STATE_COMMAND_POST_WRITE_2;
goto saveStateAndReturn;
}
@@ -1794,32 +1863,33 @@ saveStateAndReturn:
#undef BROTLI_SAFE
-static BROTLI_NOINLINE BrotliErrorCode ProcessCommands(BrotliState* s) {
+static BROTLI_NOINLINE BrotliDecoderErrorCode ProcessCommands(
+ BrotliDecoderState* s) {
return ProcessCommandsInternal(0, s);
}
-static BROTLI_NOINLINE BrotliErrorCode SafeProcessCommands(BrotliState* s) {
+static BROTLI_NOINLINE BrotliDecoderErrorCode SafeProcessCommands(
+ BrotliDecoderState* s) {
return ProcessCommandsInternal(1, s);
}
-BrotliResult BrotliDecompressBuffer(size_t encoded_size,
- const uint8_t* encoded_buffer,
- size_t* decoded_size,
- uint8_t* decoded_buffer) {
- BrotliState s;
- BrotliResult result;
+BrotliDecoderResult BrotliDecoderDecompress(
+ size_t encoded_size, const uint8_t* encoded_buffer, size_t* decoded_size,
+ uint8_t* decoded_buffer) {
+ BrotliDecoderState s;
+ BrotliDecoderResult result;
size_t total_out = 0;
size_t available_in = encoded_size;
const uint8_t* next_in = encoded_buffer;
size_t available_out = *decoded_size;
uint8_t* next_out = decoded_buffer;
- BrotliStateInit(&s);
- result = BrotliDecompressStream(&available_in, &next_in, &available_out,
- &next_out, &total_out, &s);
+ BrotliDecoderStateInit(&s);
+ result = BrotliDecoderDecompressStream(
+ &s, &available_in, &next_in, &available_out, &next_out, &total_out);
*decoded_size = total_out;
- BrotliStateCleanup(&s);
- if (result != BROTLI_RESULT_SUCCESS) {
- result = BROTLI_RESULT_ERROR;
+ BrotliDecoderStateCleanup(&s);
+ if (result != BROTLI_DECODER_RESULT_SUCCESS) {
+ result = BROTLI_DECODER_RESULT_ERROR;
}
return result;
}
@@ -1827,7 +1897,7 @@ BrotliResult BrotliDecompressBuffer(size_t encoded_size,
/* Invariant: input stream is never overconsumed:
* invalid input implies that the whole stream is invalid -> any amount of
input could be read and discarded
- * when result is "needs more input", then at leat one more byte is REQUIRED
+ * when result is "needs more input", then at least one more byte is REQUIRED
to complete decoding; all input data MUST be consumed by decoder, so
client could swap the input buffer
* when result is "needs more output" decoder MUST ensure that it doesn't
@@ -1836,11 +1906,20 @@ BrotliResult BrotliDecompressBuffer(size_t encoded_size,
* when result is "success" decoder MUST return all unused data back to input
buffer; this is possible because the invariant is hold on enter
*/
-BrotliResult BrotliDecompressStream(size_t* available_in,
- const uint8_t** next_in, size_t* available_out, uint8_t** next_out,
- size_t* total_out, BrotliState* s) {
- BrotliErrorCode result = BROTLI_SUCCESS;
+BrotliDecoderResult BrotliDecoderDecompressStream(
+ BrotliDecoderState* s, size_t* available_in, const uint8_t** next_in,
+ size_t* available_out, uint8_t** next_out, size_t* total_out) {
+ BrotliDecoderErrorCode result = BROTLI_DECODER_SUCCESS;
BrotliBitReader* br = &s->br;
+ /* Do not try to process further in a case of unrecoverable error. */
+ if ((int)s->error_code < 0) {
+ return BROTLI_DECODER_RESULT_ERROR;
+ }
+ if (*available_out && (!next_out || !*next_out)) {
+ return SaveErrorCode(
+ s, BROTLI_FAILURE(BROTLI_DECODER_ERROR_INVALID_ARGUMENTS));
+ }
+ if (!*available_out) next_out = 0;
if (s->buffer_length == 0) { /* Just connect bit reader to input stream. */
br->avail_in = *available_in;
br->next_in = *next_in;
@@ -1848,30 +1927,36 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
/* At least one byte of input is required. More than one byte of input may
be required to complete the transaction -> reading more data must be
done in a loop -> do it in a main loop. */
- result = BROTLI_NEEDS_MORE_INPUT;
+ result = BROTLI_DECODER_NEEDS_MORE_INPUT;
br->next_in = &s->buffer.u8[0];
}
/* State machine */
for (;;) {
- if (result != BROTLI_SUCCESS) { /* Error | needs more input/output */
- if (result == BROTLI_NEEDS_MORE_INPUT) {
- if (s->ringbuffer != 0) { /* Proactively push output. */
- WriteRingBuffer(available_out, next_out, total_out, s);
+ if (result != BROTLI_DECODER_SUCCESS) { /* Error, needs more input/output */
+ if (result == BROTLI_DECODER_NEEDS_MORE_INPUT) {
+ if (s->ringbuffer != 0) { /* Pro-actively push output. */
+ BrotliDecoderErrorCode intermediate_result = WriteRingBuffer(s,
+ available_out, next_out, total_out, BROTLI_TRUE);
+ /* WriteRingBuffer checks s->meta_block_remaining_len validity. */
+ if ((int)intermediate_result < 0) {
+ result = intermediate_result;
+ break;
+ }
}
if (s->buffer_length != 0) { /* Used with internal buffer. */
if (br->avail_in == 0) { /* Successfully finished read transaction. */
- /* Accamulator contains less than 8 bits, because internal buffer
+ /* Accumulator contains less than 8 bits, because internal buffer
is expanded byte-by-byte until it is enough to complete read. */
s->buffer_length = 0;
/* Switch to input stream and restart. */
- result = BROTLI_SUCCESS;
+ result = BROTLI_DECODER_SUCCESS;
br->avail_in = *available_in;
br->next_in = *next_in;
continue;
} else if (*available_in != 0) {
/* Not enough data in buffer, but can take one more byte from
input stream. */
- result = BROTLI_SUCCESS;
+ result = BROTLI_DECODER_SUCCESS;
s->buffer.u8[s->buffer_length] = **next_in;
s->buffer_length++;
br->avail_in = s->buffer_length;
@@ -1905,8 +1990,8 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
s->buffer_length = 0;
} else {
/* Using input stream in last iteration. When decoder switches to input
- stream it has less than 8 bits in accamulator, so it is safe to
- return unused accamulator bits there. */
+ stream it has less than 8 bits in accumulator, so it is safe to
+ return unused accumulator bits there. */
BrotliBitReaderUnload(br);
*available_in = br->avail_in;
*next_in = br->next_in;
@@ -1917,7 +2002,7 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
case BROTLI_STATE_UNINITED:
/* Prepare to the first read. */
if (!BrotliWarmupBitReader(br)) {
- result = BROTLI_NEEDS_MORE_INPUT;
+ result = BROTLI_DECODER_NEEDS_MORE_INPUT;
break;
}
/* Decode window size. */
@@ -1925,25 +2010,18 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
BROTLI_LOG_UINT(s->window_bits);
if (s->window_bits == 9) {
/* Value 9 is reserved for future use. */
- result = BROTLI_FAILURE(BROTLI_ERROR_FORMAT_WINDOW_BITS);
+ result = BROTLI_FAILURE(BROTLI_DECODER_ERROR_FORMAT_WINDOW_BITS);
break;
}
/* Maximum distance, see section 9.1. of the spec. */
- s->max_backward_distance = (1 << s->window_bits) - 16;
- /* Limit custom dictionary size. */
- if (s->custom_dict_size >= s->max_backward_distance) {
- s->custom_dict += s->custom_dict_size - s->max_backward_distance;
- s->custom_dict_size = s->max_backward_distance;
- }
- s->max_backward_distance_minus_custom_dict_size =
- s->max_backward_distance - s->custom_dict_size;
+ s->max_backward_distance = (1 << s->window_bits) - BROTLI_WINDOW_GAP;
/* Allocate memory for both block_type_trees and block_len_trees. */
s->block_type_trees = (HuffmanCode*)BROTLI_ALLOC(s,
sizeof(HuffmanCode) * 3 *
(BROTLI_HUFFMAN_MAX_SIZE_258 + BROTLI_HUFFMAN_MAX_SIZE_26));
if (s->block_type_trees == 0) {
- result = BROTLI_FAILURE(BROTLI_ERROR_ALLOC_BLOCK_TYPE_TREES);
+ result = BROTLI_FAILURE(BROTLI_DECODER_ERROR_ALLOC_BLOCK_TYPE_TREES);
break;
}
s->block_len_trees =
@@ -1952,13 +2030,13 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
s->state = BROTLI_STATE_METABLOCK_BEGIN;
/* No break, continue to next state */
case BROTLI_STATE_METABLOCK_BEGIN:
- BrotliStateMetablockBegin(s);
+ BrotliDecoderStateMetablockBegin(s);
BROTLI_LOG_UINT(s->pos);
s->state = BROTLI_STATE_METABLOCK_HEADER;
/* No break, continue to next state */
case BROTLI_STATE_METABLOCK_HEADER:
result = DecodeMetaBlockLength(s, br); /* Reads 2 - 31 bits. */
- if (result != BROTLI_SUCCESS) {
+ if (result != BROTLI_DECODER_SUCCESS) {
break;
}
BROTLI_LOG_UINT(s->is_last_metablock);
@@ -1967,7 +2045,7 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
BROTLI_LOG_UINT(s->is_uncompressed);
if (s->is_metadata || s->is_uncompressed) {
if (!BrotliJumpToByteBoundary(br)) {
- result = BROTLI_FAILURE(BROTLI_ERROR_FORMAT_PADDING_1);
+ result = BROTLI_FAILURE(BROTLI_DECODER_ERROR_FORMAT_PADDING_1);
break;
}
}
@@ -1979,9 +2057,7 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
s->state = BROTLI_STATE_METABLOCK_DONE;
break;
}
- if (!s->ringbuffer) {
- BrotliCalculateRingBufferSize(s, br);
- }
+ BrotliCalculateRingBufferSize(s);
if (s->is_uncompressed) {
s->state = BROTLI_STATE_UNCOMPRESSED;
break;
@@ -1990,11 +2066,9 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
s->state = BROTLI_STATE_HUFFMAN_CODE_0;
break;
case BROTLI_STATE_UNCOMPRESSED: {
- int bytes_copied = s->meta_block_remaining_len;
result = CopyUncompressedBlockToOutput(
available_out, next_out, total_out, s);
- bytes_copied -= s->meta_block_remaining_len;
- if (result != BROTLI_SUCCESS) {
+ if (result != BROTLI_DECODER_SUCCESS) {
break;
}
s->state = BROTLI_STATE_METABLOCK_DONE;
@@ -2005,11 +2079,11 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
uint32_t bits;
/* Read one byte and ignore it. */
if (!BrotliSafeReadBits(br, 8, &bits)) {
- result = BROTLI_NEEDS_MORE_INPUT;
+ result = BROTLI_DECODER_NEEDS_MORE_INPUT;
break;
}
}
- if (result == BROTLI_SUCCESS) {
+ if (result == BROTLI_DECODER_SUCCESS) {
s->state = BROTLI_STATE_METABLOCK_DONE;
}
break;
@@ -2020,7 +2094,7 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
}
/* Reads 1..11 bits. */
result = DecodeVarLenUint8(s, br, &s->num_block_types[s->loop_counter]);
- if (result != BROTLI_SUCCESS) {
+ if (result != BROTLI_DECODER_SUCCESS) {
break;
}
s->num_block_types[s->loop_counter]++;
@@ -2035,15 +2109,15 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
int tree_offset = s->loop_counter * BROTLI_HUFFMAN_MAX_SIZE_258;
result = ReadHuffmanCode(s->num_block_types[s->loop_counter] + 2,
&s->block_type_trees[tree_offset], NULL, s);
- if (result != BROTLI_SUCCESS) break;
+ if (result != BROTLI_DECODER_SUCCESS) break;
s->state = BROTLI_STATE_HUFFMAN_CODE_2;
/* No break, continue to next state */
}
case BROTLI_STATE_HUFFMAN_CODE_2: {
int tree_offset = s->loop_counter * BROTLI_HUFFMAN_MAX_SIZE_26;
- result = ReadHuffmanCode(kNumBlockLengthCodes,
+ result = ReadHuffmanCode(BROTLI_NUM_BLOCK_LEN_SYMBOLS,
&s->block_len_trees[tree_offset], NULL, s);
- if (result != BROTLI_SUCCESS) break;
+ if (result != BROTLI_DECODER_SUCCESS) break;
s->state = BROTLI_STATE_HUFFMAN_CODE_3;
/* No break, continue to next state */
}
@@ -2051,7 +2125,7 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
int tree_offset = s->loop_counter * BROTLI_HUFFMAN_MAX_SIZE_26;
if (!SafeReadBlockLength(s, &s->block_length[s->loop_counter],
&s->block_len_trees[tree_offset], br)) {
- result = BROTLI_NEEDS_MORE_INPUT;
+ result = BROTLI_DECODER_NEEDS_MORE_INPUT;
break;
}
BROTLI_LOG_UINT(s->block_length[s->loop_counter]);
@@ -2062,20 +2136,20 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
case BROTLI_STATE_METABLOCK_HEADER_2: {
uint32_t bits;
if (!BrotliSafeReadBits(br, 6, &bits)) {
- result = BROTLI_NEEDS_MORE_INPUT;
+ result = BROTLI_DECODER_NEEDS_MORE_INPUT;
break;
}
s->distance_postfix_bits = bits & BitMask(2);
bits >>= 2;
- s->num_direct_distance_codes =
- NUM_DISTANCE_SHORT_CODES + (bits << s->distance_postfix_bits);
+ s->num_direct_distance_codes = BROTLI_NUM_DISTANCE_SHORT_CODES +
+ (bits << s->distance_postfix_bits);
BROTLI_LOG_UINT(s->num_direct_distance_codes);
BROTLI_LOG_UINT(s->distance_postfix_bits);
s->distance_postfix_mask = (int)BitMask(s->distance_postfix_bits);
s->context_modes =
(uint8_t*)BROTLI_ALLOC(s, (size_t)s->num_block_types[0]);
if (s->context_modes == 0) {
- result = BROTLI_FAILURE(BROTLI_ERROR_ALLOC_CONTEXT_MODES);
+ result = BROTLI_FAILURE(BROTLI_DECODER_ERROR_ALLOC_CONTEXT_MODES);
break;
}
s->loop_counter = 0;
@@ -2084,16 +2158,16 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
}
case BROTLI_STATE_CONTEXT_MODES:
result = ReadContextModes(s);
- if (result != BROTLI_SUCCESS) {
+ if (result != BROTLI_DECODER_SUCCESS) {
break;
}
s->state = BROTLI_STATE_CONTEXT_MAP_1;
/* No break, continue to next state */
case BROTLI_STATE_CONTEXT_MAP_1:
result = DecodeContextMap(
- s->num_block_types[0] << kLiteralContextBits,
+ s->num_block_types[0] << BROTLI_LITERAL_CONTEXT_BITS,
&s->num_literal_htrees, &s->context_map, s);
- if (result != BROTLI_SUCCESS) {
+ if (result != BROTLI_DECODER_SUCCESS) {
break;
}
DetectTrivialLiteralBlockTypes(s);
@@ -2101,26 +2175,27 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
/* No break, continue to next state */
case BROTLI_STATE_CONTEXT_MAP_2:
{
- uint32_t num_distance_codes =
- s->num_direct_distance_codes + (48U << s->distance_postfix_bits);
+ uint32_t num_distance_codes = s->num_direct_distance_codes +
+ ((2 * BROTLI_MAX_DISTANCE_BITS) << s->distance_postfix_bits);
+ BROTLI_BOOL allocation_success = BROTLI_TRUE;
result = DecodeContextMap(
- s->num_block_types[2] << kDistanceContextBits,
+ s->num_block_types[2] << BROTLI_DISTANCE_CONTEXT_BITS,
&s->num_dist_htrees, &s->dist_context_map, s);
- if (result != BROTLI_SUCCESS) {
+ if (result != BROTLI_DECODER_SUCCESS) {
break;
}
- BrotliHuffmanTreeGroupInit(s, &s->literal_hgroup, kNumLiteralCodes,
- s->num_literal_htrees);
- BrotliHuffmanTreeGroupInit(s, &s->insert_copy_hgroup,
- kNumInsertAndCopyCodes,
- s->num_block_types[1]);
- BrotliHuffmanTreeGroupInit(s, &s->distance_hgroup, num_distance_codes,
- s->num_dist_htrees);
- if (s->literal_hgroup.codes == 0 ||
- s->insert_copy_hgroup.codes == 0 ||
- s->distance_hgroup.codes == 0) {
+ allocation_success &= BrotliDecoderHuffmanTreeGroupInit(
+ s, &s->literal_hgroup, BROTLI_NUM_LITERAL_SYMBOLS,
+ s->num_literal_htrees);
+ allocation_success &= BrotliDecoderHuffmanTreeGroupInit(
+ s, &s->insert_copy_hgroup, BROTLI_NUM_COMMAND_SYMBOLS,
+ s->num_block_types[1]);
+ allocation_success &= BrotliDecoderHuffmanTreeGroupInit(
+ s, &s->distance_hgroup, num_distance_codes,
+ s->num_dist_htrees);
+ if (!allocation_success) {
return SaveErrorCode(s,
- BROTLI_FAILURE(BROTLI_ERROR_ALLOC_TREE_GROUPS));
+ BROTLI_FAILURE(BROTLI_DECODER_ERROR_ALLOC_TREE_GROUPS));
}
}
s->loop_counter = 0;
@@ -2140,19 +2215,19 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
hgroup = &s->distance_hgroup;
break;
default:
- return SaveErrorCode(s,
- BROTLI_FAILURE(BROTLI_ERROR_UNREACHABLE));
+ return SaveErrorCode(s, BROTLI_FAILURE(
+ BROTLI_DECODER_ERROR_UNREACHABLE));
}
result = HuffmanTreeGroupDecode(hgroup, s);
}
- if (result != BROTLI_SUCCESS) break;
+ if (result != BROTLI_DECODER_SUCCESS) break;
s->loop_counter++;
if (s->loop_counter >= 3) {
PrepareLiteralDecoding(s);
s->dist_context_map_slice = s->dist_context_map;
s->htree_command = s->insert_copy_hgroup.htrees[0];
- if (!s->ringbuffer && !BrotliAllocateRingBuffer(s)) {
- result = BROTLI_FAILURE(BROTLI_ERROR_ALLOC_RING_BUFFER_2);
+ if (!BrotliEnsureRingBuffer(s)) {
+ result = BROTLI_FAILURE(BROTLI_DECODER_ERROR_ALLOC_RING_BUFFER_2);
break;
}
s->state = BROTLI_STATE_COMMAND_BEGIN;
@@ -2163,20 +2238,23 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
case BROTLI_STATE_COMMAND_POST_DECODE_LITERALS:
case BROTLI_STATE_COMMAND_POST_WRAP_COPY:
result = ProcessCommands(s);
- if (result == BROTLI_NEEDS_MORE_INPUT) {
+ if (result == BROTLI_DECODER_NEEDS_MORE_INPUT) {
result = SafeProcessCommands(s);
}
break;
case BROTLI_STATE_COMMAND_INNER_WRITE:
case BROTLI_STATE_COMMAND_POST_WRITE_1:
case BROTLI_STATE_COMMAND_POST_WRITE_2:
- result = WriteRingBuffer(available_out, next_out, total_out, s);
- if (result != BROTLI_SUCCESS) {
+ result = WriteRingBuffer(
+ s, available_out, next_out, total_out, BROTLI_FALSE);
+ if (result != BROTLI_DECODER_SUCCESS) {
break;
}
- s->max_distance = s->max_backward_distance;
+ WrapRingBuffer(s);
+ if (s->ringbuffer_size == 1 << s->window_bits) {
+ s->max_distance = s->max_backward_distance;
+ }
if (s->state == BROTLI_STATE_COMMAND_POST_WRITE_1) {
- memcpy(s->ringbuffer, s->ringbuffer_end, (size_t)s->pos);
if (s->meta_block_remaining_len == 0) {
/* Next metablock, if any */
s->state = BROTLI_STATE_METABLOCK_DONE;
@@ -2200,16 +2278,16 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
break;
case BROTLI_STATE_METABLOCK_DONE:
if (s->meta_block_remaining_len < 0) {
- result = BROTLI_FAILURE(BROTLI_ERROR_FORMAT_BLOCK_LENGTH_2);
+ result = BROTLI_FAILURE(BROTLI_DECODER_ERROR_FORMAT_BLOCK_LENGTH_2);
break;
}
- BrotliStateCleanupAfterMetablock(s);
+ BrotliDecoderStateCleanupAfterMetablock(s);
if (!s->is_last_metablock) {
s->state = BROTLI_STATE_METABLOCK_BEGIN;
break;
}
if (!BrotliJumpToByteBoundary(br)) {
- result = BROTLI_FAILURE(BROTLI_ERROR_FORMAT_PADDING_2);
+ result = BROTLI_FAILURE(BROTLI_DECODER_ERROR_FORMAT_PADDING_2);
break;
}
if (s->buffer_length == 0) {
@@ -2221,8 +2299,9 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
/* No break, continue to next state */
case BROTLI_STATE_DONE:
if (s->ringbuffer != 0) {
- result = WriteRingBuffer(available_out, next_out, total_out, s);
- if (result != BROTLI_SUCCESS) {
+ result = WriteRingBuffer(
+ s, available_out, next_out, total_out, BROTLI_TRUE);
+ if (result != BROTLI_DECODER_SUCCESS) {
break;
}
}
@@ -2232,31 +2311,70 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
return SaveErrorCode(s, result);
}
-void BrotliSetCustomDictionary(
- size_t size, const uint8_t* dict, BrotliState* s) {
- if (size > (1u << 24)) {
- return;
+BROTLI_BOOL BrotliDecoderHasMoreOutput(const BrotliDecoderState* s) {
+ /* After unrecoverable error remaining output is considered nonsensical. */
+ if ((int)s->error_code < 0) {
+ return BROTLI_FALSE;
}
- s->custom_dict = dict;
- s->custom_dict_size = (int)size;
+ return TO_BROTLI_BOOL(
+ s->ringbuffer != 0 && UnwrittenBytes(s, BROTLI_FALSE) != 0);
}
-BrotliErrorCode BrotliGetErrorCode(const BrotliState* s) {
- return (BrotliErrorCode)s->error_code;
+const uint8_t* BrotliDecoderTakeOutput(BrotliDecoderState* s, size_t* size) {
+ uint8_t* result = 0;
+ size_t available_out = *size ? *size : 1u << 24;
+ size_t requested_out = available_out;
+ BrotliDecoderErrorCode status;
+ if ((s->ringbuffer == 0) || ((int)s->error_code < 0)) {
+ *size = 0;
+ return 0;
+ }
+ WrapRingBuffer(s);
+ status = WriteRingBuffer(s, &available_out, &result, 0, BROTLI_TRUE);
+ /* Either WriteRingBuffer returns those "success" codes... */
+ if (status == BROTLI_DECODER_SUCCESS ||
+ status == BROTLI_DECODER_NEEDS_MORE_OUTPUT) {
+ *size = requested_out - available_out;
+ } else {
+ /* ... or stream is broken. Normally this should be caught by
+ BrotliDecoderDecompressStream, this is just a safeguard. */
+ if ((int)status < 0) SaveErrorCode(s, status);
+ *size = 0;
+ result = 0;
+ }
+ return result;
+}
+
+BROTLI_BOOL BrotliDecoderIsUsed(const BrotliDecoderState* s) {
+ return TO_BROTLI_BOOL(s->state != BROTLI_STATE_UNINITED ||
+ BrotliGetAvailableBits(&s->br) != 0);
+}
+
+BROTLI_BOOL BrotliDecoderIsFinished(const BrotliDecoderState* s) {
+ return TO_BROTLI_BOOL(s->state == BROTLI_STATE_DONE) &&
+ !BrotliDecoderHasMoreOutput(s);
}
-const char* BrotliErrorString(BrotliErrorCode c) {
+BrotliDecoderErrorCode BrotliDecoderGetErrorCode(const BrotliDecoderState* s) {
+ return (BrotliDecoderErrorCode)s->error_code;
+}
+
+const char* BrotliDecoderErrorString(BrotliDecoderErrorCode c) {
switch (c) {
-#define _BROTLI_ERROR_CODE_CASE(PREFIX, NAME, CODE) \
- case BROTLI ## PREFIX ## NAME: return #NAME;
-#define _BROTLI_NOTHING
- BROTLI_ERROR_CODES_LIST(_BROTLI_ERROR_CODE_CASE, _BROTLI_NOTHING)
-#undef _BROTLI_ERROR_CODE_CASE
-#undef _BROTLI_NOTHING
+#define BROTLI_ERROR_CODE_CASE_(PREFIX, NAME, CODE) \
+ case BROTLI_DECODER ## PREFIX ## NAME: return #NAME;
+#define BROTLI_NOTHING_
+ BROTLI_DECODER_ERROR_CODES_LIST(BROTLI_ERROR_CODE_CASE_, BROTLI_NOTHING_)
+#undef BROTLI_ERROR_CODE_CASE_
+#undef BROTLI_NOTHING_
default: return "INVALID";
}
}
+uint32_t BrotliDecoderVersion() {
+ return BROTLI_VERSION;
+}
+
#if defined(__cplusplus) || defined(c_plusplus)
} /* extern "C" */
#endif
diff --git a/Source/ThirdParty/brotli/dec/decode.h b/Source/ThirdParty/brotli/dec/decode.h
deleted file mode 100644
index 056a8b548..000000000
--- a/Source/ThirdParty/brotli/dec/decode.h
+++ /dev/null
@@ -1,162 +0,0 @@
-/* Copyright 2013 Google Inc. All Rights Reserved.
-
- Distributed under MIT license.
- See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
-*/
-
-/* API for Brotli decompression */
-
-#ifndef BROTLI_DEC_DECODE_H_
-#define BROTLI_DEC_DECODE_H_
-
-#include "./types.h"
-
-#if defined(__cplusplus) || defined(c_plusplus)
-extern "C" {
-#endif
-
-typedef struct BrotliStateStruct BrotliState;
-
-typedef enum {
- /* Decoding error, e.g. corrupt input or memory allocation problem */
- BROTLI_RESULT_ERROR = 0,
- /* Decoding successfully completed */
- BROTLI_RESULT_SUCCESS = 1,
- /* Partially done; should be called again with more input */
- BROTLI_RESULT_NEEDS_MORE_INPUT = 2,
- /* Partially done; should be called again with more output */
- BROTLI_RESULT_NEEDS_MORE_OUTPUT = 3
-} BrotliResult;
-
-#define BROTLI_ERROR_CODES_LIST(BROTLI_ERROR_CODE, SEPARATOR) \
- BROTLI_ERROR_CODE(_, NO_ERROR, 0) SEPARATOR \
- /* Same as BrotliResult values */ \
- BROTLI_ERROR_CODE(_, SUCCESS, 1) SEPARATOR \
- BROTLI_ERROR_CODE(_, NEEDS_MORE_INPUT, 2) SEPARATOR \
- BROTLI_ERROR_CODE(_, NEEDS_MORE_OUTPUT, 3) SEPARATOR \
- \
- /* Errors caused by invalid input */ \
- BROTLI_ERROR_CODE(_ERROR_FORMAT_, EXUBERANT_NIBBLE, -1) SEPARATOR \
- BROTLI_ERROR_CODE(_ERROR_FORMAT_, RESERVED, -2) SEPARATOR \
- BROTLI_ERROR_CODE(_ERROR_FORMAT_, EXUBERANT_META_NIBBLE, -3) SEPARATOR \
- BROTLI_ERROR_CODE(_ERROR_FORMAT_, SIMPLE_HUFFMAN_ALPHABET, -4) SEPARATOR \
- BROTLI_ERROR_CODE(_ERROR_FORMAT_, SIMPLE_HUFFMAN_SAME, -5) SEPARATOR \
- BROTLI_ERROR_CODE(_ERROR_FORMAT_, CL_SPACE, -6) SEPARATOR \
- BROTLI_ERROR_CODE(_ERROR_FORMAT_, HUFFMAN_SPACE, -7) SEPARATOR \
- BROTLI_ERROR_CODE(_ERROR_FORMAT_, CONTEXT_MAP_REPEAT, -8) SEPARATOR \
- BROTLI_ERROR_CODE(_ERROR_FORMAT_, BLOCK_LENGTH_1, -9) SEPARATOR \
- BROTLI_ERROR_CODE(_ERROR_FORMAT_, BLOCK_LENGTH_2, -10) SEPARATOR \
- BROTLI_ERROR_CODE(_ERROR_FORMAT_, TRANSFORM, -11) SEPARATOR \
- BROTLI_ERROR_CODE(_ERROR_FORMAT_, DICTIONARY, -12) SEPARATOR \
- BROTLI_ERROR_CODE(_ERROR_FORMAT_, WINDOW_BITS, -13) SEPARATOR \
- BROTLI_ERROR_CODE(_ERROR_FORMAT_, PADDING_1, -14) SEPARATOR \
- BROTLI_ERROR_CODE(_ERROR_FORMAT_, PADDING_2, -15) SEPARATOR \
- \
- /* -16..-20 codes are reserved */ \
- \
- /* Memory allocation problems */ \
- BROTLI_ERROR_CODE(_ERROR_ALLOC_, CONTEXT_MODES, -21) SEPARATOR \
- /* Literal, insert and distance trees together */ \
- BROTLI_ERROR_CODE(_ERROR_ALLOC_, TREE_GROUPS, -22) SEPARATOR \
- /* -23..-24 codes are reserved for distinct tree groups */ \
- BROTLI_ERROR_CODE(_ERROR_ALLOC_, CONTEXT_MAP, -25) SEPARATOR \
- BROTLI_ERROR_CODE(_ERROR_ALLOC_, RING_BUFFER_1, -26) SEPARATOR \
- BROTLI_ERROR_CODE(_ERROR_ALLOC_, RING_BUFFER_2, -27) SEPARATOR \
- /* -28..-29 codes are reserved for dynamic ringbuffer allocation */ \
- BROTLI_ERROR_CODE(_ERROR_ALLOC_, BLOCK_TYPE_TREES, -30) SEPARATOR \
- \
- /* "Impossible" states */ \
- BROTLI_ERROR_CODE(_ERROR_, UNREACHABLE, -31)
-
-typedef enum {
-#define _BROTLI_COMMA ,
-#define _BROTLI_ERROR_CODE_ENUM_ITEM(PREFIX, NAME, CODE) \
- BROTLI ## PREFIX ## NAME = CODE
- BROTLI_ERROR_CODES_LIST(_BROTLI_ERROR_CODE_ENUM_ITEM, _BROTLI_COMMA)
-#undef _BROTLI_ERROR_CODE_ENUM_ITEM
-#undef _BROTLI_COMMA
-} BrotliErrorCode;
-
-#define BROTLI_LAST_ERROR_CODE BROTLI_ERROR_UNREACHABLE
-
-/* Creates the instance of BrotliState and initializes it. |alloc_func| and
- |free_func| MUST be both zero or both non-zero. In the case they are both
- zero, default memory allocators are used. |opaque| is passed to |alloc_func|
- and |free_func| when they are called. */
-BrotliState* BrotliCreateState(
- brotli_alloc_func alloc_func, brotli_free_func free_func, void* opaque);
-
-/* Deinitializes and frees BrotliState instance. */
-void BrotliDestroyState(BrotliState* state);
-
-/* Sets |*decoded_size| to the decompressed size of the given encoded stream.
- This function only works if the encoded buffer has a single meta block,
- or if it has two meta-blocks, where the first is uncompressed and the
- second is empty.
- Returns 1 on success, 0 on failure. */
-int BrotliDecompressedSize(size_t encoded_size,
- const uint8_t* encoded_buffer,
- size_t* decoded_size);
-
-/* Decompresses the data in |encoded_buffer| into |decoded_buffer|, and sets
- |*decoded_size| to the decompressed length. */
-BrotliResult BrotliDecompressBuffer(size_t encoded_size,
- const uint8_t* encoded_buffer,
- size_t* decoded_size,
- uint8_t* decoded_buffer);
-
-/* Decompresses the data. Supports partial input and output.
-
- Must be called with an allocated input buffer in |*next_in| and an allocated
- output buffer in |*next_out|. The values |*available_in| and |*available_out|
- must specify the allocated size in |*next_in| and |*next_out| respectively.
-
- After each call, |*available_in| will be decremented by the amount of input
- bytes consumed, and the |*next_in| pointer will be incremented by that
- amount. Similarly, |*available_out| will be decremented by the amount of
- output bytes written, and the |*next_out| pointer will be incremented by that
- amount. |total_out|, if it is not a null-pointer, will be set to the number
- of bytes decompressed since the last state initialization.
-
- Input is never overconsumed, so |next_in| and |available_in| could be passed
- to the next consumer after decoding is complete. */
-BrotliResult BrotliDecompressStream(size_t* available_in,
- const uint8_t** next_in,
- size_t* available_out,
- uint8_t** next_out,
- size_t* total_out,
- BrotliState* s);
-
-/* Fills the new state with a dictionary for LZ77, warming up the ringbuffer,
- e.g. for custom static dictionaries for data formats.
- Not to be confused with the built-in transformable dictionary of Brotli.
- |size| should be less or equal to 2^24 (16MiB), otherwise the dictionary will
- be ignored. The dictionary must exist in memory until decoding is done and
- is owned by the caller. To use:
- 1) Allocate and initialize state with BrotliCreateState
- 2) Use BrotliSetCustomDictionary
- 3) Use BrotliDecompressStream
- 4) Clean up and free state with BrotliDestroyState
-*/
-void BrotliSetCustomDictionary(
- size_t size, const uint8_t* dict, BrotliState* s);
-
-/* Returns 1, if s is in a state where we have not read any input bytes yet,
- and 0 otherwise */
-int BrotliStateIsStreamStart(const BrotliState* s);
-
-/* Returns 1, if s is in a state where we reached the end of the input and
- produced all of the output, and 0 otherwise. */
-int BrotliStateIsStreamEnd(const BrotliState* s);
-
-/* Returns detailed error code after BrotliDecompressStream returns
- BROTLI_RESULT_ERROR. */
-BrotliErrorCode BrotliGetErrorCode(const BrotliState* s);
-
-const char* BrotliErrorString(BrotliErrorCode c);
-
-#if defined(__cplusplus) || defined(c_plusplus)
-} /* extern "C" */
-#endif
-
-#endif /* BROTLI_DEC_DECODE_H_ */
diff --git a/Source/ThirdParty/brotli/dec/dictionary.c b/Source/ThirdParty/brotli/dec/dictionary.c
deleted file mode 100644
index f8f58575c..000000000
--- a/Source/ThirdParty/brotli/dec/dictionary.c
+++ /dev/null
@@ -1,9466 +0,0 @@
-/* Copyright 2013 Google Inc. All Rights Reserved.
-
- Distributed under MIT license.
- See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
-*/
-
-#include "./dictionary.h"
-
-#if defined(__cplusplus) || defined(c_plusplus)
-extern "C" {
-#endif
-
-/* In case of multiple definition linker error with dictionary.cc from the
- encoder: include only one of enc/dictionary.cc or dec/dictionary.c in a
- target using both enc and dec. */
-const uint8_t kBrotliDictionary[122784] = {
- 0x74, 0x69, 0x6d, 0x65, 0x64, 0x6f, 0x77, 0x6e, 0x6c, 0x69, 0x66, 0x65, 0x6c,
- 0x65, 0x66, 0x74, 0x62, 0x61, 0x63, 0x6b, 0x63, 0x6f, 0x64, 0x65, 0x64, 0x61,
- 0x74, 0x61, 0x73, 0x68, 0x6f, 0x77, 0x6f, 0x6e, 0x6c, 0x79, 0x73, 0x69, 0x74,
- 0x65, 0x63, 0x69, 0x74, 0x79, 0x6f, 0x70, 0x65, 0x6e, 0x6a, 0x75, 0x73, 0x74,
- 0x6c, 0x69, 0x6b, 0x65, 0x66, 0x72, 0x65, 0x65, 0x77, 0x6f, 0x72, 0x6b, 0x74,
- 0x65, 0x78, 0x74, 0x79, 0x65, 0x61, 0x72, 0x6f, 0x76, 0x65, 0x72, 0x62, 0x6f,
- 0x64, 0x79, 0x6c, 0x6f, 0x76, 0x65, 0x66, 0x6f, 0x72, 0x6d, 0x62, 0x6f, 0x6f,
- 0x6b, 0x70, 0x6c, 0x61, 0x79, 0x6c, 0x69, 0x76, 0x65, 0x6c, 0x69, 0x6e, 0x65,
- 0x68, 0x65, 0x6c, 0x70, 0x68, 0x6f, 0x6d, 0x65, 0x73, 0x69, 0x64, 0x65, 0x6d,
- 0x6f, 0x72, 0x65, 0x77, 0x6f, 0x72, 0x64, 0x6c, 0x6f, 0x6e, 0x67, 0x74, 0x68,
- 0x65, 0x6d, 0x76, 0x69, 0x65, 0x77, 0x66, 0x69, 0x6e, 0x64, 0x70, 0x61, 0x67,
- 0x65, 0x64, 0x61, 0x79, 0x73, 0x66, 0x75, 0x6c, 0x6c, 0x68, 0x65, 0x61, 0x64,
- 0x74, 0x65, 0x72, 0x6d, 0x65, 0x61, 0x63, 0x68, 0x61, 0x72, 0x65, 0x61, 0x66,
- 0x72, 0x6f, 0x6d, 0x74, 0x72, 0x75, 0x65, 0x6d, 0x61, 0x72, 0x6b, 0x61, 0x62,
- 0x6c, 0x65, 0x75, 0x70, 0x6f, 0x6e, 0x68, 0x69, 0x67, 0x68, 0x64, 0x61, 0x74,
- 0x65, 0x6c, 0x61, 0x6e, 0x64, 0x6e, 0x65, 0x77, 0x73, 0x65, 0x76, 0x65, 0x6e,
- 0x6e, 0x65, 0x78, 0x74, 0x63, 0x61, 0x73, 0x65, 0x62, 0x6f, 0x74, 0x68, 0x70,
- 0x6f, 0x73, 0x74, 0x75, 0x73, 0x65, 0x64, 0x6d, 0x61, 0x64, 0x65, 0x68, 0x61,
- 0x6e, 0x64, 0x68, 0x65, 0x72, 0x65, 0x77, 0x68, 0x61, 0x74, 0x6e, 0x61, 0x6d,
- 0x65, 0x4c, 0x69, 0x6e, 0x6b, 0x62, 0x6c, 0x6f, 0x67, 0x73, 0x69, 0x7a, 0x65,
- 0x62, 0x61, 0x73, 0x65, 0x68, 0x65, 0x6c, 0x64, 0x6d, 0x61, 0x6b, 0x65, 0x6d,
- 0x61, 0x69, 0x6e, 0x75, 0x73, 0x65, 0x72, 0x27, 0x29, 0x20, 0x2b, 0x68, 0x6f,
- 0x6c, 0x64, 0x65, 0x6e, 0x64, 0x73, 0x77, 0x69, 0x74, 0x68, 0x4e, 0x65, 0x77,
- 0x73, 0x72, 0x65, 0x61, 0x64, 0x77, 0x65, 0x72, 0x65, 0x73, 0x69, 0x67, 0x6e,
- 0x74, 0x61, 0x6b, 0x65, 0x68, 0x61, 0x76, 0x65, 0x67, 0x61, 0x6d, 0x65, 0x73,
- 0x65, 0x65, 0x6e, 0x63, 0x61, 0x6c, 0x6c, 0x70, 0x61, 0x74, 0x68, 0x77, 0x65,
- 0x6c, 0x6c, 0x70, 0x6c, 0x75, 0x73, 0x6d, 0x65, 0x6e, 0x75, 0x66, 0x69, 0x6c,
- 0x6d, 0x70, 0x61, 0x72, 0x74, 0x6a, 0x6f, 0x69, 0x6e, 0x74, 0x68, 0x69, 0x73,
- 0x6c, 0x69, 0x73, 0x74, 0x67, 0x6f, 0x6f, 0x64, 0x6e, 0x65, 0x65, 0x64, 0x77,
- 0x61, 0x79, 0x73, 0x77, 0x65, 0x73, 0x74, 0x6a, 0x6f, 0x62, 0x73, 0x6d, 0x69,
- 0x6e, 0x64, 0x61, 0x6c, 0x73, 0x6f, 0x6c, 0x6f, 0x67, 0x6f, 0x72, 0x69, 0x63,
- 0x68, 0x75, 0x73, 0x65, 0x73, 0x6c, 0x61, 0x73, 0x74, 0x74, 0x65, 0x61, 0x6d,
- 0x61, 0x72, 0x6d, 0x79, 0x66, 0x6f, 0x6f, 0x64, 0x6b, 0x69, 0x6e, 0x67, 0x77,
- 0x69, 0x6c, 0x6c, 0x65, 0x61, 0x73, 0x74, 0x77, 0x61, 0x72, 0x64, 0x62, 0x65,
- 0x73, 0x74, 0x66, 0x69, 0x72, 0x65, 0x50, 0x61, 0x67, 0x65, 0x6b, 0x6e, 0x6f,
- 0x77, 0x61, 0x77, 0x61, 0x79, 0x2e, 0x70, 0x6e, 0x67, 0x6d, 0x6f, 0x76, 0x65,
- 0x74, 0x68, 0x61, 0x6e, 0x6c, 0x6f, 0x61, 0x64, 0x67, 0x69, 0x76, 0x65, 0x73,
- 0x65, 0x6c, 0x66, 0x6e, 0x6f, 0x74, 0x65, 0x6d, 0x75, 0x63, 0x68, 0x66, 0x65,
- 0x65, 0x64, 0x6d, 0x61, 0x6e, 0x79, 0x72, 0x6f, 0x63, 0x6b, 0x69, 0x63, 0x6f,
- 0x6e, 0x6f, 0x6e, 0x63, 0x65, 0x6c, 0x6f, 0x6f, 0x6b, 0x68, 0x69, 0x64, 0x65,
- 0x64, 0x69, 0x65, 0x64, 0x48, 0x6f, 0x6d, 0x65, 0x72, 0x75, 0x6c, 0x65, 0x68,
- 0x6f, 0x73, 0x74, 0x61, 0x6a, 0x61, 0x78, 0x69, 0x6e, 0x66, 0x6f, 0x63, 0x6c,
- 0x75, 0x62, 0x6c, 0x61, 0x77, 0x73, 0x6c, 0x65, 0x73, 0x73, 0x68, 0x61, 0x6c,
- 0x66, 0x73, 0x6f, 0x6d, 0x65, 0x73, 0x75, 0x63, 0x68, 0x7a, 0x6f, 0x6e, 0x65,
- 0x31, 0x30, 0x30, 0x25, 0x6f, 0x6e, 0x65, 0x73, 0x63, 0x61, 0x72, 0x65, 0x54,
- 0x69, 0x6d, 0x65, 0x72, 0x61, 0x63, 0x65, 0x62, 0x6c, 0x75, 0x65, 0x66, 0x6f,
- 0x75, 0x72, 0x77, 0x65, 0x65, 0x6b, 0x66, 0x61, 0x63, 0x65, 0x68, 0x6f, 0x70,
- 0x65, 0x67, 0x61, 0x76, 0x65, 0x68, 0x61, 0x72, 0x64, 0x6c, 0x6f, 0x73, 0x74,
- 0x77, 0x68, 0x65, 0x6e, 0x70, 0x61, 0x72, 0x6b, 0x6b, 0x65, 0x70, 0x74, 0x70,
- 0x61, 0x73, 0x73, 0x73, 0x68, 0x69, 0x70, 0x72, 0x6f, 0x6f, 0x6d, 0x48, 0x54,
- 0x4d, 0x4c, 0x70, 0x6c, 0x61, 0x6e, 0x54, 0x79, 0x70, 0x65, 0x64, 0x6f, 0x6e,
- 0x65, 0x73, 0x61, 0x76, 0x65, 0x6b, 0x65, 0x65, 0x70, 0x66, 0x6c, 0x61, 0x67,
- 0x6c, 0x69, 0x6e, 0x6b, 0x73, 0x6f, 0x6c, 0x64, 0x66, 0x69, 0x76, 0x65, 0x74,
- 0x6f, 0x6f, 0x6b, 0x72, 0x61, 0x74, 0x65, 0x74, 0x6f, 0x77, 0x6e, 0x6a, 0x75,
- 0x6d, 0x70, 0x74, 0x68, 0x75, 0x73, 0x64, 0x61, 0x72, 0x6b, 0x63, 0x61, 0x72,
- 0x64, 0x66, 0x69, 0x6c, 0x65, 0x66, 0x65, 0x61, 0x72, 0x73, 0x74, 0x61, 0x79,
- 0x6b, 0x69, 0x6c, 0x6c, 0x74, 0x68, 0x61, 0x74, 0x66, 0x61, 0x6c, 0x6c, 0x61,
- 0x75, 0x74, 0x6f, 0x65, 0x76, 0x65, 0x72, 0x2e, 0x63, 0x6f, 0x6d, 0x74, 0x61,
- 0x6c, 0x6b, 0x73, 0x68, 0x6f, 0x70, 0x76, 0x6f, 0x74, 0x65, 0x64, 0x65, 0x65,
- 0x70, 0x6d, 0x6f, 0x64, 0x65, 0x72, 0x65, 0x73, 0x74, 0x74, 0x75, 0x72, 0x6e,
- 0x62, 0x6f, 0x72, 0x6e, 0x62, 0x61, 0x6e, 0x64, 0x66, 0x65, 0x6c, 0x6c, 0x72,
- 0x6f, 0x73, 0x65, 0x75, 0x72, 0x6c, 0x28, 0x73, 0x6b, 0x69, 0x6e, 0x72, 0x6f,
- 0x6c, 0x65, 0x63, 0x6f, 0x6d, 0x65, 0x61, 0x63, 0x74, 0x73, 0x61, 0x67, 0x65,
- 0x73, 0x6d, 0x65, 0x65, 0x74, 0x67, 0x6f, 0x6c, 0x64, 0x2e, 0x6a, 0x70, 0x67,
- 0x69, 0x74, 0x65, 0x6d, 0x76, 0x61, 0x72, 0x79, 0x66, 0x65, 0x6c, 0x74, 0x74,
- 0x68, 0x65, 0x6e, 0x73, 0x65, 0x6e, 0x64, 0x64, 0x72, 0x6f, 0x70, 0x56, 0x69,
- 0x65, 0x77, 0x63, 0x6f, 0x70, 0x79, 0x31, 0x2e, 0x30, 0x22, 0x3c, 0x2f, 0x61,
- 0x3e, 0x73, 0x74, 0x6f, 0x70, 0x65, 0x6c, 0x73, 0x65, 0x6c, 0x69, 0x65, 0x73,
- 0x74, 0x6f, 0x75, 0x72, 0x70, 0x61, 0x63, 0x6b, 0x2e, 0x67, 0x69, 0x66, 0x70,
- 0x61, 0x73, 0x74, 0x63, 0x73, 0x73, 0x3f, 0x67, 0x72, 0x61, 0x79, 0x6d, 0x65,
- 0x61, 0x6e, 0x26, 0x67, 0x74, 0x3b, 0x72, 0x69, 0x64, 0x65, 0x73, 0x68, 0x6f,
- 0x74, 0x6c, 0x61, 0x74, 0x65, 0x73, 0x61, 0x69, 0x64, 0x72, 0x6f, 0x61, 0x64,
- 0x76, 0x61, 0x72, 0x20, 0x66, 0x65, 0x65, 0x6c, 0x6a, 0x6f, 0x68, 0x6e, 0x72,
- 0x69, 0x63, 0x6b, 0x70, 0x6f, 0x72, 0x74, 0x66, 0x61, 0x73, 0x74, 0x27, 0x55,
- 0x41, 0x2d, 0x64, 0x65, 0x61, 0x64, 0x3c, 0x2f, 0x62, 0x3e, 0x70, 0x6f, 0x6f,
- 0x72, 0x62, 0x69, 0x6c, 0x6c, 0x74, 0x79, 0x70, 0x65, 0x55, 0x2e, 0x53, 0x2e,
- 0x77, 0x6f, 0x6f, 0x64, 0x6d, 0x75, 0x73, 0x74, 0x32, 0x70, 0x78, 0x3b, 0x49,
- 0x6e, 0x66, 0x6f, 0x72, 0x61, 0x6e, 0x6b, 0x77, 0x69, 0x64, 0x65, 0x77, 0x61,
- 0x6e, 0x74, 0x77, 0x61, 0x6c, 0x6c, 0x6c, 0x65, 0x61, 0x64, 0x5b, 0x30, 0x5d,
- 0x3b, 0x70, 0x61, 0x75, 0x6c, 0x77, 0x61, 0x76, 0x65, 0x73, 0x75, 0x72, 0x65,
- 0x24, 0x28, 0x27, 0x23, 0x77, 0x61, 0x69, 0x74, 0x6d, 0x61, 0x73, 0x73, 0x61,
- 0x72, 0x6d, 0x73, 0x67, 0x6f, 0x65, 0x73, 0x67, 0x61, 0x69, 0x6e, 0x6c, 0x61,
- 0x6e, 0x67, 0x70, 0x61, 0x69, 0x64, 0x21, 0x2d, 0x2d, 0x20, 0x6c, 0x6f, 0x63,
- 0x6b, 0x75, 0x6e, 0x69, 0x74, 0x72, 0x6f, 0x6f, 0x74, 0x77, 0x61, 0x6c, 0x6b,
- 0x66, 0x69, 0x72, 0x6d, 0x77, 0x69, 0x66, 0x65, 0x78, 0x6d, 0x6c, 0x22, 0x73,
- 0x6f, 0x6e, 0x67, 0x74, 0x65, 0x73, 0x74, 0x32, 0x30, 0x70, 0x78, 0x6b, 0x69,
- 0x6e, 0x64, 0x72, 0x6f, 0x77, 0x73, 0x74, 0x6f, 0x6f, 0x6c, 0x66, 0x6f, 0x6e,
- 0x74, 0x6d, 0x61, 0x69, 0x6c, 0x73, 0x61, 0x66, 0x65, 0x73, 0x74, 0x61, 0x72,
- 0x6d, 0x61, 0x70, 0x73, 0x63, 0x6f, 0x72, 0x65, 0x72, 0x61, 0x69, 0x6e, 0x66,
- 0x6c, 0x6f, 0x77, 0x62, 0x61, 0x62, 0x79, 0x73, 0x70, 0x61, 0x6e, 0x73, 0x61,
- 0x79, 0x73, 0x34, 0x70, 0x78, 0x3b, 0x36, 0x70, 0x78, 0x3b, 0x61, 0x72, 0x74,
- 0x73, 0x66, 0x6f, 0x6f, 0x74, 0x72, 0x65, 0x61, 0x6c, 0x77, 0x69, 0x6b, 0x69,
- 0x68, 0x65, 0x61, 0x74, 0x73, 0x74, 0x65, 0x70, 0x74, 0x72, 0x69, 0x70, 0x6f,
- 0x72, 0x67, 0x2f, 0x6c, 0x61, 0x6b, 0x65, 0x77, 0x65, 0x61, 0x6b, 0x74, 0x6f,
- 0x6c, 0x64, 0x46, 0x6f, 0x72, 0x6d, 0x63, 0x61, 0x73, 0x74, 0x66, 0x61, 0x6e,
- 0x73, 0x62, 0x61, 0x6e, 0x6b, 0x76, 0x65, 0x72, 0x79, 0x72, 0x75, 0x6e, 0x73,
- 0x6a, 0x75, 0x6c, 0x79, 0x74, 0x61, 0x73, 0x6b, 0x31, 0x70, 0x78, 0x3b, 0x67,
- 0x6f, 0x61, 0x6c, 0x67, 0x72, 0x65, 0x77, 0x73, 0x6c, 0x6f, 0x77, 0x65, 0x64,
- 0x67, 0x65, 0x69, 0x64, 0x3d, 0x22, 0x73, 0x65, 0x74, 0x73, 0x35, 0x70, 0x78,
- 0x3b, 0x2e, 0x6a, 0x73, 0x3f, 0x34, 0x30, 0x70, 0x78, 0x69, 0x66, 0x20, 0x28,
- 0x73, 0x6f, 0x6f, 0x6e, 0x73, 0x65, 0x61, 0x74, 0x6e, 0x6f, 0x6e, 0x65, 0x74,
- 0x75, 0x62, 0x65, 0x7a, 0x65, 0x72, 0x6f, 0x73, 0x65, 0x6e, 0x74, 0x72, 0x65,
- 0x65, 0x64, 0x66, 0x61, 0x63, 0x74, 0x69, 0x6e, 0x74, 0x6f, 0x67, 0x69, 0x66,
- 0x74, 0x68, 0x61, 0x72, 0x6d, 0x31, 0x38, 0x70, 0x78, 0x63, 0x61, 0x6d, 0x65,
- 0x68, 0x69, 0x6c, 0x6c, 0x62, 0x6f, 0x6c, 0x64, 0x7a, 0x6f, 0x6f, 0x6d, 0x76,
- 0x6f, 0x69, 0x64, 0x65, 0x61, 0x73, 0x79, 0x72, 0x69, 0x6e, 0x67, 0x66, 0x69,
- 0x6c, 0x6c, 0x70, 0x65, 0x61, 0x6b, 0x69, 0x6e, 0x69, 0x74, 0x63, 0x6f, 0x73,
- 0x74, 0x33, 0x70, 0x78, 0x3b, 0x6a, 0x61, 0x63, 0x6b, 0x74, 0x61, 0x67, 0x73,
- 0x62, 0x69, 0x74, 0x73, 0x72, 0x6f, 0x6c, 0x6c, 0x65, 0x64, 0x69, 0x74, 0x6b,
- 0x6e, 0x65, 0x77, 0x6e, 0x65, 0x61, 0x72, 0x3c, 0x21, 0x2d, 0x2d, 0x67, 0x72,
- 0x6f, 0x77, 0x4a, 0x53, 0x4f, 0x4e, 0x64, 0x75, 0x74, 0x79, 0x4e, 0x61, 0x6d,
- 0x65, 0x73, 0x61, 0x6c, 0x65, 0x79, 0x6f, 0x75, 0x20, 0x6c, 0x6f, 0x74, 0x73,
- 0x70, 0x61, 0x69, 0x6e, 0x6a, 0x61, 0x7a, 0x7a, 0x63, 0x6f, 0x6c, 0x64, 0x65,
- 0x79, 0x65, 0x73, 0x66, 0x69, 0x73, 0x68, 0x77, 0x77, 0x77, 0x2e, 0x72, 0x69,
- 0x73, 0x6b, 0x74, 0x61, 0x62, 0x73, 0x70, 0x72, 0x65, 0x76, 0x31, 0x30, 0x70,
- 0x78, 0x72, 0x69, 0x73, 0x65, 0x32, 0x35, 0x70, 0x78, 0x42, 0x6c, 0x75, 0x65,
- 0x64, 0x69, 0x6e, 0x67, 0x33, 0x30, 0x30, 0x2c, 0x62, 0x61, 0x6c, 0x6c, 0x66,
- 0x6f, 0x72, 0x64, 0x65, 0x61, 0x72, 0x6e, 0x77, 0x69, 0x6c, 0x64, 0x62, 0x6f,
- 0x78, 0x2e, 0x66, 0x61, 0x69, 0x72, 0x6c, 0x61, 0x63, 0x6b, 0x76, 0x65, 0x72,
- 0x73, 0x70, 0x61, 0x69, 0x72, 0x6a, 0x75, 0x6e, 0x65, 0x74, 0x65, 0x63, 0x68,
- 0x69, 0x66, 0x28, 0x21, 0x70, 0x69, 0x63, 0x6b, 0x65, 0x76, 0x69, 0x6c, 0x24,
- 0x28, 0x22, 0x23, 0x77, 0x61, 0x72, 0x6d, 0x6c, 0x6f, 0x72, 0x64, 0x64, 0x6f,
- 0x65, 0x73, 0x70, 0x75, 0x6c, 0x6c, 0x2c, 0x30, 0x30, 0x30, 0x69, 0x64, 0x65,
- 0x61, 0x64, 0x72, 0x61, 0x77, 0x68, 0x75, 0x67, 0x65, 0x73, 0x70, 0x6f, 0x74,
- 0x66, 0x75, 0x6e, 0x64, 0x62, 0x75, 0x72, 0x6e, 0x68, 0x72, 0x65, 0x66, 0x63,
- 0x65, 0x6c, 0x6c, 0x6b, 0x65, 0x79, 0x73, 0x74, 0x69, 0x63, 0x6b, 0x68, 0x6f,
- 0x75, 0x72, 0x6c, 0x6f, 0x73, 0x73, 0x66, 0x75, 0x65, 0x6c, 0x31, 0x32, 0x70,
- 0x78, 0x73, 0x75, 0x69, 0x74, 0x64, 0x65, 0x61, 0x6c, 0x52, 0x53, 0x53, 0x22,
- 0x61, 0x67, 0x65, 0x64, 0x67, 0x72, 0x65, 0x79, 0x47, 0x45, 0x54, 0x22, 0x65,
- 0x61, 0x73, 0x65, 0x61, 0x69, 0x6d, 0x73, 0x67, 0x69, 0x72, 0x6c, 0x61, 0x69,
- 0x64, 0x73, 0x38, 0x70, 0x78, 0x3b, 0x6e, 0x61, 0x76, 0x79, 0x67, 0x72, 0x69,
- 0x64, 0x74, 0x69, 0x70, 0x73, 0x23, 0x39, 0x39, 0x39, 0x77, 0x61, 0x72, 0x73,
- 0x6c, 0x61, 0x64, 0x79, 0x63, 0x61, 0x72, 0x73, 0x29, 0x3b, 0x20, 0x7d, 0x70,
- 0x68, 0x70, 0x3f, 0x68, 0x65, 0x6c, 0x6c, 0x74, 0x61, 0x6c, 0x6c, 0x77, 0x68,
- 0x6f, 0x6d, 0x7a, 0x68, 0x3a, 0xe5, 0x2a, 0x2f, 0x0d, 0x0a, 0x20, 0x31, 0x30,
- 0x30, 0x68, 0x61, 0x6c, 0x6c, 0x2e, 0x0a, 0x0a, 0x41, 0x37, 0x70, 0x78, 0x3b,
- 0x70, 0x75, 0x73, 0x68, 0x63, 0x68, 0x61, 0x74, 0x30, 0x70, 0x78, 0x3b, 0x63,
- 0x72, 0x65, 0x77, 0x2a, 0x2f, 0x3c, 0x2f, 0x68, 0x61, 0x73, 0x68, 0x37, 0x35,
- 0x70, 0x78, 0x66, 0x6c, 0x61, 0x74, 0x72, 0x61, 0x72, 0x65, 0x20, 0x26, 0x26,
- 0x20, 0x74, 0x65, 0x6c, 0x6c, 0x63, 0x61, 0x6d, 0x70, 0x6f, 0x6e, 0x74, 0x6f,
- 0x6c, 0x61, 0x69, 0x64, 0x6d, 0x69, 0x73, 0x73, 0x73, 0x6b, 0x69, 0x70, 0x74,
- 0x65, 0x6e, 0x74, 0x66, 0x69, 0x6e, 0x65, 0x6d, 0x61, 0x6c, 0x65, 0x67, 0x65,
- 0x74, 0x73, 0x70, 0x6c, 0x6f, 0x74, 0x34, 0x30, 0x30, 0x2c, 0x0d, 0x0a, 0x0d,
- 0x0a, 0x63, 0x6f, 0x6f, 0x6c, 0x66, 0x65, 0x65, 0x74, 0x2e, 0x70, 0x68, 0x70,
- 0x3c, 0x62, 0x72, 0x3e, 0x65, 0x72, 0x69, 0x63, 0x6d, 0x6f, 0x73, 0x74, 0x67,
- 0x75, 0x69, 0x64, 0x62, 0x65, 0x6c, 0x6c, 0x64, 0x65, 0x73, 0x63, 0x68, 0x61,
- 0x69, 0x72, 0x6d, 0x61, 0x74, 0x68, 0x61, 0x74, 0x6f, 0x6d, 0x2f, 0x69, 0x6d,
- 0x67, 0x26, 0x23, 0x38, 0x32, 0x6c, 0x75, 0x63, 0x6b, 0x63, 0x65, 0x6e, 0x74,
- 0x30, 0x30, 0x30, 0x3b, 0x74, 0x69, 0x6e, 0x79, 0x67, 0x6f, 0x6e, 0x65, 0x68,
- 0x74, 0x6d, 0x6c, 0x73, 0x65, 0x6c, 0x6c, 0x64, 0x72, 0x75, 0x67, 0x46, 0x52,
- 0x45, 0x45, 0x6e, 0x6f, 0x64, 0x65, 0x6e, 0x69, 0x63, 0x6b, 0x3f, 0x69, 0x64,
- 0x3d, 0x6c, 0x6f, 0x73, 0x65, 0x6e, 0x75, 0x6c, 0x6c, 0x76, 0x61, 0x73, 0x74,
- 0x77, 0x69, 0x6e, 0x64, 0x52, 0x53, 0x53, 0x20, 0x77, 0x65, 0x61, 0x72, 0x72,
- 0x65, 0x6c, 0x79, 0x62, 0x65, 0x65, 0x6e, 0x73, 0x61, 0x6d, 0x65, 0x64, 0x75,
- 0x6b, 0x65, 0x6e, 0x61, 0x73, 0x61, 0x63, 0x61, 0x70, 0x65, 0x77, 0x69, 0x73,
- 0x68, 0x67, 0x75, 0x6c, 0x66, 0x54, 0x32, 0x33, 0x3a, 0x68, 0x69, 0x74, 0x73,
- 0x73, 0x6c, 0x6f, 0x74, 0x67, 0x61, 0x74, 0x65, 0x6b, 0x69, 0x63, 0x6b, 0x62,
- 0x6c, 0x75, 0x72, 0x74, 0x68, 0x65, 0x79, 0x31, 0x35, 0x70, 0x78, 0x27, 0x27,
- 0x29, 0x3b, 0x29, 0x3b, 0x22, 0x3e, 0x6d, 0x73, 0x69, 0x65, 0x77, 0x69, 0x6e,
- 0x73, 0x62, 0x69, 0x72, 0x64, 0x73, 0x6f, 0x72, 0x74, 0x62, 0x65, 0x74, 0x61,
- 0x73, 0x65, 0x65, 0x6b, 0x54, 0x31, 0x38, 0x3a, 0x6f, 0x72, 0x64, 0x73, 0x74,
- 0x72, 0x65, 0x65, 0x6d, 0x61, 0x6c, 0x6c, 0x36, 0x30, 0x70, 0x78, 0x66, 0x61,
- 0x72, 0x6d, 0xe2, 0x80, 0x99, 0x73, 0x62, 0x6f, 0x79, 0x73, 0x5b, 0x30, 0x5d,
- 0x2e, 0x27, 0x29, 0x3b, 0x22, 0x50, 0x4f, 0x53, 0x54, 0x62, 0x65, 0x61, 0x72,
- 0x6b, 0x69, 0x64, 0x73, 0x29, 0x3b, 0x7d, 0x7d, 0x6d, 0x61, 0x72, 0x79, 0x74,
- 0x65, 0x6e, 0x64, 0x28, 0x55, 0x4b, 0x29, 0x71, 0x75, 0x61, 0x64, 0x7a, 0x68,
- 0x3a, 0xe6, 0x2d, 0x73, 0x69, 0x7a, 0x2d, 0x2d, 0x2d, 0x2d, 0x70, 0x72, 0x6f,
- 0x70, 0x27, 0x29, 0x3b, 0x0d, 0x6c, 0x69, 0x66, 0x74, 0x54, 0x31, 0x39, 0x3a,
- 0x76, 0x69, 0x63, 0x65, 0x61, 0x6e, 0x64, 0x79, 0x64, 0x65, 0x62, 0x74, 0x3e,
- 0x52, 0x53, 0x53, 0x70, 0x6f, 0x6f, 0x6c, 0x6e, 0x65, 0x63, 0x6b, 0x62, 0x6c,
- 0x6f, 0x77, 0x54, 0x31, 0x36, 0x3a, 0x64, 0x6f, 0x6f, 0x72, 0x65, 0x76, 0x61,
- 0x6c, 0x54, 0x31, 0x37, 0x3a, 0x6c, 0x65, 0x74, 0x73, 0x66, 0x61, 0x69, 0x6c,
- 0x6f, 0x72, 0x61, 0x6c, 0x70, 0x6f, 0x6c, 0x6c, 0x6e, 0x6f, 0x76, 0x61, 0x63,
- 0x6f, 0x6c, 0x73, 0x67, 0x65, 0x6e, 0x65, 0x20, 0xe2, 0x80, 0x94, 0x73, 0x6f,
- 0x66, 0x74, 0x72, 0x6f, 0x6d, 0x65, 0x74, 0x69, 0x6c, 0x6c, 0x72, 0x6f, 0x73,
- 0x73, 0x3c, 0x68, 0x33, 0x3e, 0x70, 0x6f, 0x75, 0x72, 0x66, 0x61, 0x64, 0x65,
- 0x70, 0x69, 0x6e, 0x6b, 0x3c, 0x74, 0x72, 0x3e, 0x6d, 0x69, 0x6e, 0x69, 0x29,
- 0x7c, 0x21, 0x28, 0x6d, 0x69, 0x6e, 0x65, 0x7a, 0x68, 0x3a, 0xe8, 0x62, 0x61,
- 0x72, 0x73, 0x68, 0x65, 0x61, 0x72, 0x30, 0x30, 0x29, 0x3b, 0x6d, 0x69, 0x6c,
- 0x6b, 0x20, 0x2d, 0x2d, 0x3e, 0x69, 0x72, 0x6f, 0x6e, 0x66, 0x72, 0x65, 0x64,
- 0x64, 0x69, 0x73, 0x6b, 0x77, 0x65, 0x6e, 0x74, 0x73, 0x6f, 0x69, 0x6c, 0x70,
- 0x75, 0x74, 0x73, 0x2f, 0x6a, 0x73, 0x2f, 0x68, 0x6f, 0x6c, 0x79, 0x54, 0x32,
- 0x32, 0x3a, 0x49, 0x53, 0x42, 0x4e, 0x54, 0x32, 0x30, 0x3a, 0x61, 0x64, 0x61,
- 0x6d, 0x73, 0x65, 0x65, 0x73, 0x3c, 0x68, 0x32, 0x3e, 0x6a, 0x73, 0x6f, 0x6e,
- 0x27, 0x2c, 0x20, 0x27, 0x63, 0x6f, 0x6e, 0x74, 0x54, 0x32, 0x31, 0x3a, 0x20,
- 0x52, 0x53, 0x53, 0x6c, 0x6f, 0x6f, 0x70, 0x61, 0x73, 0x69, 0x61, 0x6d, 0x6f,
- 0x6f, 0x6e, 0x3c, 0x2f, 0x70, 0x3e, 0x73, 0x6f, 0x75, 0x6c, 0x4c, 0x49, 0x4e,
- 0x45, 0x66, 0x6f, 0x72, 0x74, 0x63, 0x61, 0x72, 0x74, 0x54, 0x31, 0x34, 0x3a,
- 0x3c, 0x68, 0x31, 0x3e, 0x38, 0x30, 0x70, 0x78, 0x21, 0x2d, 0x2d, 0x3c, 0x39,
- 0x70, 0x78, 0x3b, 0x54, 0x30, 0x34, 0x3a, 0x6d, 0x69, 0x6b, 0x65, 0x3a, 0x34,
- 0x36, 0x5a, 0x6e, 0x69, 0x63, 0x65, 0x69, 0x6e, 0x63, 0x68, 0x59, 0x6f, 0x72,
- 0x6b, 0x72, 0x69, 0x63, 0x65, 0x7a, 0x68, 0x3a, 0xe4, 0x27, 0x29, 0x29, 0x3b,
- 0x70, 0x75, 0x72, 0x65, 0x6d, 0x61, 0x67, 0x65, 0x70, 0x61, 0x72, 0x61, 0x74,
- 0x6f, 0x6e, 0x65, 0x62, 0x6f, 0x6e, 0x64, 0x3a, 0x33, 0x37, 0x5a, 0x5f, 0x6f,
- 0x66, 0x5f, 0x27, 0x5d, 0x29, 0x3b, 0x30, 0x30, 0x30, 0x2c, 0x7a, 0x68, 0x3a,
- 0xe7, 0x74, 0x61, 0x6e, 0x6b, 0x79, 0x61, 0x72, 0x64, 0x62, 0x6f, 0x77, 0x6c,
- 0x62, 0x75, 0x73, 0x68, 0x3a, 0x35, 0x36, 0x5a, 0x4a, 0x61, 0x76, 0x61, 0x33,
- 0x30, 0x70, 0x78, 0x0a, 0x7c, 0x7d, 0x0a, 0x25, 0x43, 0x33, 0x25, 0x3a, 0x33,
- 0x34, 0x5a, 0x6a, 0x65, 0x66, 0x66, 0x45, 0x58, 0x50, 0x49, 0x63, 0x61, 0x73,
- 0x68, 0x76, 0x69, 0x73, 0x61, 0x67, 0x6f, 0x6c, 0x66, 0x73, 0x6e, 0x6f, 0x77,
- 0x7a, 0x68, 0x3a, 0xe9, 0x71, 0x75, 0x65, 0x72, 0x2e, 0x63, 0x73, 0x73, 0x73,
- 0x69, 0x63, 0x6b, 0x6d, 0x65, 0x61, 0x74, 0x6d, 0x69, 0x6e, 0x2e, 0x62, 0x69,
- 0x6e, 0x64, 0x64, 0x65, 0x6c, 0x6c, 0x68, 0x69, 0x72, 0x65, 0x70, 0x69, 0x63,
- 0x73, 0x72, 0x65, 0x6e, 0x74, 0x3a, 0x33, 0x36, 0x5a, 0x48, 0x54, 0x54, 0x50,
- 0x2d, 0x32, 0x30, 0x31, 0x66, 0x6f, 0x74, 0x6f, 0x77, 0x6f, 0x6c, 0x66, 0x45,
- 0x4e, 0x44, 0x20, 0x78, 0x62, 0x6f, 0x78, 0x3a, 0x35, 0x34, 0x5a, 0x42, 0x4f,
- 0x44, 0x59, 0x64, 0x69, 0x63, 0x6b, 0x3b, 0x0a, 0x7d, 0x0a, 0x65, 0x78, 0x69,
- 0x74, 0x3a, 0x33, 0x35, 0x5a, 0x76, 0x61, 0x72, 0x73, 0x62, 0x65, 0x61, 0x74,
- 0x27, 0x7d, 0x29, 0x3b, 0x64, 0x69, 0x65, 0x74, 0x39, 0x39, 0x39, 0x3b, 0x61,
- 0x6e, 0x6e, 0x65, 0x7d, 0x7d, 0x3c, 0x2f, 0x5b, 0x69, 0x5d, 0x2e, 0x4c, 0x61,
- 0x6e, 0x67, 0x6b, 0x6d, 0xc2, 0xb2, 0x77, 0x69, 0x72, 0x65, 0x74, 0x6f, 0x79,
- 0x73, 0x61, 0x64, 0x64, 0x73, 0x73, 0x65, 0x61, 0x6c, 0x61, 0x6c, 0x65, 0x78,
- 0x3b, 0x0a, 0x09, 0x7d, 0x65, 0x63, 0x68, 0x6f, 0x6e, 0x69, 0x6e, 0x65, 0x2e,
- 0x6f, 0x72, 0x67, 0x30, 0x30, 0x35, 0x29, 0x74, 0x6f, 0x6e, 0x79, 0x6a, 0x65,
- 0x77, 0x73, 0x73, 0x61, 0x6e, 0x64, 0x6c, 0x65, 0x67, 0x73, 0x72, 0x6f, 0x6f,
- 0x66, 0x30, 0x30, 0x30, 0x29, 0x20, 0x32, 0x30, 0x30, 0x77, 0x69, 0x6e, 0x65,
- 0x67, 0x65, 0x61, 0x72, 0x64, 0x6f, 0x67, 0x73, 0x62, 0x6f, 0x6f, 0x74, 0x67,
- 0x61, 0x72, 0x79, 0x63, 0x75, 0x74, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x74, 0x65,
- 0x6d, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x78, 0x6d, 0x6c, 0x63, 0x6f, 0x63,
- 0x6b, 0x67, 0x61, 0x6e, 0x67, 0x24, 0x28, 0x27, 0x2e, 0x35, 0x30, 0x70, 0x78,
- 0x50, 0x68, 0x2e, 0x44, 0x6d, 0x69, 0x73, 0x63, 0x61, 0x6c, 0x61, 0x6e, 0x6c,
- 0x6f, 0x61, 0x6e, 0x64, 0x65, 0x73, 0x6b, 0x6d, 0x69, 0x6c, 0x65, 0x72, 0x79,
- 0x61, 0x6e, 0x75, 0x6e, 0x69, 0x78, 0x64, 0x69, 0x73, 0x63, 0x29, 0x3b, 0x7d,
- 0x0a, 0x64, 0x75, 0x73, 0x74, 0x63, 0x6c, 0x69, 0x70, 0x29, 0x2e, 0x0a, 0x0a,
- 0x37, 0x30, 0x70, 0x78, 0x2d, 0x32, 0x30, 0x30, 0x44, 0x56, 0x44, 0x73, 0x37,
- 0x5d, 0x3e, 0x3c, 0x74, 0x61, 0x70, 0x65, 0x64, 0x65, 0x6d, 0x6f, 0x69, 0x2b,
- 0x2b, 0x29, 0x77, 0x61, 0x67, 0x65, 0x65, 0x75, 0x72, 0x6f, 0x70, 0x68, 0x69,
- 0x6c, 0x6f, 0x70, 0x74, 0x73, 0x68, 0x6f, 0x6c, 0x65, 0x46, 0x41, 0x51, 0x73,
- 0x61, 0x73, 0x69, 0x6e, 0x2d, 0x32, 0x36, 0x54, 0x6c, 0x61, 0x62, 0x73, 0x70,
- 0x65, 0x74, 0x73, 0x55, 0x52, 0x4c, 0x20, 0x62, 0x75, 0x6c, 0x6b, 0x63, 0x6f,
- 0x6f, 0x6b, 0x3b, 0x7d, 0x0d, 0x0a, 0x48, 0x45, 0x41, 0x44, 0x5b, 0x30, 0x5d,
- 0x29, 0x61, 0x62, 0x62, 0x72, 0x6a, 0x75, 0x61, 0x6e, 0x28, 0x31, 0x39, 0x38,
- 0x6c, 0x65, 0x73, 0x68, 0x74, 0x77, 0x69, 0x6e, 0x3c, 0x2f, 0x69, 0x3e, 0x73,
- 0x6f, 0x6e, 0x79, 0x67, 0x75, 0x79, 0x73, 0x66, 0x75, 0x63, 0x6b, 0x70, 0x69,
- 0x70, 0x65, 0x7c, 0x2d, 0x0a, 0x21, 0x30, 0x30, 0x32, 0x29, 0x6e, 0x64, 0x6f,
- 0x77, 0x5b, 0x31, 0x5d, 0x3b, 0x5b, 0x5d, 0x3b, 0x0a, 0x4c, 0x6f, 0x67, 0x20,
- 0x73, 0x61, 0x6c, 0x74, 0x0d, 0x0a, 0x09, 0x09, 0x62, 0x61, 0x6e, 0x67, 0x74,
- 0x72, 0x69, 0x6d, 0x62, 0x61, 0x74, 0x68, 0x29, 0x7b, 0x0d, 0x0a, 0x30, 0x30,
- 0x70, 0x78, 0x0a, 0x7d, 0x29, 0x3b, 0x6b, 0x6f, 0x3a, 0xec, 0x66, 0x65, 0x65,
- 0x73, 0x61, 0x64, 0x3e, 0x0d, 0x73, 0x3a, 0x2f, 0x2f, 0x20, 0x5b, 0x5d, 0x3b,
- 0x74, 0x6f, 0x6c, 0x6c, 0x70, 0x6c, 0x75, 0x67, 0x28, 0x29, 0x7b, 0x0a, 0x7b,
- 0x0d, 0x0a, 0x20, 0x2e, 0x6a, 0x73, 0x27, 0x32, 0x30, 0x30, 0x70, 0x64, 0x75,
- 0x61, 0x6c, 0x62, 0x6f, 0x61, 0x74, 0x2e, 0x4a, 0x50, 0x47, 0x29, 0x3b, 0x0a,
- 0x7d, 0x71, 0x75, 0x6f, 0x74, 0x29, 0x3b, 0x0a, 0x0a, 0x27, 0x29, 0x3b, 0x0a,
- 0x0d, 0x0a, 0x7d, 0x0d, 0x32, 0x30, 0x31, 0x34, 0x32, 0x30, 0x31, 0x35, 0x32,
- 0x30, 0x31, 0x36, 0x32, 0x30, 0x31, 0x37, 0x32, 0x30, 0x31, 0x38, 0x32, 0x30,
- 0x31, 0x39, 0x32, 0x30, 0x32, 0x30, 0x32, 0x30, 0x32, 0x31, 0x32, 0x30, 0x32,
- 0x32, 0x32, 0x30, 0x32, 0x33, 0x32, 0x30, 0x32, 0x34, 0x32, 0x30, 0x32, 0x35,
- 0x32, 0x30, 0x32, 0x36, 0x32, 0x30, 0x32, 0x37, 0x32, 0x30, 0x32, 0x38, 0x32,
- 0x30, 0x32, 0x39, 0x32, 0x30, 0x33, 0x30, 0x32, 0x30, 0x33, 0x31, 0x32, 0x30,
- 0x33, 0x32, 0x32, 0x30, 0x33, 0x33, 0x32, 0x30, 0x33, 0x34, 0x32, 0x30, 0x33,
- 0x35, 0x32, 0x30, 0x33, 0x36, 0x32, 0x30, 0x33, 0x37, 0x32, 0x30, 0x31, 0x33,
- 0x32, 0x30, 0x31, 0x32, 0x32, 0x30, 0x31, 0x31, 0x32, 0x30, 0x31, 0x30, 0x32,
- 0x30, 0x30, 0x39, 0x32, 0x30, 0x30, 0x38, 0x32, 0x30, 0x30, 0x37, 0x32, 0x30,
- 0x30, 0x36, 0x32, 0x30, 0x30, 0x35, 0x32, 0x30, 0x30, 0x34, 0x32, 0x30, 0x30,
- 0x33, 0x32, 0x30, 0x30, 0x32, 0x32, 0x30, 0x30, 0x31, 0x32, 0x30, 0x30, 0x30,
- 0x31, 0x39, 0x39, 0x39, 0x31, 0x39, 0x39, 0x38, 0x31, 0x39, 0x39, 0x37, 0x31,
- 0x39, 0x39, 0x36, 0x31, 0x39, 0x39, 0x35, 0x31, 0x39, 0x39, 0x34, 0x31, 0x39,
- 0x39, 0x33, 0x31, 0x39, 0x39, 0x32, 0x31, 0x39, 0x39, 0x31, 0x31, 0x39, 0x39,
- 0x30, 0x31, 0x39, 0x38, 0x39, 0x31, 0x39, 0x38, 0x38, 0x31, 0x39, 0x38, 0x37,
- 0x31, 0x39, 0x38, 0x36, 0x31, 0x39, 0x38, 0x35, 0x31, 0x39, 0x38, 0x34, 0x31,
- 0x39, 0x38, 0x33, 0x31, 0x39, 0x38, 0x32, 0x31, 0x39, 0x38, 0x31, 0x31, 0x39,
- 0x38, 0x30, 0x31, 0x39, 0x37, 0x39, 0x31, 0x39, 0x37, 0x38, 0x31, 0x39, 0x37,
- 0x37, 0x31, 0x39, 0x37, 0x36, 0x31, 0x39, 0x37, 0x35, 0x31, 0x39, 0x37, 0x34,
- 0x31, 0x39, 0x37, 0x33, 0x31, 0x39, 0x37, 0x32, 0x31, 0x39, 0x37, 0x31, 0x31,
- 0x39, 0x37, 0x30, 0x31, 0x39, 0x36, 0x39, 0x31, 0x39, 0x36, 0x38, 0x31, 0x39,
- 0x36, 0x37, 0x31, 0x39, 0x36, 0x36, 0x31, 0x39, 0x36, 0x35, 0x31, 0x39, 0x36,
- 0x34, 0x31, 0x39, 0x36, 0x33, 0x31, 0x39, 0x36, 0x32, 0x31, 0x39, 0x36, 0x31,
- 0x31, 0x39, 0x36, 0x30, 0x31, 0x39, 0x35, 0x39, 0x31, 0x39, 0x35, 0x38, 0x31,
- 0x39, 0x35, 0x37, 0x31, 0x39, 0x35, 0x36, 0x31, 0x39, 0x35, 0x35, 0x31, 0x39,
- 0x35, 0x34, 0x31, 0x39, 0x35, 0x33, 0x31, 0x39, 0x35, 0x32, 0x31, 0x39, 0x35,
- 0x31, 0x31, 0x39, 0x35, 0x30, 0x31, 0x30, 0x30, 0x30, 0x31, 0x30, 0x32, 0x34,
- 0x31, 0x33, 0x39, 0x34, 0x30, 0x30, 0x30, 0x30, 0x39, 0x39, 0x39, 0x39, 0x63,
- 0x6f, 0x6d, 0x6f, 0x6d, 0xc3, 0xa1, 0x73, 0x65, 0x73, 0x74, 0x65, 0x65, 0x73,
- 0x74, 0x61, 0x70, 0x65, 0x72, 0x6f, 0x74, 0x6f, 0x64, 0x6f, 0x68, 0x61, 0x63,
- 0x65, 0x63, 0x61, 0x64, 0x61, 0x61, 0xc3, 0xb1, 0x6f, 0x62, 0x69, 0x65, 0x6e,
- 0x64, 0xc3, 0xad, 0x61, 0x61, 0x73, 0xc3, 0xad, 0x76, 0x69, 0x64, 0x61, 0x63,
- 0x61, 0x73, 0x6f, 0x6f, 0x74, 0x72, 0x6f, 0x66, 0x6f, 0x72, 0x6f, 0x73, 0x6f,
- 0x6c, 0x6f, 0x6f, 0x74, 0x72, 0x61, 0x63, 0x75, 0x61, 0x6c, 0x64, 0x69, 0x6a,
- 0x6f, 0x73, 0x69, 0x64, 0x6f, 0x67, 0x72, 0x61, 0x6e, 0x74, 0x69, 0x70, 0x6f,
- 0x74, 0x65, 0x6d, 0x61, 0x64, 0x65, 0x62, 0x65, 0x61, 0x6c, 0x67, 0x6f, 0x71,
- 0x75, 0xc3, 0xa9, 0x65, 0x73, 0x74, 0x6f, 0x6e, 0x61, 0x64, 0x61, 0x74, 0x72,
- 0x65, 0x73, 0x70, 0x6f, 0x63, 0x6f, 0x63, 0x61, 0x73, 0x61, 0x62, 0x61, 0x6a,
- 0x6f, 0x74, 0x6f, 0x64, 0x61, 0x73, 0x69, 0x6e, 0x6f, 0x61, 0x67, 0x75, 0x61,
- 0x70, 0x75, 0x65, 0x73, 0x75, 0x6e, 0x6f, 0x73, 0x61, 0x6e, 0x74, 0x65, 0x64,
- 0x69, 0x63, 0x65, 0x6c, 0x75, 0x69, 0x73, 0x65, 0x6c, 0x6c, 0x61, 0x6d, 0x61,
- 0x79, 0x6f, 0x7a, 0x6f, 0x6e, 0x61, 0x61, 0x6d, 0x6f, 0x72, 0x70, 0x69, 0x73,
- 0x6f, 0x6f, 0x62, 0x72, 0x61, 0x63, 0x6c, 0x69, 0x63, 0x65, 0x6c, 0x6c, 0x6f,
- 0x64, 0x69, 0x6f, 0x73, 0x68, 0x6f, 0x72, 0x61, 0x63, 0x61, 0x73, 0x69, 0xd0,
- 0xb7, 0xd0, 0xb0, 0xd0, 0xbd, 0xd0, 0xb0, 0xd0, 0xbe, 0xd0, 0xbc, 0xd1, 0x80,
- 0xd0, 0xb0, 0xd1, 0x80, 0xd1, 0x83, 0xd1, 0x82, 0xd0, 0xb0, 0xd0, 0xbd, 0xd0,
- 0xb5, 0xd0, 0xbf, 0xd0, 0xbe, 0xd0, 0xbe, 0xd1, 0x82, 0xd0, 0xb8, 0xd0, 0xb7,
- 0xd0, 0xbd, 0xd0, 0xbe, 0xd0, 0xb4, 0xd0, 0xbe, 0xd1, 0x82, 0xd0, 0xbe, 0xd0,
- 0xb6, 0xd0, 0xb5, 0xd0, 0xbe, 0xd0, 0xbd, 0xd0, 0xb8, 0xd1, 0x85, 0xd0, 0x9d,
- 0xd0, 0xb0, 0xd0, 0xb5, 0xd0, 0xb5, 0xd0, 0xb1, 0xd1, 0x8b, 0xd0, 0xbc, 0xd1,
- 0x8b, 0xd0, 0x92, 0xd1, 0x8b, 0xd1, 0x81, 0xd0, 0xbe, 0xd0, 0xb2, 0xd1, 0x8b,
- 0xd0, 0xb2, 0xd0, 0xbe, 0xd0, 0x9d, 0xd0, 0xbe, 0xd0, 0xbe, 0xd0, 0xb1, 0xd0,
- 0x9f, 0xd0, 0xbe, 0xd0, 0xbb, 0xd0, 0xb8, 0xd0, 0xbd, 0xd0, 0xb8, 0xd0, 0xa0,
- 0xd0, 0xa4, 0xd0, 0x9d, 0xd0, 0xb5, 0xd0, 0x9c, 0xd1, 0x8b, 0xd1, 0x82, 0xd1,
- 0x8b, 0xd0, 0x9e, 0xd0, 0xbd, 0xd0, 0xb8, 0xd0, 0xbc, 0xd0, 0xb4, 0xd0, 0xb0,
- 0xd0, 0x97, 0xd0, 0xb0, 0xd0, 0x94, 0xd0, 0xb0, 0xd0, 0x9d, 0xd1, 0x83, 0xd0,
- 0x9e, 0xd0, 0xb1, 0xd1, 0x82, 0xd0, 0xb5, 0xd0, 0x98, 0xd0, 0xb7, 0xd0, 0xb5,
- 0xd0, 0xb9, 0xd0, 0xbd, 0xd1, 0x83, 0xd0, 0xbc, 0xd0, 0xbc, 0xd0, 0xa2, 0xd1,
- 0x8b, 0xd1, 0x83, 0xd0, 0xb6, 0xd9, 0x81, 0xd9, 0x8a, 0xd8, 0xa3, 0xd9, 0x86,
- 0xd9, 0x85, 0xd8, 0xa7, 0xd9, 0x85, 0xd8, 0xb9, 0xd9, 0x83, 0xd9, 0x84, 0xd8,
- 0xa3, 0xd9, 0x88, 0xd8, 0xb1, 0xd8, 0xaf, 0xd9, 0x8a, 0xd8, 0xa7, 0xd9, 0x81,
- 0xd9, 0x89, 0xd9, 0x87, 0xd9, 0x88, 0xd9, 0x84, 0xd9, 0x85, 0xd9, 0x84, 0xd9,
- 0x83, 0xd8, 0xa7, 0xd9, 0x88, 0xd9, 0x84, 0xd9, 0x87, 0xd8, 0xa8, 0xd8, 0xb3,
- 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa5, 0xd9, 0x86, 0xd9, 0x87, 0xd9, 0x8a, 0xd8,
- 0xa3, 0xd9, 0x8a, 0xd9, 0x82, 0xd8, 0xaf, 0xd9, 0x87, 0xd9, 0x84, 0xd8, 0xab,
- 0xd9, 0x85, 0xd8, 0xa8, 0xd9, 0x87, 0xd9, 0x84, 0xd9, 0x88, 0xd9, 0x84, 0xd9,
- 0x8a, 0xd8, 0xa8, 0xd9, 0x84, 0xd8, 0xa7, 0xd9, 0x8a, 0xd8, 0xa8, 0xd9, 0x83,
- 0xd8, 0xb4, 0xd9, 0x8a, 0xd8, 0xa7, 0xd9, 0x85, 0xd8, 0xa3, 0xd9, 0x85, 0xd9,
- 0x86, 0xd8, 0xaa, 0xd8, 0xa8, 0xd9, 0x8a, 0xd9, 0x84, 0xd9, 0x86, 0xd8, 0xad,
- 0xd8, 0xa8, 0xd9, 0x87, 0xd9, 0x85, 0xd9, 0x85, 0xd8, 0xb4, 0xd9, 0x88, 0xd8,
- 0xb4, 0x66, 0x69, 0x72, 0x73, 0x74, 0x76, 0x69, 0x64, 0x65, 0x6f, 0x6c, 0x69,
- 0x67, 0x68, 0x74, 0x77, 0x6f, 0x72, 0x6c, 0x64, 0x6d, 0x65, 0x64, 0x69, 0x61,
- 0x77, 0x68, 0x69, 0x74, 0x65, 0x63, 0x6c, 0x6f, 0x73, 0x65, 0x62, 0x6c, 0x61,
- 0x63, 0x6b, 0x72, 0x69, 0x67, 0x68, 0x74, 0x73, 0x6d, 0x61, 0x6c, 0x6c, 0x62,
- 0x6f, 0x6f, 0x6b, 0x73, 0x70, 0x6c, 0x61, 0x63, 0x65, 0x6d, 0x75, 0x73, 0x69,
- 0x63, 0x66, 0x69, 0x65, 0x6c, 0x64, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x70, 0x6f,
- 0x69, 0x6e, 0x74, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x6c, 0x65, 0x76, 0x65, 0x6c,
- 0x74, 0x61, 0x62, 0x6c, 0x65, 0x62, 0x6f, 0x61, 0x72, 0x64, 0x68, 0x6f, 0x75,
- 0x73, 0x65, 0x67, 0x72, 0x6f, 0x75, 0x70, 0x77, 0x6f, 0x72, 0x6b, 0x73, 0x79,
- 0x65, 0x61, 0x72, 0x73, 0x73, 0x74, 0x61, 0x74, 0x65, 0x74, 0x6f, 0x64, 0x61,
- 0x79, 0x77, 0x61, 0x74, 0x65, 0x72, 0x73, 0x74, 0x61, 0x72, 0x74, 0x73, 0x74,
- 0x79, 0x6c, 0x65, 0x64, 0x65, 0x61, 0x74, 0x68, 0x70, 0x6f, 0x77, 0x65, 0x72,
- 0x70, 0x68, 0x6f, 0x6e, 0x65, 0x6e, 0x69, 0x67, 0x68, 0x74, 0x65, 0x72, 0x72,
- 0x6f, 0x72, 0x69, 0x6e, 0x70, 0x75, 0x74, 0x61, 0x62, 0x6f, 0x75, 0x74, 0x74,
- 0x65, 0x72, 0x6d, 0x73, 0x74, 0x69, 0x74, 0x6c, 0x65, 0x74, 0x6f, 0x6f, 0x6c,
- 0x73, 0x65, 0x76, 0x65, 0x6e, 0x74, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x74, 0x69,
- 0x6d, 0x65, 0x73, 0x6c, 0x61, 0x72, 0x67, 0x65, 0x77, 0x6f, 0x72, 0x64, 0x73,
- 0x67, 0x61, 0x6d, 0x65, 0x73, 0x73, 0x68, 0x6f, 0x72, 0x74, 0x73, 0x70, 0x61,
- 0x63, 0x65, 0x66, 0x6f, 0x63, 0x75, 0x73, 0x63, 0x6c, 0x65, 0x61, 0x72, 0x6d,
- 0x6f, 0x64, 0x65, 0x6c, 0x62, 0x6c, 0x6f, 0x63, 0x6b, 0x67, 0x75, 0x69, 0x64,
- 0x65, 0x72, 0x61, 0x64, 0x69, 0x6f, 0x73, 0x68, 0x61, 0x72, 0x65, 0x77, 0x6f,
- 0x6d, 0x65, 0x6e, 0x61, 0x67, 0x61, 0x69, 0x6e, 0x6d, 0x6f, 0x6e, 0x65, 0x79,
- 0x69, 0x6d, 0x61, 0x67, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x73, 0x79, 0x6f, 0x75,
- 0x6e, 0x67, 0x6c, 0x69, 0x6e, 0x65, 0x73, 0x6c, 0x61, 0x74, 0x65, 0x72, 0x63,
- 0x6f, 0x6c, 0x6f, 0x72, 0x67, 0x72, 0x65, 0x65, 0x6e, 0x66, 0x72, 0x6f, 0x6e,
- 0x74, 0x26, 0x61, 0x6d, 0x70, 0x3b, 0x77, 0x61, 0x74, 0x63, 0x68, 0x66, 0x6f,
- 0x72, 0x63, 0x65, 0x70, 0x72, 0x69, 0x63, 0x65, 0x72, 0x75, 0x6c, 0x65, 0x73,
- 0x62, 0x65, 0x67, 0x69, 0x6e, 0x61, 0x66, 0x74, 0x65, 0x72, 0x76, 0x69, 0x73,
- 0x69, 0x74, 0x69, 0x73, 0x73, 0x75, 0x65, 0x61, 0x72, 0x65, 0x61, 0x73, 0x62,
- 0x65, 0x6c, 0x6f, 0x77, 0x69, 0x6e, 0x64, 0x65, 0x78, 0x74, 0x6f, 0x74, 0x61,
- 0x6c, 0x68, 0x6f, 0x75, 0x72, 0x73, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x70, 0x72,
- 0x69, 0x6e, 0x74, 0x70, 0x72, 0x65, 0x73, 0x73, 0x62, 0x75, 0x69, 0x6c, 0x74,
- 0x6c, 0x69, 0x6e, 0x6b, 0x73, 0x73, 0x70, 0x65, 0x65, 0x64, 0x73, 0x74, 0x75,
- 0x64, 0x79, 0x74, 0x72, 0x61, 0x64, 0x65, 0x66, 0x6f, 0x75, 0x6e, 0x64, 0x73,
- 0x65, 0x6e, 0x73, 0x65, 0x75, 0x6e, 0x64, 0x65, 0x72, 0x73, 0x68, 0x6f, 0x77,
- 0x6e, 0x66, 0x6f, 0x72, 0x6d, 0x73, 0x72, 0x61, 0x6e, 0x67, 0x65, 0x61, 0x64,
- 0x64, 0x65, 0x64, 0x73, 0x74, 0x69, 0x6c, 0x6c, 0x6d, 0x6f, 0x76, 0x65, 0x64,
- 0x74, 0x61, 0x6b, 0x65, 0x6e, 0x61, 0x62, 0x6f, 0x76, 0x65, 0x66, 0x6c, 0x61,
- 0x73, 0x68, 0x66, 0x69, 0x78, 0x65, 0x64, 0x6f, 0x66, 0x74, 0x65, 0x6e, 0x6f,
- 0x74, 0x68, 0x65, 0x72, 0x76, 0x69, 0x65, 0x77, 0x73, 0x63, 0x68, 0x65, 0x63,
- 0x6b, 0x6c, 0x65, 0x67, 0x61, 0x6c, 0x72, 0x69, 0x76, 0x65, 0x72, 0x69, 0x74,
- 0x65, 0x6d, 0x73, 0x71, 0x75, 0x69, 0x63, 0x6b, 0x73, 0x68, 0x61, 0x70, 0x65,
- 0x68, 0x75, 0x6d, 0x61, 0x6e, 0x65, 0x78, 0x69, 0x73, 0x74, 0x67, 0x6f, 0x69,
- 0x6e, 0x67, 0x6d, 0x6f, 0x76, 0x69, 0x65, 0x74, 0x68, 0x69, 0x72, 0x64, 0x62,
- 0x61, 0x73, 0x69, 0x63, 0x70, 0x65, 0x61, 0x63, 0x65, 0x73, 0x74, 0x61, 0x67,
- 0x65, 0x77, 0x69, 0x64, 0x74, 0x68, 0x6c, 0x6f, 0x67, 0x69, 0x6e, 0x69, 0x64,
- 0x65, 0x61, 0x73, 0x77, 0x72, 0x6f, 0x74, 0x65, 0x70, 0x61, 0x67, 0x65, 0x73,
- 0x75, 0x73, 0x65, 0x72, 0x73, 0x64, 0x72, 0x69, 0x76, 0x65, 0x73, 0x74, 0x6f,
- 0x72, 0x65, 0x62, 0x72, 0x65, 0x61, 0x6b, 0x73, 0x6f, 0x75, 0x74, 0x68, 0x76,
- 0x6f, 0x69, 0x63, 0x65, 0x73, 0x69, 0x74, 0x65, 0x73, 0x6d, 0x6f, 0x6e, 0x74,
- 0x68, 0x77, 0x68, 0x65, 0x72, 0x65, 0x62, 0x75, 0x69, 0x6c, 0x64, 0x77, 0x68,
- 0x69, 0x63, 0x68, 0x65, 0x61, 0x72, 0x74, 0x68, 0x66, 0x6f, 0x72, 0x75, 0x6d,
- 0x74, 0x68, 0x72, 0x65, 0x65, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x70, 0x61, 0x72,
- 0x74, 0x79, 0x43, 0x6c, 0x69, 0x63, 0x6b, 0x6c, 0x6f, 0x77, 0x65, 0x72, 0x6c,
- 0x69, 0x76, 0x65, 0x73, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x6c, 0x61, 0x79, 0x65,
- 0x72, 0x65, 0x6e, 0x74, 0x72, 0x79, 0x73, 0x74, 0x6f, 0x72, 0x79, 0x75, 0x73,
- 0x61, 0x67, 0x65, 0x73, 0x6f, 0x75, 0x6e, 0x64, 0x63, 0x6f, 0x75, 0x72, 0x74,
- 0x79, 0x6f, 0x75, 0x72, 0x20, 0x62, 0x69, 0x72, 0x74, 0x68, 0x70, 0x6f, 0x70,
- 0x75, 0x70, 0x74, 0x79, 0x70, 0x65, 0x73, 0x61, 0x70, 0x70, 0x6c, 0x79, 0x49,
- 0x6d, 0x61, 0x67, 0x65, 0x62, 0x65, 0x69, 0x6e, 0x67, 0x75, 0x70, 0x70, 0x65,
- 0x72, 0x6e, 0x6f, 0x74, 0x65, 0x73, 0x65, 0x76, 0x65, 0x72, 0x79, 0x73, 0x68,
- 0x6f, 0x77, 0x73, 0x6d, 0x65, 0x61, 0x6e, 0x73, 0x65, 0x78, 0x74, 0x72, 0x61,
- 0x6d, 0x61, 0x74, 0x63, 0x68, 0x74, 0x72, 0x61, 0x63, 0x6b, 0x6b, 0x6e, 0x6f,
- 0x77, 0x6e, 0x65, 0x61, 0x72, 0x6c, 0x79, 0x62, 0x65, 0x67, 0x61, 0x6e, 0x73,
- 0x75, 0x70, 0x65, 0x72, 0x70, 0x61, 0x70, 0x65, 0x72, 0x6e, 0x6f, 0x72, 0x74,
- 0x68, 0x6c, 0x65, 0x61, 0x72, 0x6e, 0x67, 0x69, 0x76, 0x65, 0x6e, 0x6e, 0x61,
- 0x6d, 0x65, 0x64, 0x65, 0x6e, 0x64, 0x65, 0x64, 0x54, 0x65, 0x72, 0x6d, 0x73,
- 0x70, 0x61, 0x72, 0x74, 0x73, 0x47, 0x72, 0x6f, 0x75, 0x70, 0x62, 0x72, 0x61,
- 0x6e, 0x64, 0x75, 0x73, 0x69, 0x6e, 0x67, 0x77, 0x6f, 0x6d, 0x61, 0x6e, 0x66,
- 0x61, 0x6c, 0x73, 0x65, 0x72, 0x65, 0x61, 0x64, 0x79, 0x61, 0x75, 0x64, 0x69,
- 0x6f, 0x74, 0x61, 0x6b, 0x65, 0x73, 0x77, 0x68, 0x69, 0x6c, 0x65, 0x2e, 0x63,
- 0x6f, 0x6d, 0x2f, 0x6c, 0x69, 0x76, 0x65, 0x64, 0x63, 0x61, 0x73, 0x65, 0x73,
- 0x64, 0x61, 0x69, 0x6c, 0x79, 0x63, 0x68, 0x69, 0x6c, 0x64, 0x67, 0x72, 0x65,
- 0x61, 0x74, 0x6a, 0x75, 0x64, 0x67, 0x65, 0x74, 0x68, 0x6f, 0x73, 0x65, 0x75,
- 0x6e, 0x69, 0x74, 0x73, 0x6e, 0x65, 0x76, 0x65, 0x72, 0x62, 0x72, 0x6f, 0x61,
- 0x64, 0x63, 0x6f, 0x61, 0x73, 0x74, 0x63, 0x6f, 0x76, 0x65, 0x72, 0x61, 0x70,
- 0x70, 0x6c, 0x65, 0x66, 0x69, 0x6c, 0x65, 0x73, 0x63, 0x79, 0x63, 0x6c, 0x65,
- 0x73, 0x63, 0x65, 0x6e, 0x65, 0x70, 0x6c, 0x61, 0x6e, 0x73, 0x63, 0x6c, 0x69,
- 0x63, 0x6b, 0x77, 0x72, 0x69, 0x74, 0x65, 0x71, 0x75, 0x65, 0x65, 0x6e, 0x70,
- 0x69, 0x65, 0x63, 0x65, 0x65, 0x6d, 0x61, 0x69, 0x6c, 0x66, 0x72, 0x61, 0x6d,
- 0x65, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x70, 0x68, 0x6f, 0x74, 0x6f, 0x6c, 0x69,
- 0x6d, 0x69, 0x74, 0x63, 0x61, 0x63, 0x68, 0x65, 0x63, 0x69, 0x76, 0x69, 0x6c,
- 0x73, 0x63, 0x61, 0x6c, 0x65, 0x65, 0x6e, 0x74, 0x65, 0x72, 0x74, 0x68, 0x65,
- 0x6d, 0x65, 0x74, 0x68, 0x65, 0x72, 0x65, 0x74, 0x6f, 0x75, 0x63, 0x68, 0x62,
- 0x6f, 0x75, 0x6e, 0x64, 0x72, 0x6f, 0x79, 0x61, 0x6c, 0x61, 0x73, 0x6b, 0x65,
- 0x64, 0x77, 0x68, 0x6f, 0x6c, 0x65, 0x73, 0x69, 0x6e, 0x63, 0x65, 0x73, 0x74,
- 0x6f, 0x63, 0x6b, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x66, 0x61, 0x69, 0x74, 0x68,
- 0x68, 0x65, 0x61, 0x72, 0x74, 0x65, 0x6d, 0x70, 0x74, 0x79, 0x6f, 0x66, 0x66,
- 0x65, 0x72, 0x73, 0x63, 0x6f, 0x70, 0x65, 0x6f, 0x77, 0x6e, 0x65, 0x64, 0x6d,
- 0x69, 0x67, 0x68, 0x74, 0x61, 0x6c, 0x62, 0x75, 0x6d, 0x74, 0x68, 0x69, 0x6e,
- 0x6b, 0x62, 0x6c, 0x6f, 0x6f, 0x64, 0x61, 0x72, 0x72, 0x61, 0x79, 0x6d, 0x61,
- 0x6a, 0x6f, 0x72, 0x74, 0x72, 0x75, 0x73, 0x74, 0x63, 0x61, 0x6e, 0x6f, 0x6e,
- 0x75, 0x6e, 0x69, 0x6f, 0x6e, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x76, 0x61, 0x6c,
- 0x69, 0x64, 0x73, 0x74, 0x6f, 0x6e, 0x65, 0x53, 0x74, 0x79, 0x6c, 0x65, 0x4c,
- 0x6f, 0x67, 0x69, 0x6e, 0x68, 0x61, 0x70, 0x70, 0x79, 0x6f, 0x63, 0x63, 0x75,
- 0x72, 0x6c, 0x65, 0x66, 0x74, 0x3a, 0x66, 0x72, 0x65, 0x73, 0x68, 0x71, 0x75,
- 0x69, 0x74, 0x65, 0x66, 0x69, 0x6c, 0x6d, 0x73, 0x67, 0x72, 0x61, 0x64, 0x65,
- 0x6e, 0x65, 0x65, 0x64, 0x73, 0x75, 0x72, 0x62, 0x61, 0x6e, 0x66, 0x69, 0x67,
- 0x68, 0x74, 0x62, 0x61, 0x73, 0x69, 0x73, 0x68, 0x6f, 0x76, 0x65, 0x72, 0x61,
- 0x75, 0x74, 0x6f, 0x3b, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x68, 0x74, 0x6d,
- 0x6c, 0x6d, 0x69, 0x78, 0x65, 0x64, 0x66, 0x69, 0x6e, 0x61, 0x6c, 0x59, 0x6f,
- 0x75, 0x72, 0x20, 0x73, 0x6c, 0x69, 0x64, 0x65, 0x74, 0x6f, 0x70, 0x69, 0x63,
- 0x62, 0x72, 0x6f, 0x77, 0x6e, 0x61, 0x6c, 0x6f, 0x6e, 0x65, 0x64, 0x72, 0x61,
- 0x77, 0x6e, 0x73, 0x70, 0x6c, 0x69, 0x74, 0x72, 0x65, 0x61, 0x63, 0x68, 0x52,
- 0x69, 0x67, 0x68, 0x74, 0x64, 0x61, 0x74, 0x65, 0x73, 0x6d, 0x61, 0x72, 0x63,
- 0x68, 0x71, 0x75, 0x6f, 0x74, 0x65, 0x67, 0x6f, 0x6f, 0x64, 0x73, 0x4c, 0x69,
- 0x6e, 0x6b, 0x73, 0x64, 0x6f, 0x75, 0x62, 0x74, 0x61, 0x73, 0x79, 0x6e, 0x63,
- 0x74, 0x68, 0x75, 0x6d, 0x62, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x63, 0x68, 0x69,
- 0x65, 0x66, 0x79, 0x6f, 0x75, 0x74, 0x68, 0x6e, 0x6f, 0x76, 0x65, 0x6c, 0x31,
- 0x30, 0x70, 0x78, 0x3b, 0x73, 0x65, 0x72, 0x76, 0x65, 0x75, 0x6e, 0x74, 0x69,
- 0x6c, 0x68, 0x61, 0x6e, 0x64, 0x73, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x53, 0x70,
- 0x61, 0x63, 0x65, 0x71, 0x75, 0x65, 0x72, 0x79, 0x6a, 0x61, 0x6d, 0x65, 0x73,
- 0x65, 0x71, 0x75, 0x61, 0x6c, 0x74, 0x77, 0x69, 0x63, 0x65, 0x30, 0x2c, 0x30,
- 0x30, 0x30, 0x53, 0x74, 0x61, 0x72, 0x74, 0x70, 0x61, 0x6e, 0x65, 0x6c, 0x73,
- 0x6f, 0x6e, 0x67, 0x73, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x65, 0x69, 0x67, 0x68,
- 0x74, 0x73, 0x68, 0x69, 0x66, 0x74, 0x77, 0x6f, 0x72, 0x74, 0x68, 0x70, 0x6f,
- 0x73, 0x74, 0x73, 0x6c, 0x65, 0x61, 0x64, 0x73, 0x77, 0x65, 0x65, 0x6b, 0x73,
- 0x61, 0x76, 0x6f, 0x69, 0x64, 0x74, 0x68, 0x65, 0x73, 0x65, 0x6d, 0x69, 0x6c,
- 0x65, 0x73, 0x70, 0x6c, 0x61, 0x6e, 0x65, 0x73, 0x6d, 0x61, 0x72, 0x74, 0x61,
- 0x6c, 0x70, 0x68, 0x61, 0x70, 0x6c, 0x61, 0x6e, 0x74, 0x6d, 0x61, 0x72, 0x6b,
- 0x73, 0x72, 0x61, 0x74, 0x65, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x73, 0x63, 0x6c,
- 0x61, 0x69, 0x6d, 0x73, 0x61, 0x6c, 0x65, 0x73, 0x74, 0x65, 0x78, 0x74, 0x73,
- 0x73, 0x74, 0x61, 0x72, 0x73, 0x77, 0x72, 0x6f, 0x6e, 0x67, 0x3c, 0x2f, 0x68,
- 0x33, 0x3e, 0x74, 0x68, 0x69, 0x6e, 0x67, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x6d,
- 0x75, 0x6c, 0x74, 0x69, 0x68, 0x65, 0x61, 0x72, 0x64, 0x50, 0x6f, 0x77, 0x65,
- 0x72, 0x73, 0x74, 0x61, 0x6e, 0x64, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x73, 0x6f,
- 0x6c, 0x69, 0x64, 0x28, 0x74, 0x68, 0x69, 0x73, 0x62, 0x72, 0x69, 0x6e, 0x67,
- 0x73, 0x68, 0x69, 0x70, 0x73, 0x73, 0x74, 0x61, 0x66, 0x66, 0x74, 0x72, 0x69,
- 0x65, 0x64, 0x63, 0x61, 0x6c, 0x6c, 0x73, 0x66, 0x75, 0x6c, 0x6c, 0x79, 0x66,
- 0x61, 0x63, 0x74, 0x73, 0x61, 0x67, 0x65, 0x6e, 0x74, 0x54, 0x68, 0x69, 0x73,
- 0x20, 0x2f, 0x2f, 0x2d, 0x2d, 0x3e, 0x61, 0x64, 0x6d, 0x69, 0x6e, 0x65, 0x67,
- 0x79, 0x70, 0x74, 0x45, 0x76, 0x65, 0x6e, 0x74, 0x31, 0x35, 0x70, 0x78, 0x3b,
- 0x45, 0x6d, 0x61, 0x69, 0x6c, 0x74, 0x72, 0x75, 0x65, 0x22, 0x63, 0x72, 0x6f,
- 0x73, 0x73, 0x73, 0x70, 0x65, 0x6e, 0x74, 0x62, 0x6c, 0x6f, 0x67, 0x73, 0x62,
- 0x6f, 0x78, 0x22, 0x3e, 0x6e, 0x6f, 0x74, 0x65, 0x64, 0x6c, 0x65, 0x61, 0x76,
- 0x65, 0x63, 0x68, 0x69, 0x6e, 0x61, 0x73, 0x69, 0x7a, 0x65, 0x73, 0x67, 0x75,
- 0x65, 0x73, 0x74, 0x3c, 0x2f, 0x68, 0x34, 0x3e, 0x72, 0x6f, 0x62, 0x6f, 0x74,
- 0x68, 0x65, 0x61, 0x76, 0x79, 0x74, 0x72, 0x75, 0x65, 0x2c, 0x73, 0x65, 0x76,
- 0x65, 0x6e, 0x67, 0x72, 0x61, 0x6e, 0x64, 0x63, 0x72, 0x69, 0x6d, 0x65, 0x73,
- 0x69, 0x67, 0x6e, 0x73, 0x61, 0x77, 0x61, 0x72, 0x65, 0x64, 0x61, 0x6e, 0x63,
- 0x65, 0x70, 0x68, 0x61, 0x73, 0x65, 0x3e, 0x3c, 0x21, 0x2d, 0x2d, 0x65, 0x6e,
- 0x5f, 0x55, 0x53, 0x26, 0x23, 0x33, 0x39, 0x3b, 0x32, 0x30, 0x30, 0x70, 0x78,
- 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x6c, 0x61, 0x74, 0x69, 0x6e, 0x65, 0x6e, 0x6a,
- 0x6f, 0x79, 0x61, 0x6a, 0x61, 0x78, 0x2e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73,
- 0x6d, 0x69, 0x74, 0x68, 0x55, 0x2e, 0x53, 0x2e, 0x20, 0x68, 0x6f, 0x6c, 0x64,
- 0x73, 0x70, 0x65, 0x74, 0x65, 0x72, 0x69, 0x6e, 0x64, 0x69, 0x61, 0x6e, 0x61,
- 0x76, 0x22, 0x3e, 0x63, 0x68, 0x61, 0x69, 0x6e, 0x73, 0x63, 0x6f, 0x72, 0x65,
- 0x63, 0x6f, 0x6d, 0x65, 0x73, 0x64, 0x6f, 0x69, 0x6e, 0x67, 0x70, 0x72, 0x69,
- 0x6f, 0x72, 0x53, 0x68, 0x61, 0x72, 0x65, 0x31, 0x39, 0x39, 0x30, 0x73, 0x72,
- 0x6f, 0x6d, 0x61, 0x6e, 0x6c, 0x69, 0x73, 0x74, 0x73, 0x6a, 0x61, 0x70, 0x61,
- 0x6e, 0x66, 0x61, 0x6c, 0x6c, 0x73, 0x74, 0x72, 0x69, 0x61, 0x6c, 0x6f, 0x77,
- 0x6e, 0x65, 0x72, 0x61, 0x67, 0x72, 0x65, 0x65, 0x3c, 0x2f, 0x68, 0x32, 0x3e,
- 0x61, 0x62, 0x75, 0x73, 0x65, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x6f, 0x70, 0x65,
- 0x72, 0x61, 0x22, 0x2d, 0x2f, 0x2f, 0x57, 0x63, 0x61, 0x72, 0x64, 0x73, 0x68,
- 0x69, 0x6c, 0x6c, 0x73, 0x74, 0x65, 0x61, 0x6d, 0x73, 0x50, 0x68, 0x6f, 0x74,
- 0x6f, 0x74, 0x72, 0x75, 0x74, 0x68, 0x63, 0x6c, 0x65, 0x61, 0x6e, 0x2e, 0x70,
- 0x68, 0x70, 0x3f, 0x73, 0x61, 0x69, 0x6e, 0x74, 0x6d, 0x65, 0x74, 0x61, 0x6c,
- 0x6c, 0x6f, 0x75, 0x69, 0x73, 0x6d, 0x65, 0x61, 0x6e, 0x74, 0x70, 0x72, 0x6f,
- 0x6f, 0x66, 0x62, 0x72, 0x69, 0x65, 0x66, 0x72, 0x6f, 0x77, 0x22, 0x3e, 0x67,
- 0x65, 0x6e, 0x72, 0x65, 0x74, 0x72, 0x75, 0x63, 0x6b, 0x6c, 0x6f, 0x6f, 0x6b,
- 0x73, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x46, 0x72, 0x61, 0x6d, 0x65, 0x2e, 0x6e,
- 0x65, 0x74, 0x2f, 0x2d, 0x2d, 0x3e, 0x0a, 0x3c, 0x74, 0x72, 0x79, 0x20, 0x7b,
- 0x0a, 0x76, 0x61, 0x72, 0x20, 0x6d, 0x61, 0x6b, 0x65, 0x73, 0x63, 0x6f, 0x73,
- 0x74, 0x73, 0x70, 0x6c, 0x61, 0x69, 0x6e, 0x61, 0x64, 0x75, 0x6c, 0x74, 0x71,
- 0x75, 0x65, 0x73, 0x74, 0x74, 0x72, 0x61, 0x69, 0x6e, 0x6c, 0x61, 0x62, 0x6f,
- 0x72, 0x68, 0x65, 0x6c, 0x70, 0x73, 0x63, 0x61, 0x75, 0x73, 0x65, 0x6d, 0x61,
- 0x67, 0x69, 0x63, 0x6d, 0x6f, 0x74, 0x6f, 0x72, 0x74, 0x68, 0x65, 0x69, 0x72,
- 0x32, 0x35, 0x30, 0x70, 0x78, 0x6c, 0x65, 0x61, 0x73, 0x74, 0x73, 0x74, 0x65,
- 0x70, 0x73, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x63, 0x6f, 0x75, 0x6c, 0x64, 0x67,
- 0x6c, 0x61, 0x73, 0x73, 0x73, 0x69, 0x64, 0x65, 0x73, 0x66, 0x75, 0x6e, 0x64,
- 0x73, 0x68, 0x6f, 0x74, 0x65, 0x6c, 0x61, 0x77, 0x61, 0x72, 0x64, 0x6d, 0x6f,
- 0x75, 0x74, 0x68, 0x6d, 0x6f, 0x76, 0x65, 0x73, 0x70, 0x61, 0x72, 0x69, 0x73,
- 0x67, 0x69, 0x76, 0x65, 0x73, 0x64, 0x75, 0x74, 0x63, 0x68, 0x74, 0x65, 0x78,
- 0x61, 0x73, 0x66, 0x72, 0x75, 0x69, 0x74, 0x6e, 0x75, 0x6c, 0x6c, 0x2c, 0x7c,
- 0x7c, 0x5b, 0x5d, 0x3b, 0x74, 0x6f, 0x70, 0x22, 0x3e, 0x0a, 0x3c, 0x21, 0x2d,
- 0x2d, 0x50, 0x4f, 0x53, 0x54, 0x22, 0x6f, 0x63, 0x65, 0x61, 0x6e, 0x3c, 0x62,
- 0x72, 0x2f, 0x3e, 0x66, 0x6c, 0x6f, 0x6f, 0x72, 0x73, 0x70, 0x65, 0x61, 0x6b,
- 0x64, 0x65, 0x70, 0x74, 0x68, 0x20, 0x73, 0x69, 0x7a, 0x65, 0x62, 0x61, 0x6e,
- 0x6b, 0x73, 0x63, 0x61, 0x74, 0x63, 0x68, 0x63, 0x68, 0x61, 0x72, 0x74, 0x32,
- 0x30, 0x70, 0x78, 0x3b, 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x64, 0x65, 0x61, 0x6c,
- 0x73, 0x77, 0x6f, 0x75, 0x6c, 0x64, 0x35, 0x30, 0x70, 0x78, 0x3b, 0x75, 0x72,
- 0x6c, 0x3d, 0x22, 0x70, 0x61, 0x72, 0x6b, 0x73, 0x6d, 0x6f, 0x75, 0x73, 0x65,
- 0x4d, 0x6f, 0x73, 0x74, 0x20, 0x2e, 0x2e, 0x2e, 0x3c, 0x2f, 0x61, 0x6d, 0x6f,
- 0x6e, 0x67, 0x62, 0x72, 0x61, 0x69, 0x6e, 0x62, 0x6f, 0x64, 0x79, 0x20, 0x6e,
- 0x6f, 0x6e, 0x65, 0x3b, 0x62, 0x61, 0x73, 0x65, 0x64, 0x63, 0x61, 0x72, 0x72,
- 0x79, 0x64, 0x72, 0x61, 0x66, 0x74, 0x72, 0x65, 0x66, 0x65, 0x72, 0x70, 0x61,
- 0x67, 0x65, 0x5f, 0x68, 0x6f, 0x6d, 0x65, 0x2e, 0x6d, 0x65, 0x74, 0x65, 0x72,
- 0x64, 0x65, 0x6c, 0x61, 0x79, 0x64, 0x72, 0x65, 0x61, 0x6d, 0x70, 0x72, 0x6f,
- 0x76, 0x65, 0x6a, 0x6f, 0x69, 0x6e, 0x74, 0x3c, 0x2f, 0x74, 0x72, 0x3e, 0x64,
- 0x72, 0x75, 0x67, 0x73, 0x3c, 0x21, 0x2d, 0x2d, 0x20, 0x61, 0x70, 0x72, 0x69,
- 0x6c, 0x69, 0x64, 0x65, 0x61, 0x6c, 0x61, 0x6c, 0x6c, 0x65, 0x6e, 0x65, 0x78,
- 0x61, 0x63, 0x74, 0x66, 0x6f, 0x72, 0x74, 0x68, 0x63, 0x6f, 0x64, 0x65, 0x73,
- 0x6c, 0x6f, 0x67, 0x69, 0x63, 0x56, 0x69, 0x65, 0x77, 0x20, 0x73, 0x65, 0x65,
- 0x6d, 0x73, 0x62, 0x6c, 0x61, 0x6e, 0x6b, 0x70, 0x6f, 0x72, 0x74, 0x73, 0x20,
- 0x28, 0x32, 0x30, 0x30, 0x73, 0x61, 0x76, 0x65, 0x64, 0x5f, 0x6c, 0x69, 0x6e,
- 0x6b, 0x67, 0x6f, 0x61, 0x6c, 0x73, 0x67, 0x72, 0x61, 0x6e, 0x74, 0x67, 0x72,
- 0x65, 0x65, 0x6b, 0x68, 0x6f, 0x6d, 0x65, 0x73, 0x72, 0x69, 0x6e, 0x67, 0x73,
- 0x72, 0x61, 0x74, 0x65, 0x64, 0x33, 0x30, 0x70, 0x78, 0x3b, 0x77, 0x68, 0x6f,
- 0x73, 0x65, 0x70, 0x61, 0x72, 0x73, 0x65, 0x28, 0x29, 0x3b, 0x22, 0x20, 0x42,
- 0x6c, 0x6f, 0x63, 0x6b, 0x6c, 0x69, 0x6e, 0x75, 0x78, 0x6a, 0x6f, 0x6e, 0x65,
- 0x73, 0x70, 0x69, 0x78, 0x65, 0x6c, 0x27, 0x29, 0x3b, 0x22, 0x3e, 0x29, 0x3b,
- 0x69, 0x66, 0x28, 0x2d, 0x6c, 0x65, 0x66, 0x74, 0x64, 0x61, 0x76, 0x69, 0x64,
- 0x68, 0x6f, 0x72, 0x73, 0x65, 0x46, 0x6f, 0x63, 0x75, 0x73, 0x72, 0x61, 0x69,
- 0x73, 0x65, 0x62, 0x6f, 0x78, 0x65, 0x73, 0x54, 0x72, 0x61, 0x63, 0x6b, 0x65,
- 0x6d, 0x65, 0x6e, 0x74, 0x3c, 0x2f, 0x65, 0x6d, 0x3e, 0x62, 0x61, 0x72, 0x22,
- 0x3e, 0x2e, 0x73, 0x72, 0x63, 0x3d, 0x74, 0x6f, 0x77, 0x65, 0x72, 0x61, 0x6c,
- 0x74, 0x3d, 0x22, 0x63, 0x61, 0x62, 0x6c, 0x65, 0x68, 0x65, 0x6e, 0x72, 0x79,
- 0x32, 0x34, 0x70, 0x78, 0x3b, 0x73, 0x65, 0x74, 0x75, 0x70, 0x69, 0x74, 0x61,
- 0x6c, 0x79, 0x73, 0x68, 0x61, 0x72, 0x70, 0x6d, 0x69, 0x6e, 0x6f, 0x72, 0x74,
- 0x61, 0x73, 0x74, 0x65, 0x77, 0x61, 0x6e, 0x74, 0x73, 0x74, 0x68, 0x69, 0x73,
- 0x2e, 0x72, 0x65, 0x73, 0x65, 0x74, 0x77, 0x68, 0x65, 0x65, 0x6c, 0x67, 0x69,
- 0x72, 0x6c, 0x73, 0x2f, 0x63, 0x73, 0x73, 0x2f, 0x31, 0x30, 0x30, 0x25, 0x3b,
- 0x63, 0x6c, 0x75, 0x62, 0x73, 0x73, 0x74, 0x75, 0x66, 0x66, 0x62, 0x69, 0x62,
- 0x6c, 0x65, 0x76, 0x6f, 0x74, 0x65, 0x73, 0x20, 0x31, 0x30, 0x30, 0x30, 0x6b,
- 0x6f, 0x72, 0x65, 0x61, 0x7d, 0x29, 0x3b, 0x0d, 0x0a, 0x62, 0x61, 0x6e, 0x64,
- 0x73, 0x71, 0x75, 0x65, 0x75, 0x65, 0x3d, 0x20, 0x7b, 0x7d, 0x3b, 0x38, 0x30,
- 0x70, 0x78, 0x3b, 0x63, 0x6b, 0x69, 0x6e, 0x67, 0x7b, 0x0d, 0x0a, 0x09, 0x09,
- 0x61, 0x68, 0x65, 0x61, 0x64, 0x63, 0x6c, 0x6f, 0x63, 0x6b, 0x69, 0x72, 0x69,
- 0x73, 0x68, 0x6c, 0x69, 0x6b, 0x65, 0x20, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x73,
- 0x74, 0x61, 0x74, 0x73, 0x46, 0x6f, 0x72, 0x6d, 0x22, 0x79, 0x61, 0x68, 0x6f,
- 0x6f, 0x29, 0x5b, 0x30, 0x5d, 0x3b, 0x41, 0x62, 0x6f, 0x75, 0x74, 0x66, 0x69,
- 0x6e, 0x64, 0x73, 0x3c, 0x2f, 0x68, 0x31, 0x3e, 0x64, 0x65, 0x62, 0x75, 0x67,
- 0x74, 0x61, 0x73, 0x6b, 0x73, 0x55, 0x52, 0x4c, 0x20, 0x3d, 0x63, 0x65, 0x6c,
- 0x6c, 0x73, 0x7d, 0x29, 0x28, 0x29, 0x3b, 0x31, 0x32, 0x70, 0x78, 0x3b, 0x70,
- 0x72, 0x69, 0x6d, 0x65, 0x74, 0x65, 0x6c, 0x6c, 0x73, 0x74, 0x75, 0x72, 0x6e,
- 0x73, 0x30, 0x78, 0x36, 0x30, 0x30, 0x2e, 0x6a, 0x70, 0x67, 0x22, 0x73, 0x70,
- 0x61, 0x69, 0x6e, 0x62, 0x65, 0x61, 0x63, 0x68, 0x74, 0x61, 0x78, 0x65, 0x73,
- 0x6d, 0x69, 0x63, 0x72, 0x6f, 0x61, 0x6e, 0x67, 0x65, 0x6c, 0x2d, 0x2d, 0x3e,
- 0x3c, 0x2f, 0x67, 0x69, 0x66, 0x74, 0x73, 0x73, 0x74, 0x65, 0x76, 0x65, 0x2d,
- 0x6c, 0x69, 0x6e, 0x6b, 0x62, 0x6f, 0x64, 0x79, 0x2e, 0x7d, 0x29, 0x3b, 0x0a,
- 0x09, 0x6d, 0x6f, 0x75, 0x6e, 0x74, 0x20, 0x28, 0x31, 0x39, 0x39, 0x46, 0x41,
- 0x51, 0x3c, 0x2f, 0x72, 0x6f, 0x67, 0x65, 0x72, 0x66, 0x72, 0x61, 0x6e, 0x6b,
- 0x43, 0x6c, 0x61, 0x73, 0x73, 0x32, 0x38, 0x70, 0x78, 0x3b, 0x66, 0x65, 0x65,
- 0x64, 0x73, 0x3c, 0x68, 0x31, 0x3e, 0x3c, 0x73, 0x63, 0x6f, 0x74, 0x74, 0x74,
- 0x65, 0x73, 0x74, 0x73, 0x32, 0x32, 0x70, 0x78, 0x3b, 0x64, 0x72, 0x69, 0x6e,
- 0x6b, 0x29, 0x20, 0x7c, 0x7c, 0x20, 0x6c, 0x65, 0x77, 0x69, 0x73, 0x73, 0x68,
- 0x61, 0x6c, 0x6c, 0x23, 0x30, 0x33, 0x39, 0x3b, 0x20, 0x66, 0x6f, 0x72, 0x20,
- 0x6c, 0x6f, 0x76, 0x65, 0x64, 0x77, 0x61, 0x73, 0x74, 0x65, 0x30, 0x30, 0x70,
- 0x78, 0x3b, 0x6a, 0x61, 0x3a, 0xe3, 0x82, 0x73, 0x69, 0x6d, 0x6f, 0x6e, 0x3c,
- 0x66, 0x6f, 0x6e, 0x74, 0x72, 0x65, 0x70, 0x6c, 0x79, 0x6d, 0x65, 0x65, 0x74,
- 0x73, 0x75, 0x6e, 0x74, 0x65, 0x72, 0x63, 0x68, 0x65, 0x61, 0x70, 0x74, 0x69,
- 0x67, 0x68, 0x74, 0x42, 0x72, 0x61, 0x6e, 0x64, 0x29, 0x20, 0x21, 0x3d, 0x20,
- 0x64, 0x72, 0x65, 0x73, 0x73, 0x63, 0x6c, 0x69, 0x70, 0x73, 0x72, 0x6f, 0x6f,
- 0x6d, 0x73, 0x6f, 0x6e, 0x6b, 0x65, 0x79, 0x6d, 0x6f, 0x62, 0x69, 0x6c, 0x6d,
- 0x61, 0x69, 0x6e, 0x2e, 0x4e, 0x61, 0x6d, 0x65, 0x20, 0x70, 0x6c, 0x61, 0x74,
- 0x65, 0x66, 0x75, 0x6e, 0x6e, 0x79, 0x74, 0x72, 0x65, 0x65, 0x73, 0x63, 0x6f,
- 0x6d, 0x2f, 0x22, 0x31, 0x2e, 0x6a, 0x70, 0x67, 0x77, 0x6d, 0x6f, 0x64, 0x65,
- 0x70, 0x61, 0x72, 0x61, 0x6d, 0x53, 0x54, 0x41, 0x52, 0x54, 0x6c, 0x65, 0x66,
- 0x74, 0x20, 0x69, 0x64, 0x64, 0x65, 0x6e, 0x2c, 0x20, 0x32, 0x30, 0x31, 0x29,
- 0x3b, 0x0a, 0x7d, 0x0a, 0x66, 0x6f, 0x72, 0x6d, 0x2e, 0x76, 0x69, 0x72, 0x75,
- 0x73, 0x63, 0x68, 0x61, 0x69, 0x72, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x77, 0x6f,
- 0x72, 0x73, 0x74, 0x50, 0x61, 0x67, 0x65, 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e,
- 0x70, 0x61, 0x74, 0x63, 0x68, 0x3c, 0x21, 0x2d, 0x2d, 0x0a, 0x6f, 0x2d, 0x63,
- 0x61, 0x63, 0x66, 0x69, 0x72, 0x6d, 0x73, 0x74, 0x6f, 0x75, 0x72, 0x73, 0x2c,
- 0x30, 0x30, 0x30, 0x20, 0x61, 0x73, 0x69, 0x61, 0x6e, 0x69, 0x2b, 0x2b, 0x29,
- 0x7b, 0x61, 0x64, 0x6f, 0x62, 0x65, 0x27, 0x29, 0x5b, 0x30, 0x5d, 0x69, 0x64,
- 0x3d, 0x31, 0x30, 0x62, 0x6f, 0x74, 0x68, 0x3b, 0x6d, 0x65, 0x6e, 0x75, 0x20,
- 0x2e, 0x32, 0x2e, 0x6d, 0x69, 0x2e, 0x70, 0x6e, 0x67, 0x22, 0x6b, 0x65, 0x76,
- 0x69, 0x6e, 0x63, 0x6f, 0x61, 0x63, 0x68, 0x43, 0x68, 0x69, 0x6c, 0x64, 0x62,
- 0x72, 0x75, 0x63, 0x65, 0x32, 0x2e, 0x6a, 0x70, 0x67, 0x55, 0x52, 0x4c, 0x29,
- 0x2b, 0x2e, 0x6a, 0x70, 0x67, 0x7c, 0x73, 0x75, 0x69, 0x74, 0x65, 0x73, 0x6c,
- 0x69, 0x63, 0x65, 0x68, 0x61, 0x72, 0x72, 0x79, 0x31, 0x32, 0x30, 0x22, 0x20,
- 0x73, 0x77, 0x65, 0x65, 0x74, 0x74, 0x72, 0x3e, 0x0d, 0x0a, 0x6e, 0x61, 0x6d,
- 0x65, 0x3d, 0x64, 0x69, 0x65, 0x67, 0x6f, 0x70, 0x61, 0x67, 0x65, 0x20, 0x73,
- 0x77, 0x69, 0x73, 0x73, 0x2d, 0x2d, 0x3e, 0x0a, 0x0a, 0x23, 0x66, 0x66, 0x66,
- 0x3b, 0x22, 0x3e, 0x4c, 0x6f, 0x67, 0x2e, 0x63, 0x6f, 0x6d, 0x22, 0x74, 0x72,
- 0x65, 0x61, 0x74, 0x73, 0x68, 0x65, 0x65, 0x74, 0x29, 0x20, 0x26, 0x26, 0x20,
- 0x31, 0x34, 0x70, 0x78, 0x3b, 0x73, 0x6c, 0x65, 0x65, 0x70, 0x6e, 0x74, 0x65,
- 0x6e, 0x74, 0x66, 0x69, 0x6c, 0x65, 0x64, 0x6a, 0x61, 0x3a, 0xe3, 0x83, 0x69,
- 0x64, 0x3d, 0x22, 0x63, 0x4e, 0x61, 0x6d, 0x65, 0x22, 0x77, 0x6f, 0x72, 0x73,
- 0x65, 0x73, 0x68, 0x6f, 0x74, 0x73, 0x2d, 0x62, 0x6f, 0x78, 0x2d, 0x64, 0x65,
- 0x6c, 0x74, 0x61, 0x0a, 0x26, 0x6c, 0x74, 0x3b, 0x62, 0x65, 0x61, 0x72, 0x73,
- 0x3a, 0x34, 0x38, 0x5a, 0x3c, 0x64, 0x61, 0x74, 0x61, 0x2d, 0x72, 0x75, 0x72,
- 0x61, 0x6c, 0x3c, 0x2f, 0x61, 0x3e, 0x20, 0x73, 0x70, 0x65, 0x6e, 0x64, 0x62,
- 0x61, 0x6b, 0x65, 0x72, 0x73, 0x68, 0x6f, 0x70, 0x73, 0x3d, 0x20, 0x22, 0x22,
- 0x3b, 0x70, 0x68, 0x70, 0x22, 0x3e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x31, 0x33,
- 0x70, 0x78, 0x3b, 0x62, 0x72, 0x69, 0x61, 0x6e, 0x68, 0x65, 0x6c, 0x6c, 0x6f,
- 0x73, 0x69, 0x7a, 0x65, 0x3d, 0x6f, 0x3d, 0x25, 0x32, 0x46, 0x20, 0x6a, 0x6f,
- 0x69, 0x6e, 0x6d, 0x61, 0x79, 0x62, 0x65, 0x3c, 0x69, 0x6d, 0x67, 0x20, 0x69,
- 0x6d, 0x67, 0x22, 0x3e, 0x2c, 0x20, 0x66, 0x6a, 0x73, 0x69, 0x6d, 0x67, 0x22,
- 0x20, 0x22, 0x29, 0x5b, 0x30, 0x5d, 0x4d, 0x54, 0x6f, 0x70, 0x42, 0x54, 0x79,
- 0x70, 0x65, 0x22, 0x6e, 0x65, 0x77, 0x6c, 0x79, 0x44, 0x61, 0x6e, 0x73, 0x6b,
- 0x63, 0x7a, 0x65, 0x63, 0x68, 0x74, 0x72, 0x61, 0x69, 0x6c, 0x6b, 0x6e, 0x6f,
- 0x77, 0x73, 0x3c, 0x2f, 0x68, 0x35, 0x3e, 0x66, 0x61, 0x71, 0x22, 0x3e, 0x7a,
- 0x68, 0x2d, 0x63, 0x6e, 0x31, 0x30, 0x29, 0x3b, 0x0a, 0x2d, 0x31, 0x22, 0x29,
- 0x3b, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x62, 0x6c, 0x75, 0x65, 0x73, 0x74, 0x72,
- 0x75, 0x6c, 0x79, 0x64, 0x61, 0x76, 0x69, 0x73, 0x2e, 0x6a, 0x73, 0x27, 0x3b,
- 0x3e, 0x0d, 0x0a, 0x3c, 0x21, 0x73, 0x74, 0x65, 0x65, 0x6c, 0x20, 0x79, 0x6f,
- 0x75, 0x20, 0x68, 0x32, 0x3e, 0x0d, 0x0a, 0x66, 0x6f, 0x72, 0x6d, 0x20, 0x6a,
- 0x65, 0x73, 0x75, 0x73, 0x31, 0x30, 0x30, 0x25, 0x20, 0x6d, 0x65, 0x6e, 0x75,
- 0x2e, 0x0d, 0x0a, 0x09, 0x0d, 0x0a, 0x77, 0x61, 0x6c, 0x65, 0x73, 0x72, 0x69,
- 0x73, 0x6b, 0x73, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x64, 0x64, 0x69, 0x6e, 0x67,
- 0x62, 0x2d, 0x6c, 0x69, 0x6b, 0x74, 0x65, 0x61, 0x63, 0x68, 0x67, 0x69, 0x66,
- 0x22, 0x20, 0x76, 0x65, 0x67, 0x61, 0x73, 0x64, 0x61, 0x6e, 0x73, 0x6b, 0x65,
- 0x65, 0x73, 0x74, 0x69, 0x73, 0x68, 0x71, 0x69, 0x70, 0x73, 0x75, 0x6f, 0x6d,
- 0x69, 0x73, 0x6f, 0x62, 0x72, 0x65, 0x64, 0x65, 0x73, 0x64, 0x65, 0x65, 0x6e,
- 0x74, 0x72, 0x65, 0x74, 0x6f, 0x64, 0x6f, 0x73, 0x70, 0x75, 0x65, 0x64, 0x65,
- 0x61, 0xc3, 0xb1, 0x6f, 0x73, 0x65, 0x73, 0x74, 0xc3, 0xa1, 0x74, 0x69, 0x65,
- 0x6e, 0x65, 0x68, 0x61, 0x73, 0x74, 0x61, 0x6f, 0x74, 0x72, 0x6f, 0x73, 0x70,
- 0x61, 0x72, 0x74, 0x65, 0x64, 0x6f, 0x6e, 0x64, 0x65, 0x6e, 0x75, 0x65, 0x76,
- 0x6f, 0x68, 0x61, 0x63, 0x65, 0x72, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x6d, 0x69,
- 0x73, 0x6d, 0x6f, 0x6d, 0x65, 0x6a, 0x6f, 0x72, 0x6d, 0x75, 0x6e, 0x64, 0x6f,
- 0x61, 0x71, 0x75, 0xc3, 0xad, 0x64, 0xc3, 0xad, 0x61, 0x73, 0x73, 0xc3, 0xb3,
- 0x6c, 0x6f, 0x61, 0x79, 0x75, 0x64, 0x61, 0x66, 0x65, 0x63, 0x68, 0x61, 0x74,
- 0x6f, 0x64, 0x61, 0x73, 0x74, 0x61, 0x6e, 0x74, 0x6f, 0x6d, 0x65, 0x6e, 0x6f,
- 0x73, 0x64, 0x61, 0x74, 0x6f, 0x73, 0x6f, 0x74, 0x72, 0x61, 0x73, 0x73, 0x69,
- 0x74, 0x69, 0x6f, 0x6d, 0x75, 0x63, 0x68, 0x6f, 0x61, 0x68, 0x6f, 0x72, 0x61,
- 0x6c, 0x75, 0x67, 0x61, 0x72, 0x6d, 0x61, 0x79, 0x6f, 0x72, 0x65, 0x73, 0x74,
- 0x6f, 0x73, 0x68, 0x6f, 0x72, 0x61, 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x61,
- 0x6e, 0x74, 0x65, 0x73, 0x66, 0x6f, 0x74, 0x6f, 0x73, 0x65, 0x73, 0x74, 0x61,
- 0x73, 0x70, 0x61, 0xc3, 0xad, 0x73, 0x6e, 0x75, 0x65, 0x76, 0x61, 0x73, 0x61,
- 0x6c, 0x75, 0x64, 0x66, 0x6f, 0x72, 0x6f, 0x73, 0x6d, 0x65, 0x64, 0x69, 0x6f,
- 0x71, 0x75, 0x69, 0x65, 0x6e, 0x6d, 0x65, 0x73, 0x65, 0x73, 0x70, 0x6f, 0x64,
- 0x65, 0x72, 0x63, 0x68, 0x69, 0x6c, 0x65, 0x73, 0x65, 0x72, 0xc3, 0xa1, 0x76,
- 0x65, 0x63, 0x65, 0x73, 0x64, 0x65, 0x63, 0x69, 0x72, 0x6a, 0x6f, 0x73, 0xc3,
- 0xa9, 0x65, 0x73, 0x74, 0x61, 0x72, 0x76, 0x65, 0x6e, 0x74, 0x61, 0x67, 0x72,
- 0x75, 0x70, 0x6f, 0x68, 0x65, 0x63, 0x68, 0x6f, 0x65, 0x6c, 0x6c, 0x6f, 0x73,
- 0x74, 0x65, 0x6e, 0x67, 0x6f, 0x61, 0x6d, 0x69, 0x67, 0x6f, 0x63, 0x6f, 0x73,
- 0x61, 0x73, 0x6e, 0x69, 0x76, 0x65, 0x6c, 0x67, 0x65, 0x6e, 0x74, 0x65, 0x6d,
- 0x69, 0x73, 0x6d, 0x61, 0x61, 0x69, 0x72, 0x65, 0x73, 0x6a, 0x75, 0x6c, 0x69,
- 0x6f, 0x74, 0x65, 0x6d, 0x61, 0x73, 0x68, 0x61, 0x63, 0x69, 0x61, 0x66, 0x61,
- 0x76, 0x6f, 0x72, 0x6a, 0x75, 0x6e, 0x69, 0x6f, 0x6c, 0x69, 0x62, 0x72, 0x65,
- 0x70, 0x75, 0x6e, 0x74, 0x6f, 0x62, 0x75, 0x65, 0x6e, 0x6f, 0x61, 0x75, 0x74,
- 0x6f, 0x72, 0x61, 0x62, 0x72, 0x69, 0x6c, 0x62, 0x75, 0x65, 0x6e, 0x61, 0x74,
- 0x65, 0x78, 0x74, 0x6f, 0x6d, 0x61, 0x72, 0x7a, 0x6f, 0x73, 0x61, 0x62, 0x65,
- 0x72, 0x6c, 0x69, 0x73, 0x74, 0x61, 0x6c, 0x75, 0x65, 0x67, 0x6f, 0x63, 0xc3,
- 0xb3, 0x6d, 0x6f, 0x65, 0x6e, 0x65, 0x72, 0x6f, 0x6a, 0x75, 0x65, 0x67, 0x6f,
- 0x70, 0x65, 0x72, 0xc3, 0xba, 0x68, 0x61, 0x62, 0x65, 0x72, 0x65, 0x73, 0x74,
- 0x6f, 0x79, 0x6e, 0x75, 0x6e, 0x63, 0x61, 0x6d, 0x75, 0x6a, 0x65, 0x72, 0x76,
- 0x61, 0x6c, 0x6f, 0x72, 0x66, 0x75, 0x65, 0x72, 0x61, 0x6c, 0x69, 0x62, 0x72,
- 0x6f, 0x67, 0x75, 0x73, 0x74, 0x61, 0x69, 0x67, 0x75, 0x61, 0x6c, 0x76, 0x6f,
- 0x74, 0x6f, 0x73, 0x63, 0x61, 0x73, 0x6f, 0x73, 0x67, 0x75, 0xc3, 0xad, 0x61,
- 0x70, 0x75, 0x65, 0x64, 0x6f, 0x73, 0x6f, 0x6d, 0x6f, 0x73, 0x61, 0x76, 0x69,
- 0x73, 0x6f, 0x75, 0x73, 0x74, 0x65, 0x64, 0x64, 0x65, 0x62, 0x65, 0x6e, 0x6e,
- 0x6f, 0x63, 0x68, 0x65, 0x62, 0x75, 0x73, 0x63, 0x61, 0x66, 0x61, 0x6c, 0x74,
- 0x61, 0x65, 0x75, 0x72, 0x6f, 0x73, 0x73, 0x65, 0x72, 0x69, 0x65, 0x64, 0x69,
- 0x63, 0x68, 0x6f, 0x63, 0x75, 0x72, 0x73, 0x6f, 0x63, 0x6c, 0x61, 0x76, 0x65,
- 0x63, 0x61, 0x73, 0x61, 0x73, 0x6c, 0x65, 0xc3, 0xb3, 0x6e, 0x70, 0x6c, 0x61,
- 0x7a, 0x6f, 0x6c, 0x61, 0x72, 0x67, 0x6f, 0x6f, 0x62, 0x72, 0x61, 0x73, 0x76,
- 0x69, 0x73, 0x74, 0x61, 0x61, 0x70, 0x6f, 0x79, 0x6f, 0x6a, 0x75, 0x6e, 0x74,
- 0x6f, 0x74, 0x72, 0x61, 0x74, 0x61, 0x76, 0x69, 0x73, 0x74, 0x6f, 0x63, 0x72,
- 0x65, 0x61, 0x72, 0x63, 0x61, 0x6d, 0x70, 0x6f, 0x68, 0x65, 0x6d, 0x6f, 0x73,
- 0x63, 0x69, 0x6e, 0x63, 0x6f, 0x63, 0x61, 0x72, 0x67, 0x6f, 0x70, 0x69, 0x73,
- 0x6f, 0x73, 0x6f, 0x72, 0x64, 0x65, 0x6e, 0x68, 0x61, 0x63, 0x65, 0x6e, 0xc3,
- 0xa1, 0x72, 0x65, 0x61, 0x64, 0x69, 0x73, 0x63, 0x6f, 0x70, 0x65, 0x64, 0x72,
- 0x6f, 0x63, 0x65, 0x72, 0x63, 0x61, 0x70, 0x75, 0x65, 0x64, 0x61, 0x70, 0x61,
- 0x70, 0x65, 0x6c, 0x6d, 0x65, 0x6e, 0x6f, 0x72, 0xc3, 0xba, 0x74, 0x69, 0x6c,
- 0x63, 0x6c, 0x61, 0x72, 0x6f, 0x6a, 0x6f, 0x72, 0x67, 0x65, 0x63, 0x61, 0x6c,
- 0x6c, 0x65, 0x70, 0x6f, 0x6e, 0x65, 0x72, 0x74, 0x61, 0x72, 0x64, 0x65, 0x6e,
- 0x61, 0x64, 0x69, 0x65, 0x6d, 0x61, 0x72, 0x63, 0x61, 0x73, 0x69, 0x67, 0x75,
- 0x65, 0x65, 0x6c, 0x6c, 0x61, 0x73, 0x73, 0x69, 0x67, 0x6c, 0x6f, 0x63, 0x6f,
- 0x63, 0x68, 0x65, 0x6d, 0x6f, 0x74, 0x6f, 0x73, 0x6d, 0x61, 0x64, 0x72, 0x65,
- 0x63, 0x6c, 0x61, 0x73, 0x65, 0x72, 0x65, 0x73, 0x74, 0x6f, 0x6e, 0x69, 0xc3,
- 0xb1, 0x6f, 0x71, 0x75, 0x65, 0x64, 0x61, 0x70, 0x61, 0x73, 0x61, 0x72, 0x62,
- 0x61, 0x6e, 0x63, 0x6f, 0x68, 0x69, 0x6a, 0x6f, 0x73, 0x76, 0x69, 0x61, 0x6a,
- 0x65, 0x70, 0x61, 0x62, 0x6c, 0x6f, 0xc3, 0xa9, 0x73, 0x74, 0x65, 0x76, 0x69,
- 0x65, 0x6e, 0x65, 0x72, 0x65, 0x69, 0x6e, 0x6f, 0x64, 0x65, 0x6a, 0x61, 0x72,
- 0x66, 0x6f, 0x6e, 0x64, 0x6f, 0x63, 0x61, 0x6e, 0x61, 0x6c, 0x6e, 0x6f, 0x72,
- 0x74, 0x65, 0x6c, 0x65, 0x74, 0x72, 0x61, 0x63, 0x61, 0x75, 0x73, 0x61, 0x74,
- 0x6f, 0x6d, 0x61, 0x72, 0x6d, 0x61, 0x6e, 0x6f, 0x73, 0x6c, 0x75, 0x6e, 0x65,
- 0x73, 0x61, 0x75, 0x74, 0x6f, 0x73, 0x76, 0x69, 0x6c, 0x6c, 0x61, 0x76, 0x65,
- 0x6e, 0x64, 0x6f, 0x70, 0x65, 0x73, 0x61, 0x72, 0x74, 0x69, 0x70, 0x6f, 0x73,
- 0x74, 0x65, 0x6e, 0x67, 0x61, 0x6d, 0x61, 0x72, 0x63, 0x6f, 0x6c, 0x6c, 0x65,
- 0x76, 0x61, 0x70, 0x61, 0x64, 0x72, 0x65, 0x75, 0x6e, 0x69, 0x64, 0x6f, 0x76,
- 0x61, 0x6d, 0x6f, 0x73, 0x7a, 0x6f, 0x6e, 0x61, 0x73, 0x61, 0x6d, 0x62, 0x6f,
- 0x73, 0x62, 0x61, 0x6e, 0x64, 0x61, 0x6d, 0x61, 0x72, 0x69, 0x61, 0x61, 0x62,
- 0x75, 0x73, 0x6f, 0x6d, 0x75, 0x63, 0x68, 0x61, 0x73, 0x75, 0x62, 0x69, 0x72,
- 0x72, 0x69, 0x6f, 0x6a, 0x61, 0x76, 0x69, 0x76, 0x69, 0x72, 0x67, 0x72, 0x61,
- 0x64, 0x6f, 0x63, 0x68, 0x69, 0x63, 0x61, 0x61, 0x6c, 0x6c, 0xc3, 0xad, 0x6a,
- 0x6f, 0x76, 0x65, 0x6e, 0x64, 0x69, 0x63, 0x68, 0x61, 0x65, 0x73, 0x74, 0x61,
- 0x6e, 0x74, 0x61, 0x6c, 0x65, 0x73, 0x73, 0x61, 0x6c, 0x69, 0x72, 0x73, 0x75,
- 0x65, 0x6c, 0x6f, 0x70, 0x65, 0x73, 0x6f, 0x73, 0x66, 0x69, 0x6e, 0x65, 0x73,
- 0x6c, 0x6c, 0x61, 0x6d, 0x61, 0x62, 0x75, 0x73, 0x63, 0x6f, 0xc3, 0xa9, 0x73,
- 0x74, 0x61, 0x6c, 0x6c, 0x65, 0x67, 0x61, 0x6e, 0x65, 0x67, 0x72, 0x6f, 0x70,
- 0x6c, 0x61, 0x7a, 0x61, 0x68, 0x75, 0x6d, 0x6f, 0x72, 0x70, 0x61, 0x67, 0x61,
- 0x72, 0x6a, 0x75, 0x6e, 0x74, 0x61, 0x64, 0x6f, 0x62, 0x6c, 0x65, 0x69, 0x73,
- 0x6c, 0x61, 0x73, 0x62, 0x6f, 0x6c, 0x73, 0x61, 0x62, 0x61, 0xc3, 0xb1, 0x6f,
- 0x68, 0x61, 0x62, 0x6c, 0x61, 0x6c, 0x75, 0x63, 0x68, 0x61, 0xc3, 0x81, 0x72,
- 0x65, 0x61, 0x64, 0x69, 0x63, 0x65, 0x6e, 0x6a, 0x75, 0x67, 0x61, 0x72, 0x6e,
- 0x6f, 0x74, 0x61, 0x73, 0x76, 0x61, 0x6c, 0x6c, 0x65, 0x61, 0x6c, 0x6c, 0xc3,
- 0xa1, 0x63, 0x61, 0x72, 0x67, 0x61, 0x64, 0x6f, 0x6c, 0x6f, 0x72, 0x61, 0x62,
- 0x61, 0x6a, 0x6f, 0x65, 0x73, 0x74, 0xc3, 0xa9, 0x67, 0x75, 0x73, 0x74, 0x6f,
- 0x6d, 0x65, 0x6e, 0x74, 0x65, 0x6d, 0x61, 0x72, 0x69, 0x6f, 0x66, 0x69, 0x72,
- 0x6d, 0x61, 0x63, 0x6f, 0x73, 0x74, 0x6f, 0x66, 0x69, 0x63, 0x68, 0x61, 0x70,
- 0x6c, 0x61, 0x74, 0x61, 0x68, 0x6f, 0x67, 0x61, 0x72, 0x61, 0x72, 0x74, 0x65,
- 0x73, 0x6c, 0x65, 0x79, 0x65, 0x73, 0x61, 0x71, 0x75, 0x65, 0x6c, 0x6d, 0x75,
- 0x73, 0x65, 0x6f, 0x62, 0x61, 0x73, 0x65, 0x73, 0x70, 0x6f, 0x63, 0x6f, 0x73,
- 0x6d, 0x69, 0x74, 0x61, 0x64, 0x63, 0x69, 0x65, 0x6c, 0x6f, 0x63, 0x68, 0x69,
- 0x63, 0x6f, 0x6d, 0x69, 0x65, 0x64, 0x6f, 0x67, 0x61, 0x6e, 0x61, 0x72, 0x73,
- 0x61, 0x6e, 0x74, 0x6f, 0x65, 0x74, 0x61, 0x70, 0x61, 0x64, 0x65, 0x62, 0x65,
- 0x73, 0x70, 0x6c, 0x61, 0x79, 0x61, 0x72, 0x65, 0x64, 0x65, 0x73, 0x73, 0x69,
- 0x65, 0x74, 0x65, 0x63, 0x6f, 0x72, 0x74, 0x65, 0x63, 0x6f, 0x72, 0x65, 0x61,
- 0x64, 0x75, 0x64, 0x61, 0x73, 0x64, 0x65, 0x73, 0x65, 0x6f, 0x76, 0x69, 0x65,
- 0x6a, 0x6f, 0x64, 0x65, 0x73, 0x65, 0x61, 0x61, 0x67, 0x75, 0x61, 0x73, 0x26,
- 0x71, 0x75, 0x6f, 0x74, 0x3b, 0x64, 0x6f, 0x6d, 0x61, 0x69, 0x6e, 0x63, 0x6f,
- 0x6d, 0x6d, 0x6f, 0x6e, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x65, 0x76, 0x65,
- 0x6e, 0x74, 0x73, 0x6d, 0x61, 0x73, 0x74, 0x65, 0x72, 0x73, 0x79, 0x73, 0x74,
- 0x65, 0x6d, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x62, 0x61, 0x6e, 0x6e, 0x65,
- 0x72, 0x72, 0x65, 0x6d, 0x6f, 0x76, 0x65, 0x73, 0x63, 0x72, 0x6f, 0x6c, 0x6c,
- 0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x67, 0x6c, 0x6f, 0x62, 0x61, 0x6c, 0x6d,
- 0x65, 0x64, 0x69, 0x75, 0x6d, 0x66, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x6e, 0x75,
- 0x6d, 0x62, 0x65, 0x72, 0x63, 0x68, 0x61, 0x6e, 0x67, 0x65, 0x72, 0x65, 0x73,
- 0x75, 0x6c, 0x74, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x63, 0x73, 0x63, 0x72, 0x65,
- 0x65, 0x6e, 0x63, 0x68, 0x6f, 0x6f, 0x73, 0x65, 0x6e, 0x6f, 0x72, 0x6d, 0x61,
- 0x6c, 0x74, 0x72, 0x61, 0x76, 0x65, 0x6c, 0x69, 0x73, 0x73, 0x75, 0x65, 0x73,
- 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x74, 0x61, 0x72, 0x67, 0x65, 0x74, 0x73,
- 0x70, 0x72, 0x69, 0x6e, 0x67, 0x6d, 0x6f, 0x64, 0x75, 0x6c, 0x65, 0x6d, 0x6f,
- 0x62, 0x69, 0x6c, 0x65, 0x73, 0x77, 0x69, 0x74, 0x63, 0x68, 0x70, 0x68, 0x6f,
- 0x74, 0x6f, 0x73, 0x62, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x72, 0x65, 0x67, 0x69,
- 0x6f, 0x6e, 0x69, 0x74, 0x73, 0x65, 0x6c, 0x66, 0x73, 0x6f, 0x63, 0x69, 0x61,
- 0x6c, 0x61, 0x63, 0x74, 0x69, 0x76, 0x65, 0x63, 0x6f, 0x6c, 0x75, 0x6d, 0x6e,
- 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x66, 0x6f, 0x6c, 0x6c, 0x6f, 0x77, 0x74,
- 0x69, 0x74, 0x6c, 0x65, 0x3e, 0x65, 0x69, 0x74, 0x68, 0x65, 0x72, 0x6c, 0x65,
- 0x6e, 0x67, 0x74, 0x68, 0x66, 0x61, 0x6d, 0x69, 0x6c, 0x79, 0x66, 0x72, 0x69,
- 0x65, 0x6e, 0x64, 0x6c, 0x61, 0x79, 0x6f, 0x75, 0x74, 0x61, 0x75, 0x74, 0x68,
- 0x6f, 0x72, 0x63, 0x72, 0x65, 0x61, 0x74, 0x65, 0x72, 0x65, 0x76, 0x69, 0x65,
- 0x77, 0x73, 0x75, 0x6d, 0x6d, 0x65, 0x72, 0x73, 0x65, 0x72, 0x76, 0x65, 0x72,
- 0x70, 0x6c, 0x61, 0x79, 0x65, 0x64, 0x70, 0x6c, 0x61, 0x79, 0x65, 0x72, 0x65,
- 0x78, 0x70, 0x61, 0x6e, 0x64, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x66, 0x6f,
- 0x72, 0x6d, 0x61, 0x74, 0x64, 0x6f, 0x75, 0x62, 0x6c, 0x65, 0x70, 0x6f, 0x69,
- 0x6e, 0x74, 0x73, 0x73, 0x65, 0x72, 0x69, 0x65, 0x73, 0x70, 0x65, 0x72, 0x73,
- 0x6f, 0x6e, 0x6c, 0x69, 0x76, 0x69, 0x6e, 0x67, 0x64, 0x65, 0x73, 0x69, 0x67,
- 0x6e, 0x6d, 0x6f, 0x6e, 0x74, 0x68, 0x73, 0x66, 0x6f, 0x72, 0x63, 0x65, 0x73,
- 0x75, 0x6e, 0x69, 0x71, 0x75, 0x65, 0x77, 0x65, 0x69, 0x67, 0x68, 0x74, 0x70,
- 0x65, 0x6f, 0x70, 0x6c, 0x65, 0x65, 0x6e, 0x65, 0x72, 0x67, 0x79, 0x6e, 0x61,
- 0x74, 0x75, 0x72, 0x65, 0x73, 0x65, 0x61, 0x72, 0x63, 0x68, 0x66, 0x69, 0x67,
- 0x75, 0x72, 0x65, 0x68, 0x61, 0x76, 0x69, 0x6e, 0x67, 0x63, 0x75, 0x73, 0x74,
- 0x6f, 0x6d, 0x6f, 0x66, 0x66, 0x73, 0x65, 0x74, 0x6c, 0x65, 0x74, 0x74, 0x65,
- 0x72, 0x77, 0x69, 0x6e, 0x64, 0x6f, 0x77, 0x73, 0x75, 0x62, 0x6d, 0x69, 0x74,
- 0x72, 0x65, 0x6e, 0x64, 0x65, 0x72, 0x67, 0x72, 0x6f, 0x75, 0x70, 0x73, 0x75,
- 0x70, 0x6c, 0x6f, 0x61, 0x64, 0x68, 0x65, 0x61, 0x6c, 0x74, 0x68, 0x6d, 0x65,
- 0x74, 0x68, 0x6f, 0x64, 0x76, 0x69, 0x64, 0x65, 0x6f, 0x73, 0x73, 0x63, 0x68,
- 0x6f, 0x6f, 0x6c, 0x66, 0x75, 0x74, 0x75, 0x72, 0x65, 0x73, 0x68, 0x61, 0x64,
- 0x6f, 0x77, 0x64, 0x65, 0x62, 0x61, 0x74, 0x65, 0x76, 0x61, 0x6c, 0x75, 0x65,
- 0x73, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x73,
- 0x72, 0x69, 0x67, 0x68, 0x74, 0x73, 0x6c, 0x65, 0x61, 0x67, 0x75, 0x65, 0x63,
- 0x68, 0x72, 0x6f, 0x6d, 0x65, 0x73, 0x69, 0x6d, 0x70, 0x6c, 0x65, 0x6e, 0x6f,
- 0x74, 0x69, 0x63, 0x65, 0x73, 0x68, 0x61, 0x72, 0x65, 0x64, 0x65, 0x6e, 0x64,
- 0x69, 0x6e, 0x67, 0x73, 0x65, 0x61, 0x73, 0x6f, 0x6e, 0x72, 0x65, 0x70, 0x6f,
- 0x72, 0x74, 0x6f, 0x6e, 0x6c, 0x69, 0x6e, 0x65, 0x73, 0x71, 0x75, 0x61, 0x72,
- 0x65, 0x62, 0x75, 0x74, 0x74, 0x6f, 0x6e, 0x69, 0x6d, 0x61, 0x67, 0x65, 0x73,
- 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x6d, 0x6f, 0x76, 0x69, 0x6e, 0x67, 0x6c,
- 0x61, 0x74, 0x65, 0x73, 0x74, 0x77, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x46, 0x72,
- 0x61, 0x6e, 0x63, 0x65, 0x70, 0x65, 0x72, 0x69, 0x6f, 0x64, 0x73, 0x74, 0x72,
- 0x6f, 0x6e, 0x67, 0x72, 0x65, 0x70, 0x65, 0x61, 0x74, 0x4c, 0x6f, 0x6e, 0x64,
- 0x6f, 0x6e, 0x64, 0x65, 0x74, 0x61, 0x69, 0x6c, 0x66, 0x6f, 0x72, 0x6d, 0x65,
- 0x64, 0x64, 0x65, 0x6d, 0x61, 0x6e, 0x64, 0x73, 0x65, 0x63, 0x75, 0x72, 0x65,
- 0x70, 0x61, 0x73, 0x73, 0x65, 0x64, 0x74, 0x6f, 0x67, 0x67, 0x6c, 0x65, 0x70,
- 0x6c, 0x61, 0x63, 0x65, 0x73, 0x64, 0x65, 0x76, 0x69, 0x63, 0x65, 0x73, 0x74,
- 0x61, 0x74, 0x69, 0x63, 0x63, 0x69, 0x74, 0x69, 0x65, 0x73, 0x73, 0x74, 0x72,
- 0x65, 0x61, 0x6d, 0x79, 0x65, 0x6c, 0x6c, 0x6f, 0x77, 0x61, 0x74, 0x74, 0x61,
- 0x63, 0x6b, 0x73, 0x74, 0x72, 0x65, 0x65, 0x74, 0x66, 0x6c, 0x69, 0x67, 0x68,
- 0x74, 0x68, 0x69, 0x64, 0x64, 0x65, 0x6e, 0x69, 0x6e, 0x66, 0x6f, 0x22, 0x3e,
- 0x6f, 0x70, 0x65, 0x6e, 0x65, 0x64, 0x75, 0x73, 0x65, 0x66, 0x75, 0x6c, 0x76,
- 0x61, 0x6c, 0x6c, 0x65, 0x79, 0x63, 0x61, 0x75, 0x73, 0x65, 0x73, 0x6c, 0x65,
- 0x61, 0x64, 0x65, 0x72, 0x73, 0x65, 0x63, 0x72, 0x65, 0x74, 0x73, 0x65, 0x63,
- 0x6f, 0x6e, 0x64, 0x64, 0x61, 0x6d, 0x61, 0x67, 0x65, 0x73, 0x70, 0x6f, 0x72,
- 0x74, 0x73, 0x65, 0x78, 0x63, 0x65, 0x70, 0x74, 0x72, 0x61, 0x74, 0x69, 0x6e,
- 0x67, 0x73, 0x69, 0x67, 0x6e, 0x65, 0x64, 0x74, 0x68, 0x69, 0x6e, 0x67, 0x73,
- 0x65, 0x66, 0x66, 0x65, 0x63, 0x74, 0x66, 0x69, 0x65, 0x6c, 0x64, 0x73, 0x73,
- 0x74, 0x61, 0x74, 0x65, 0x73, 0x6f, 0x66, 0x66, 0x69, 0x63, 0x65, 0x76, 0x69,
- 0x73, 0x75, 0x61, 0x6c, 0x65, 0x64, 0x69, 0x74, 0x6f, 0x72, 0x76, 0x6f, 0x6c,
- 0x75, 0x6d, 0x65, 0x52, 0x65, 0x70, 0x6f, 0x72, 0x74, 0x6d, 0x75, 0x73, 0x65,
- 0x75, 0x6d, 0x6d, 0x6f, 0x76, 0x69, 0x65, 0x73, 0x70, 0x61, 0x72, 0x65, 0x6e,
- 0x74, 0x61, 0x63, 0x63, 0x65, 0x73, 0x73, 0x6d, 0x6f, 0x73, 0x74, 0x6c, 0x79,
- 0x6d, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x22, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x6d,
- 0x61, 0x72, 0x6b, 0x65, 0x74, 0x67, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x63, 0x68,
- 0x61, 0x6e, 0x63, 0x65, 0x73, 0x75, 0x72, 0x76, 0x65, 0x79, 0x62, 0x65, 0x66,
- 0x6f, 0x72, 0x65, 0x73, 0x79, 0x6d, 0x62, 0x6f, 0x6c, 0x6d, 0x6f, 0x6d, 0x65,
- 0x6e, 0x74, 0x73, 0x70, 0x65, 0x65, 0x63, 0x68, 0x6d, 0x6f, 0x74, 0x69, 0x6f,
- 0x6e, 0x69, 0x6e, 0x73, 0x69, 0x64, 0x65, 0x6d, 0x61, 0x74, 0x74, 0x65, 0x72,
- 0x43, 0x65, 0x6e, 0x74, 0x65, 0x72, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x65,
- 0x78, 0x69, 0x73, 0x74, 0x73, 0x6d, 0x69, 0x64, 0x64, 0x6c, 0x65, 0x45, 0x75,
- 0x72, 0x6f, 0x70, 0x65, 0x67, 0x72, 0x6f, 0x77, 0x74, 0x68, 0x6c, 0x65, 0x67,
- 0x61, 0x63, 0x79, 0x6d, 0x61, 0x6e, 0x6e, 0x65, 0x72, 0x65, 0x6e, 0x6f, 0x75,
- 0x67, 0x68, 0x63, 0x61, 0x72, 0x65, 0x65, 0x72, 0x61, 0x6e, 0x73, 0x77, 0x65,
- 0x72, 0x6f, 0x72, 0x69, 0x67, 0x69, 0x6e, 0x70, 0x6f, 0x72, 0x74, 0x61, 0x6c,
- 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x72,
- 0x61, 0x6e, 0x64, 0x6f, 0x6d, 0x63, 0x6c, 0x6f, 0x73, 0x65, 0x64, 0x74, 0x6f,
- 0x70, 0x69, 0x63, 0x73, 0x63, 0x6f, 0x6d, 0x69, 0x6e, 0x67, 0x66, 0x61, 0x74,
- 0x68, 0x65, 0x72, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x69, 0x6d, 0x70,
- 0x6c, 0x79, 0x72, 0x61, 0x69, 0x73, 0x65, 0x64, 0x65, 0x73, 0x63, 0x61, 0x70,
- 0x65, 0x63, 0x68, 0x6f, 0x73, 0x65, 0x6e, 0x63, 0x68, 0x75, 0x72, 0x63, 0x68,
- 0x64, 0x65, 0x66, 0x69, 0x6e, 0x65, 0x72, 0x65, 0x61, 0x73, 0x6f, 0x6e, 0x63,
- 0x6f, 0x72, 0x6e, 0x65, 0x72, 0x6f, 0x75, 0x74, 0x70, 0x75, 0x74, 0x6d, 0x65,
- 0x6d, 0x6f, 0x72, 0x79, 0x69, 0x66, 0x72, 0x61, 0x6d, 0x65, 0x70, 0x6f, 0x6c,
- 0x69, 0x63, 0x65, 0x6d, 0x6f, 0x64, 0x65, 0x6c, 0x73, 0x4e, 0x75, 0x6d, 0x62,
- 0x65, 0x72, 0x64, 0x75, 0x72, 0x69, 0x6e, 0x67, 0x6f, 0x66, 0x66, 0x65, 0x72,
- 0x73, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x73, 0x6b, 0x69, 0x6c, 0x6c, 0x65, 0x64,
- 0x6c, 0x69, 0x73, 0x74, 0x65, 0x64, 0x63, 0x61, 0x6c, 0x6c, 0x65, 0x64, 0x73,
- 0x69, 0x6c, 0x76, 0x65, 0x72, 0x6d, 0x61, 0x72, 0x67, 0x69, 0x6e, 0x64, 0x65,
- 0x6c, 0x65, 0x74, 0x65, 0x62, 0x65, 0x74, 0x74, 0x65, 0x72, 0x62, 0x72, 0x6f,
- 0x77, 0x73, 0x65, 0x6c, 0x69, 0x6d, 0x69, 0x74, 0x73, 0x47, 0x6c, 0x6f, 0x62,
- 0x61, 0x6c, 0x73, 0x69, 0x6e, 0x67, 0x6c, 0x65, 0x77, 0x69, 0x64, 0x67, 0x65,
- 0x74, 0x63, 0x65, 0x6e, 0x74, 0x65, 0x72, 0x62, 0x75, 0x64, 0x67, 0x65, 0x74,
- 0x6e, 0x6f, 0x77, 0x72, 0x61, 0x70, 0x63, 0x72, 0x65, 0x64, 0x69, 0x74, 0x63,
- 0x6c, 0x61, 0x69, 0x6d, 0x73, 0x65, 0x6e, 0x67, 0x69, 0x6e, 0x65, 0x73, 0x61,
- 0x66, 0x65, 0x74, 0x79, 0x63, 0x68, 0x6f, 0x69, 0x63, 0x65, 0x73, 0x70, 0x69,
- 0x72, 0x69, 0x74, 0x2d, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x73, 0x70, 0x72, 0x65,
- 0x61, 0x64, 0x6d, 0x61, 0x6b, 0x69, 0x6e, 0x67, 0x6e, 0x65, 0x65, 0x64, 0x65,
- 0x64, 0x72, 0x75, 0x73, 0x73, 0x69, 0x61, 0x70, 0x6c, 0x65, 0x61, 0x73, 0x65,
- 0x65, 0x78, 0x74, 0x65, 0x6e, 0x74, 0x53, 0x63, 0x72, 0x69, 0x70, 0x74, 0x62,
- 0x72, 0x6f, 0x6b, 0x65, 0x6e, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x73, 0x63, 0x68,
- 0x61, 0x72, 0x67, 0x65, 0x64, 0x69, 0x76, 0x69, 0x64, 0x65, 0x66, 0x61, 0x63,
- 0x74, 0x6f, 0x72, 0x6d, 0x65, 0x6d, 0x62, 0x65, 0x72, 0x2d, 0x62, 0x61, 0x73,
- 0x65, 0x64, 0x74, 0x68, 0x65, 0x6f, 0x72, 0x79, 0x63, 0x6f, 0x6e, 0x66, 0x69,
- 0x67, 0x61, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x77, 0x6f, 0x72, 0x6b, 0x65, 0x64,
- 0x68, 0x65, 0x6c, 0x70, 0x65, 0x64, 0x43, 0x68, 0x75, 0x72, 0x63, 0x68, 0x69,
- 0x6d, 0x70, 0x61, 0x63, 0x74, 0x73, 0x68, 0x6f, 0x75, 0x6c, 0x64, 0x61, 0x6c,
- 0x77, 0x61, 0x79, 0x73, 0x6c, 0x6f, 0x67, 0x6f, 0x22, 0x20, 0x62, 0x6f, 0x74,
- 0x74, 0x6f, 0x6d, 0x6c, 0x69, 0x73, 0x74, 0x22, 0x3e, 0x29, 0x7b, 0x76, 0x61,
- 0x72, 0x20, 0x70, 0x72, 0x65, 0x66, 0x69, 0x78, 0x6f, 0x72, 0x61, 0x6e, 0x67,
- 0x65, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x2e, 0x70, 0x75, 0x73, 0x68, 0x28,
- 0x63, 0x6f, 0x75, 0x70, 0x6c, 0x65, 0x67, 0x61, 0x72, 0x64, 0x65, 0x6e, 0x62,
- 0x72, 0x69, 0x64, 0x67, 0x65, 0x6c, 0x61, 0x75, 0x6e, 0x63, 0x68, 0x52, 0x65,
- 0x76, 0x69, 0x65, 0x77, 0x74, 0x61, 0x6b, 0x69, 0x6e, 0x67, 0x76, 0x69, 0x73,
- 0x69, 0x6f, 0x6e, 0x6c, 0x69, 0x74, 0x74, 0x6c, 0x65, 0x64, 0x61, 0x74, 0x69,
- 0x6e, 0x67, 0x42, 0x75, 0x74, 0x74, 0x6f, 0x6e, 0x62, 0x65, 0x61, 0x75, 0x74,
- 0x79, 0x74, 0x68, 0x65, 0x6d, 0x65, 0x73, 0x66, 0x6f, 0x72, 0x67, 0x6f, 0x74,
- 0x53, 0x65, 0x61, 0x72, 0x63, 0x68, 0x61, 0x6e, 0x63, 0x68, 0x6f, 0x72, 0x61,
- 0x6c, 0x6d, 0x6f, 0x73, 0x74, 0x6c, 0x6f, 0x61, 0x64, 0x65, 0x64, 0x43, 0x68,
- 0x61, 0x6e, 0x67, 0x65, 0x72, 0x65, 0x74, 0x75, 0x72, 0x6e, 0x73, 0x74, 0x72,
- 0x69, 0x6e, 0x67, 0x72, 0x65, 0x6c, 0x6f, 0x61, 0x64, 0x4d, 0x6f, 0x62, 0x69,
- 0x6c, 0x65, 0x69, 0x6e, 0x63, 0x6f, 0x6d, 0x65, 0x73, 0x75, 0x70, 0x70, 0x6c,
- 0x79, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x73,
- 0x76, 0x69, 0x65, 0x77, 0x65, 0x64, 0x26, 0x6e, 0x62, 0x73, 0x70, 0x3b, 0x63,
- 0x6f, 0x75, 0x72, 0x73, 0x65, 0x41, 0x62, 0x6f, 0x75, 0x74, 0x20, 0x69, 0x73,
- 0x6c, 0x61, 0x6e, 0x64, 0x3c, 0x68, 0x74, 0x6d, 0x6c, 0x20, 0x63, 0x6f, 0x6f,
- 0x6b, 0x69, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x22, 0x61, 0x6d, 0x61, 0x7a,
- 0x6f, 0x6e, 0x6d, 0x6f, 0x64, 0x65, 0x72, 0x6e, 0x61, 0x64, 0x76, 0x69, 0x63,
- 0x65, 0x69, 0x6e, 0x3c, 0x2f, 0x61, 0x3e, 0x3a, 0x20, 0x54, 0x68, 0x65, 0x20,
- 0x64, 0x69, 0x61, 0x6c, 0x6f, 0x67, 0x68, 0x6f, 0x75, 0x73, 0x65, 0x73, 0x42,
- 0x45, 0x47, 0x49, 0x4e, 0x20, 0x4d, 0x65, 0x78, 0x69, 0x63, 0x6f, 0x73, 0x74,
- 0x61, 0x72, 0x74, 0x73, 0x63, 0x65, 0x6e, 0x74, 0x72, 0x65, 0x68, 0x65, 0x69,
- 0x67, 0x68, 0x74, 0x61, 0x64, 0x64, 0x69, 0x6e, 0x67, 0x49, 0x73, 0x6c, 0x61,
- 0x6e, 0x64, 0x61, 0x73, 0x73, 0x65, 0x74, 0x73, 0x45, 0x6d, 0x70, 0x69, 0x72,
- 0x65, 0x53, 0x63, 0x68, 0x6f, 0x6f, 0x6c, 0x65, 0x66, 0x66, 0x6f, 0x72, 0x74,
- 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x6e, 0x65, 0x61, 0x72, 0x6c, 0x79, 0x6d,
- 0x61, 0x6e, 0x75, 0x61, 0x6c, 0x53, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x2e, 0x0a,
- 0x0a, 0x4f, 0x6e, 0x65, 0x6a, 0x6f, 0x69, 0x6e, 0x65, 0x64, 0x6d, 0x65, 0x6e,
- 0x75, 0x22, 0x3e, 0x50, 0x68, 0x69, 0x6c, 0x69, 0x70, 0x61, 0x77, 0x61, 0x72,
- 0x64, 0x73, 0x68, 0x61, 0x6e, 0x64, 0x6c, 0x65, 0x69, 0x6d, 0x70, 0x6f, 0x72,
- 0x74, 0x4f, 0x66, 0x66, 0x69, 0x63, 0x65, 0x72, 0x65, 0x67, 0x61, 0x72, 0x64,
- 0x73, 0x6b, 0x69, 0x6c, 0x6c, 0x73, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x53,
- 0x70, 0x6f, 0x72, 0x74, 0x73, 0x64, 0x65, 0x67, 0x72, 0x65, 0x65, 0x77, 0x65,
- 0x65, 0x6b, 0x6c, 0x79, 0x20, 0x28, 0x65, 0x2e, 0x67, 0x2e, 0x62, 0x65, 0x68,
- 0x69, 0x6e, 0x64, 0x64, 0x6f, 0x63, 0x74, 0x6f, 0x72, 0x6c, 0x6f, 0x67, 0x67,
- 0x65, 0x64, 0x75, 0x6e, 0x69, 0x74, 0x65, 0x64, 0x3c, 0x2f, 0x62, 0x3e, 0x3c,
- 0x2f, 0x62, 0x65, 0x67, 0x69, 0x6e, 0x73, 0x70, 0x6c, 0x61, 0x6e, 0x74, 0x73,
- 0x61, 0x73, 0x73, 0x69, 0x73, 0x74, 0x61, 0x72, 0x74, 0x69, 0x73, 0x74, 0x69,
- 0x73, 0x73, 0x75, 0x65, 0x64, 0x33, 0x30, 0x30, 0x70, 0x78, 0x7c, 0x63, 0x61,
- 0x6e, 0x61, 0x64, 0x61, 0x61, 0x67, 0x65, 0x6e, 0x63, 0x79, 0x73, 0x63, 0x68,
- 0x65, 0x6d, 0x65, 0x72, 0x65, 0x6d, 0x61, 0x69, 0x6e, 0x42, 0x72, 0x61, 0x7a,
- 0x69, 0x6c, 0x73, 0x61, 0x6d, 0x70, 0x6c, 0x65, 0x6c, 0x6f, 0x67, 0x6f, 0x22,
- 0x3e, 0x62, 0x65, 0x79, 0x6f, 0x6e, 0x64, 0x2d, 0x73, 0x63, 0x61, 0x6c, 0x65,
- 0x61, 0x63, 0x63, 0x65, 0x70, 0x74, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x6d,
- 0x61, 0x72, 0x69, 0x6e, 0x65, 0x46, 0x6f, 0x6f, 0x74, 0x65, 0x72, 0x63, 0x61,
- 0x6d, 0x65, 0x72, 0x61, 0x3c, 0x2f, 0x68, 0x31, 0x3e, 0x0a, 0x5f, 0x66, 0x6f,
- 0x72, 0x6d, 0x22, 0x6c, 0x65, 0x61, 0x76, 0x65, 0x73, 0x73, 0x74, 0x72, 0x65,
- 0x73, 0x73, 0x22, 0x20, 0x2f, 0x3e, 0x0d, 0x0a, 0x2e, 0x67, 0x69, 0x66, 0x22,
- 0x20, 0x6f, 0x6e, 0x6c, 0x6f, 0x61, 0x64, 0x6c, 0x6f, 0x61, 0x64, 0x65, 0x72,
- 0x4f, 0x78, 0x66, 0x6f, 0x72, 0x64, 0x73, 0x69, 0x73, 0x74, 0x65, 0x72, 0x73,
- 0x75, 0x72, 0x76, 0x69, 0x76, 0x6c, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x66, 0x65,
- 0x6d, 0x61, 0x6c, 0x65, 0x44, 0x65, 0x73, 0x69, 0x67, 0x6e, 0x73, 0x69, 0x7a,
- 0x65, 0x3d, 0x22, 0x61, 0x70, 0x70, 0x65, 0x61, 0x6c, 0x74, 0x65, 0x78, 0x74,
- 0x22, 0x3e, 0x6c, 0x65, 0x76, 0x65, 0x6c, 0x73, 0x74, 0x68, 0x61, 0x6e, 0x6b,
- 0x73, 0x68, 0x69, 0x67, 0x68, 0x65, 0x72, 0x66, 0x6f, 0x72, 0x63, 0x65, 0x64,
- 0x61, 0x6e, 0x69, 0x6d, 0x61, 0x6c, 0x61, 0x6e, 0x79, 0x6f, 0x6e, 0x65, 0x41,
- 0x66, 0x72, 0x69, 0x63, 0x61, 0x61, 0x67, 0x72, 0x65, 0x65, 0x64, 0x72, 0x65,
- 0x63, 0x65, 0x6e, 0x74, 0x50, 0x65, 0x6f, 0x70, 0x6c, 0x65, 0x3c, 0x62, 0x72,
- 0x20, 0x2f, 0x3e, 0x77, 0x6f, 0x6e, 0x64, 0x65, 0x72, 0x70, 0x72, 0x69, 0x63,
- 0x65, 0x73, 0x74, 0x75, 0x72, 0x6e, 0x65, 0x64, 0x7c, 0x7c, 0x20, 0x7b, 0x7d,
- 0x3b, 0x6d, 0x61, 0x69, 0x6e, 0x22, 0x3e, 0x69, 0x6e, 0x6c, 0x69, 0x6e, 0x65,
- 0x73, 0x75, 0x6e, 0x64, 0x61, 0x79, 0x77, 0x72, 0x61, 0x70, 0x22, 0x3e, 0x66,
- 0x61, 0x69, 0x6c, 0x65, 0x64, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x6d, 0x69,
- 0x6e, 0x75, 0x74, 0x65, 0x62, 0x65, 0x61, 0x63, 0x6f, 0x6e, 0x71, 0x75, 0x6f,
- 0x74, 0x65, 0x73, 0x31, 0x35, 0x30, 0x70, 0x78, 0x7c, 0x65, 0x73, 0x74, 0x61,
- 0x74, 0x65, 0x72, 0x65, 0x6d, 0x6f, 0x74, 0x65, 0x65, 0x6d, 0x61, 0x69, 0x6c,
- 0x22, 0x6c, 0x69, 0x6e, 0x6b, 0x65, 0x64, 0x72, 0x69, 0x67, 0x68, 0x74, 0x3b,
- 0x73, 0x69, 0x67, 0x6e, 0x61, 0x6c, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x6c, 0x31,
- 0x2e, 0x68, 0x74, 0x6d, 0x6c, 0x73, 0x69, 0x67, 0x6e, 0x75, 0x70, 0x70, 0x72,
- 0x69, 0x6e, 0x63, 0x65, 0x66, 0x6c, 0x6f, 0x61, 0x74, 0x3a, 0x2e, 0x70, 0x6e,
- 0x67, 0x22, 0x20, 0x66, 0x6f, 0x72, 0x75, 0x6d, 0x2e, 0x41, 0x63, 0x63, 0x65,
- 0x73, 0x73, 0x70, 0x61, 0x70, 0x65, 0x72, 0x73, 0x73, 0x6f, 0x75, 0x6e, 0x64,
- 0x73, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x64, 0x48, 0x65, 0x69, 0x67, 0x68, 0x74,
- 0x73, 0x6c, 0x69, 0x64, 0x65, 0x72, 0x55, 0x54, 0x46, 0x2d, 0x38, 0x22, 0x26,
- 0x61, 0x6d, 0x70, 0x3b, 0x20, 0x42, 0x65, 0x66, 0x6f, 0x72, 0x65, 0x2e, 0x20,
- 0x57, 0x69, 0x74, 0x68, 0x73, 0x74, 0x75, 0x64, 0x69, 0x6f, 0x6f, 0x77, 0x6e,
- 0x65, 0x72, 0x73, 0x6d, 0x61, 0x6e, 0x61, 0x67, 0x65, 0x70, 0x72, 0x6f, 0x66,
- 0x69, 0x74, 0x6a, 0x51, 0x75, 0x65, 0x72, 0x79, 0x61, 0x6e, 0x6e, 0x75, 0x61,
- 0x6c, 0x70, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x62, 0x6f, 0x75, 0x67, 0x68, 0x74,
- 0x66, 0x61, 0x6d, 0x6f, 0x75, 0x73, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x6c,
- 0x6f, 0x6e, 0x67, 0x65, 0x72, 0x69, 0x2b, 0x2b, 0x29, 0x20, 0x7b, 0x69, 0x73,
- 0x72, 0x61, 0x65, 0x6c, 0x73, 0x61, 0x79, 0x69, 0x6e, 0x67, 0x64, 0x65, 0x63,
- 0x69, 0x64, 0x65, 0x68, 0x6f, 0x6d, 0x65, 0x22, 0x3e, 0x68, 0x65, 0x61, 0x64,
- 0x65, 0x72, 0x65, 0x6e, 0x73, 0x75, 0x72, 0x65, 0x62, 0x72, 0x61, 0x6e, 0x63,
- 0x68, 0x70, 0x69, 0x65, 0x63, 0x65, 0x73, 0x62, 0x6c, 0x6f, 0x63, 0x6b, 0x3b,
- 0x73, 0x74, 0x61, 0x74, 0x65, 0x64, 0x74, 0x6f, 0x70, 0x22, 0x3e, 0x3c, 0x72,
- 0x61, 0x63, 0x69, 0x6e, 0x67, 0x72, 0x65, 0x73, 0x69, 0x7a, 0x65, 0x2d, 0x2d,
- 0x26, 0x67, 0x74, 0x3b, 0x70, 0x61, 0x63, 0x69, 0x74, 0x79, 0x73, 0x65, 0x78,
- 0x75, 0x61, 0x6c, 0x62, 0x75, 0x72, 0x65, 0x61, 0x75, 0x2e, 0x6a, 0x70, 0x67,
- 0x22, 0x20, 0x31, 0x30, 0x2c, 0x30, 0x30, 0x30, 0x6f, 0x62, 0x74, 0x61, 0x69,
- 0x6e, 0x74, 0x69, 0x74, 0x6c, 0x65, 0x73, 0x61, 0x6d, 0x6f, 0x75, 0x6e, 0x74,
- 0x2c, 0x20, 0x49, 0x6e, 0x63, 0x2e, 0x63, 0x6f, 0x6d, 0x65, 0x64, 0x79, 0x6d,
- 0x65, 0x6e, 0x75, 0x22, 0x20, 0x6c, 0x79, 0x72, 0x69, 0x63, 0x73, 0x74, 0x6f,
- 0x64, 0x61, 0x79, 0x2e, 0x69, 0x6e, 0x64, 0x65, 0x65, 0x64, 0x63, 0x6f, 0x75,
- 0x6e, 0x74, 0x79, 0x5f, 0x6c, 0x6f, 0x67, 0x6f, 0x2e, 0x46, 0x61, 0x6d, 0x69,
- 0x6c, 0x79, 0x6c, 0x6f, 0x6f, 0x6b, 0x65, 0x64, 0x4d, 0x61, 0x72, 0x6b, 0x65,
- 0x74, 0x6c, 0x73, 0x65, 0x20, 0x69, 0x66, 0x50, 0x6c, 0x61, 0x79, 0x65, 0x72,
- 0x74, 0x75, 0x72, 0x6b, 0x65, 0x79, 0x29, 0x3b, 0x76, 0x61, 0x72, 0x20, 0x66,
- 0x6f, 0x72, 0x65, 0x73, 0x74, 0x67, 0x69, 0x76, 0x69, 0x6e, 0x67, 0x65, 0x72,
- 0x72, 0x6f, 0x72, 0x73, 0x44, 0x6f, 0x6d, 0x61, 0x69, 0x6e, 0x7d, 0x65, 0x6c,
- 0x73, 0x65, 0x7b, 0x69, 0x6e, 0x73, 0x65, 0x72, 0x74, 0x42, 0x6c, 0x6f, 0x67,
- 0x3c, 0x2f, 0x66, 0x6f, 0x6f, 0x74, 0x65, 0x72, 0x6c, 0x6f, 0x67, 0x69, 0x6e,
- 0x2e, 0x66, 0x61, 0x73, 0x74, 0x65, 0x72, 0x61, 0x67, 0x65, 0x6e, 0x74, 0x73,
- 0x3c, 0x62, 0x6f, 0x64, 0x79, 0x20, 0x31, 0x30, 0x70, 0x78, 0x20, 0x30, 0x70,
- 0x72, 0x61, 0x67, 0x6d, 0x61, 0x66, 0x72, 0x69, 0x64, 0x61, 0x79, 0x6a, 0x75,
- 0x6e, 0x69, 0x6f, 0x72, 0x64, 0x6f, 0x6c, 0x6c, 0x61, 0x72, 0x70, 0x6c, 0x61,
- 0x63, 0x65, 0x64, 0x63, 0x6f, 0x76, 0x65, 0x72, 0x73, 0x70, 0x6c, 0x75, 0x67,
- 0x69, 0x6e, 0x35, 0x2c, 0x30, 0x30, 0x30, 0x20, 0x70, 0x61, 0x67, 0x65, 0x22,
- 0x3e, 0x62, 0x6f, 0x73, 0x74, 0x6f, 0x6e, 0x2e, 0x74, 0x65, 0x73, 0x74, 0x28,
- 0x61, 0x76, 0x61, 0x74, 0x61, 0x72, 0x74, 0x65, 0x73, 0x74, 0x65, 0x64, 0x5f,
- 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x66, 0x6f, 0x72, 0x75, 0x6d, 0x73, 0x73, 0x63,
- 0x68, 0x65, 0x6d, 0x61, 0x69, 0x6e, 0x64, 0x65, 0x78, 0x2c, 0x66, 0x69, 0x6c,
- 0x6c, 0x65, 0x64, 0x73, 0x68, 0x61, 0x72, 0x65, 0x73, 0x72, 0x65, 0x61, 0x64,
- 0x65, 0x72, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x28, 0x61, 0x70, 0x70, 0x65, 0x61,
- 0x72, 0x53, 0x75, 0x62, 0x6d, 0x69, 0x74, 0x6c, 0x69, 0x6e, 0x65, 0x22, 0x3e,
- 0x62, 0x6f, 0x64, 0x79, 0x22, 0x3e, 0x0a, 0x2a, 0x20, 0x54, 0x68, 0x65, 0x54,
- 0x68, 0x6f, 0x75, 0x67, 0x68, 0x73, 0x65, 0x65, 0x69, 0x6e, 0x67, 0x6a, 0x65,
- 0x72, 0x73, 0x65, 0x79, 0x4e, 0x65, 0x77, 0x73, 0x3c, 0x2f, 0x76, 0x65, 0x72,
- 0x69, 0x66, 0x79, 0x65, 0x78, 0x70, 0x65, 0x72, 0x74, 0x69, 0x6e, 0x6a, 0x75,
- 0x72, 0x79, 0x77, 0x69, 0x64, 0x74, 0x68, 0x3d, 0x43, 0x6f, 0x6f, 0x6b, 0x69,
- 0x65, 0x53, 0x54, 0x41, 0x52, 0x54, 0x20, 0x61, 0x63, 0x72, 0x6f, 0x73, 0x73,
- 0x5f, 0x69, 0x6d, 0x61, 0x67, 0x65, 0x74, 0x68, 0x72, 0x65, 0x61, 0x64, 0x6e,
- 0x61, 0x74, 0x69, 0x76, 0x65, 0x70, 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x62, 0x6f,
- 0x78, 0x22, 0x3e, 0x0a, 0x53, 0x79, 0x73, 0x74, 0x65, 0x6d, 0x20, 0x44, 0x61,
- 0x76, 0x69, 0x64, 0x63, 0x61, 0x6e, 0x63, 0x65, 0x72, 0x74, 0x61, 0x62, 0x6c,
- 0x65, 0x73, 0x70, 0x72, 0x6f, 0x76, 0x65, 0x64, 0x41, 0x70, 0x72, 0x69, 0x6c,
- 0x20, 0x72, 0x65, 0x61, 0x6c, 0x6c, 0x79, 0x64, 0x72, 0x69, 0x76, 0x65, 0x72,
- 0x69, 0x74, 0x65, 0x6d, 0x22, 0x3e, 0x6d, 0x6f, 0x72, 0x65, 0x22, 0x3e, 0x62,
- 0x6f, 0x61, 0x72, 0x64, 0x73, 0x63, 0x6f, 0x6c, 0x6f, 0x72, 0x73, 0x63, 0x61,
- 0x6d, 0x70, 0x75, 0x73, 0x66, 0x69, 0x72, 0x73, 0x74, 0x20, 0x7c, 0x7c, 0x20,
- 0x5b, 0x5d, 0x3b, 0x6d, 0x65, 0x64, 0x69, 0x61, 0x2e, 0x67, 0x75, 0x69, 0x74,
- 0x61, 0x72, 0x66, 0x69, 0x6e, 0x69, 0x73, 0x68, 0x77, 0x69, 0x64, 0x74, 0x68,
- 0x3a, 0x73, 0x68, 0x6f, 0x77, 0x65, 0x64, 0x4f, 0x74, 0x68, 0x65, 0x72, 0x20,
- 0x2e, 0x70, 0x68, 0x70, 0x22, 0x20, 0x61, 0x73, 0x73, 0x75, 0x6d, 0x65, 0x6c,
- 0x61, 0x79, 0x65, 0x72, 0x73, 0x77, 0x69, 0x6c, 0x73, 0x6f, 0x6e, 0x73, 0x74,
- 0x6f, 0x72, 0x65, 0x73, 0x72, 0x65, 0x6c, 0x69, 0x65, 0x66, 0x73, 0x77, 0x65,
- 0x64, 0x65, 0x6e, 0x43, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x65, 0x61, 0x73, 0x69,
- 0x6c, 0x79, 0x20, 0x79, 0x6f, 0x75, 0x72, 0x20, 0x53, 0x74, 0x72, 0x69, 0x6e,
- 0x67, 0x0a, 0x0a, 0x57, 0x68, 0x69, 0x6c, 0x74, 0x61, 0x79, 0x6c, 0x6f, 0x72,
- 0x63, 0x6c, 0x65, 0x61, 0x72, 0x3a, 0x72, 0x65, 0x73, 0x6f, 0x72, 0x74, 0x66,
- 0x72, 0x65, 0x6e, 0x63, 0x68, 0x74, 0x68, 0x6f, 0x75, 0x67, 0x68, 0x22, 0x29,
- 0x20, 0x2b, 0x20, 0x22, 0x3c, 0x62, 0x6f, 0x64, 0x79, 0x3e, 0x62, 0x75, 0x79,
- 0x69, 0x6e, 0x67, 0x62, 0x72, 0x61, 0x6e, 0x64, 0x73, 0x4d, 0x65, 0x6d, 0x62,
- 0x65, 0x72, 0x6e, 0x61, 0x6d, 0x65, 0x22, 0x3e, 0x6f, 0x70, 0x70, 0x69, 0x6e,
- 0x67, 0x73, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x35, 0x70, 0x78, 0x3b, 0x22, 0x3e,
- 0x76, 0x73, 0x70, 0x61, 0x63, 0x65, 0x70, 0x6f, 0x73, 0x74, 0x65, 0x72, 0x6d,
- 0x61, 0x6a, 0x6f, 0x72, 0x20, 0x63, 0x6f, 0x66, 0x66, 0x65, 0x65, 0x6d, 0x61,
- 0x72, 0x74, 0x69, 0x6e, 0x6d, 0x61, 0x74, 0x75, 0x72, 0x65, 0x68, 0x61, 0x70,
- 0x70, 0x65, 0x6e, 0x3c, 0x2f, 0x6e, 0x61, 0x76, 0x3e, 0x6b, 0x61, 0x6e, 0x73,
- 0x61, 0x73, 0x6c, 0x69, 0x6e, 0x6b, 0x22, 0x3e, 0x49, 0x6d, 0x61, 0x67, 0x65,
- 0x73, 0x3d, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x77, 0x68, 0x69, 0x6c, 0x65, 0x20,
- 0x68, 0x73, 0x70, 0x61, 0x63, 0x65, 0x30, 0x26, 0x61, 0x6d, 0x70, 0x3b, 0x20,
- 0x0a, 0x0a, 0x49, 0x6e, 0x20, 0x20, 0x70, 0x6f, 0x77, 0x65, 0x72, 0x50, 0x6f,
- 0x6c, 0x73, 0x6b, 0x69, 0x2d, 0x63, 0x6f, 0x6c, 0x6f, 0x72, 0x6a, 0x6f, 0x72,
- 0x64, 0x61, 0x6e, 0x42, 0x6f, 0x74, 0x74, 0x6f, 0x6d, 0x53, 0x74, 0x61, 0x72,
- 0x74, 0x20, 0x2d, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x32, 0x2e, 0x68, 0x74, 0x6d,
- 0x6c, 0x6e, 0x65, 0x77, 0x73, 0x22, 0x3e, 0x30, 0x31, 0x2e, 0x6a, 0x70, 0x67,
- 0x4f, 0x6e, 0x6c, 0x69, 0x6e, 0x65, 0x2d, 0x72, 0x69, 0x67, 0x68, 0x74, 0x6d,
- 0x69, 0x6c, 0x6c, 0x65, 0x72, 0x73, 0x65, 0x6e, 0x69, 0x6f, 0x72, 0x49, 0x53,
- 0x42, 0x4e, 0x20, 0x30, 0x30, 0x2c, 0x30, 0x30, 0x30, 0x20, 0x67, 0x75, 0x69,
- 0x64, 0x65, 0x73, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x29, 0x65, 0x63, 0x74, 0x69,
- 0x6f, 0x6e, 0x72, 0x65, 0x70, 0x61, 0x69, 0x72, 0x2e, 0x78, 0x6d, 0x6c, 0x22,
- 0x20, 0x20, 0x72, 0x69, 0x67, 0x68, 0x74, 0x73, 0x2e, 0x68, 0x74, 0x6d, 0x6c,
- 0x2d, 0x62, 0x6c, 0x6f, 0x63, 0x6b, 0x72, 0x65, 0x67, 0x45, 0x78, 0x70, 0x3a,
- 0x68, 0x6f, 0x76, 0x65, 0x72, 0x77, 0x69, 0x74, 0x68, 0x69, 0x6e, 0x76, 0x69,
- 0x72, 0x67, 0x69, 0x6e, 0x70, 0x68, 0x6f, 0x6e, 0x65, 0x73, 0x3c, 0x2f, 0x74,
- 0x72, 0x3e, 0x0d, 0x75, 0x73, 0x69, 0x6e, 0x67, 0x20, 0x0a, 0x09, 0x76, 0x61,
- 0x72, 0x20, 0x3e, 0x27, 0x29, 0x3b, 0x0a, 0x09, 0x3c, 0x2f, 0x74, 0x64, 0x3e,
- 0x0a, 0x3c, 0x2f, 0x74, 0x72, 0x3e, 0x0a, 0x62, 0x61, 0x68, 0x61, 0x73, 0x61,
- 0x62, 0x72, 0x61, 0x73, 0x69, 0x6c, 0x67, 0x61, 0x6c, 0x65, 0x67, 0x6f, 0x6d,
- 0x61, 0x67, 0x79, 0x61, 0x72, 0x70, 0x6f, 0x6c, 0x73, 0x6b, 0x69, 0x73, 0x72,
- 0x70, 0x73, 0x6b, 0x69, 0xd8, 0xb1, 0xd8, 0xaf, 0xd9, 0x88, 0xe4, 0xb8, 0xad,
- 0xe6, 0x96, 0x87, 0xe7, 0xae, 0x80, 0xe4, 0xbd, 0x93, 0xe7, 0xb9, 0x81, 0xe9,
- 0xab, 0x94, 0xe4, 0xbf, 0xa1, 0xe6, 0x81, 0xaf, 0xe4, 0xb8, 0xad, 0xe5, 0x9b,
- 0xbd, 0xe6, 0x88, 0x91, 0xe4, 0xbb, 0xac, 0xe4, 0xb8, 0x80, 0xe4, 0xb8, 0xaa,
- 0xe5, 0x85, 0xac, 0xe5, 0x8f, 0xb8, 0xe7, 0xae, 0xa1, 0xe7, 0x90, 0x86, 0xe8,
- 0xae, 0xba, 0xe5, 0x9d, 0x9b, 0xe5, 0x8f, 0xaf, 0xe4, 0xbb, 0xa5, 0xe6, 0x9c,
- 0x8d, 0xe5, 0x8a, 0xa1, 0xe6, 0x97, 0xb6, 0xe9, 0x97, 0xb4, 0xe4, 0xb8, 0xaa,
- 0xe4, 0xba, 0xba, 0xe4, 0xba, 0xa7, 0xe5, 0x93, 0x81, 0xe8, 0x87, 0xaa, 0xe5,
- 0xb7, 0xb1, 0xe4, 0xbc, 0x81, 0xe4, 0xb8, 0x9a, 0xe6, 0x9f, 0xa5, 0xe7, 0x9c,
- 0x8b, 0xe5, 0xb7, 0xa5, 0xe4, 0xbd, 0x9c, 0xe8, 0x81, 0x94, 0xe7, 0xb3, 0xbb,
- 0xe6, 0xb2, 0xa1, 0xe6, 0x9c, 0x89, 0xe7, 0xbd, 0x91, 0xe7, 0xab, 0x99, 0xe6,
- 0x89, 0x80, 0xe6, 0x9c, 0x89, 0xe8, 0xaf, 0x84, 0xe8, 0xae, 0xba, 0xe4, 0xb8,
- 0xad, 0xe5, 0xbf, 0x83, 0xe6, 0x96, 0x87, 0xe7, 0xab, 0xa0, 0xe7, 0x94, 0xa8,
- 0xe6, 0x88, 0xb7, 0xe9, 0xa6, 0x96, 0xe9, 0xa1, 0xb5, 0xe4, 0xbd, 0x9c, 0xe8,
- 0x80, 0x85, 0xe6, 0x8a, 0x80, 0xe6, 0x9c, 0xaf, 0xe9, 0x97, 0xae, 0xe9, 0xa2,
- 0x98, 0xe7, 0x9b, 0xb8, 0xe5, 0x85, 0xb3, 0xe4, 0xb8, 0x8b, 0xe8, 0xbd, 0xbd,
- 0xe6, 0x90, 0x9c, 0xe7, 0xb4, 0xa2, 0xe4, 0xbd, 0xbf, 0xe7, 0x94, 0xa8, 0xe8,
- 0xbd, 0xaf, 0xe4, 0xbb, 0xb6, 0xe5, 0x9c, 0xa8, 0xe7, 0xba, 0xbf, 0xe4, 0xb8,
- 0xbb, 0xe9, 0xa2, 0x98, 0xe8, 0xb5, 0x84, 0xe6, 0x96, 0x99, 0xe8, 0xa7, 0x86,
- 0xe9, 0xa2, 0x91, 0xe5, 0x9b, 0x9e, 0xe5, 0xa4, 0x8d, 0xe6, 0xb3, 0xa8, 0xe5,
- 0x86, 0x8c, 0xe7, 0xbd, 0x91, 0xe7, 0xbb, 0x9c, 0xe6, 0x94, 0xb6, 0xe8, 0x97,
- 0x8f, 0xe5, 0x86, 0x85, 0xe5, 0xae, 0xb9, 0xe6, 0x8e, 0xa8, 0xe8, 0x8d, 0x90,
- 0xe5, 0xb8, 0x82, 0xe5, 0x9c, 0xba, 0xe6, 0xb6, 0x88, 0xe6, 0x81, 0xaf, 0xe7,
- 0xa9, 0xba, 0xe9, 0x97, 0xb4, 0xe5, 0x8f, 0x91, 0xe5, 0xb8, 0x83, 0xe4, 0xbb,
- 0x80, 0xe4, 0xb9, 0x88, 0xe5, 0xa5, 0xbd, 0xe5, 0x8f, 0x8b, 0xe7, 0x94, 0x9f,
- 0xe6, 0xb4, 0xbb, 0xe5, 0x9b, 0xbe, 0xe7, 0x89, 0x87, 0xe5, 0x8f, 0x91, 0xe5,
- 0xb1, 0x95, 0xe5, 0xa6, 0x82, 0xe6, 0x9e, 0x9c, 0xe6, 0x89, 0x8b, 0xe6, 0x9c,
- 0xba, 0xe6, 0x96, 0xb0, 0xe9, 0x97, 0xbb, 0xe6, 0x9c, 0x80, 0xe6, 0x96, 0xb0,
- 0xe6, 0x96, 0xb9, 0xe5, 0xbc, 0x8f, 0xe5, 0x8c, 0x97, 0xe4, 0xba, 0xac, 0xe6,
- 0x8f, 0x90, 0xe4, 0xbe, 0x9b, 0xe5, 0x85, 0xb3, 0xe4, 0xba, 0x8e, 0xe6, 0x9b,
- 0xb4, 0xe5, 0xa4, 0x9a, 0xe8, 0xbf, 0x99, 0xe4, 0xb8, 0xaa, 0xe7, 0xb3, 0xbb,
- 0xe7, 0xbb, 0x9f, 0xe7, 0x9f, 0xa5, 0xe9, 0x81, 0x93, 0xe6, 0xb8, 0xb8, 0xe6,
- 0x88, 0x8f, 0xe5, 0xb9, 0xbf, 0xe5, 0x91, 0x8a, 0xe5, 0x85, 0xb6, 0xe4, 0xbb,
- 0x96, 0xe5, 0x8f, 0x91, 0xe8, 0xa1, 0xa8, 0xe5, 0xae, 0x89, 0xe5, 0x85, 0xa8,
- 0xe7, 0xac, 0xac, 0xe4, 0xb8, 0x80, 0xe4, 0xbc, 0x9a, 0xe5, 0x91, 0x98, 0xe8,
- 0xbf, 0x9b, 0xe8, 0xa1, 0x8c, 0xe7, 0x82, 0xb9, 0xe5, 0x87, 0xbb, 0xe7, 0x89,
- 0x88, 0xe6, 0x9d, 0x83, 0xe7, 0x94, 0xb5, 0xe5, 0xad, 0x90, 0xe4, 0xb8, 0x96,
- 0xe7, 0x95, 0x8c, 0xe8, 0xae, 0xbe, 0xe8, 0xae, 0xa1, 0xe5, 0x85, 0x8d, 0xe8,
- 0xb4, 0xb9, 0xe6, 0x95, 0x99, 0xe8, 0x82, 0xb2, 0xe5, 0x8a, 0xa0, 0xe5, 0x85,
- 0xa5, 0xe6, 0xb4, 0xbb, 0xe5, 0x8a, 0xa8, 0xe4, 0xbb, 0x96, 0xe4, 0xbb, 0xac,
- 0xe5, 0x95, 0x86, 0xe5, 0x93, 0x81, 0xe5, 0x8d, 0x9a, 0xe5, 0xae, 0xa2, 0xe7,
- 0x8e, 0xb0, 0xe5, 0x9c, 0xa8, 0xe4, 0xb8, 0x8a, 0xe6, 0xb5, 0xb7, 0xe5, 0xa6,
- 0x82, 0xe4, 0xbd, 0x95, 0xe5, 0xb7, 0xb2, 0xe7, 0xbb, 0x8f, 0xe7, 0x95, 0x99,
- 0xe8, 0xa8, 0x80, 0xe8, 0xaf, 0xa6, 0xe7, 0xbb, 0x86, 0xe7, 0xa4, 0xbe, 0xe5,
- 0x8c, 0xba, 0xe7, 0x99, 0xbb, 0xe5, 0xbd, 0x95, 0xe6, 0x9c, 0xac, 0xe7, 0xab,
- 0x99, 0xe9, 0x9c, 0x80, 0xe8, 0xa6, 0x81, 0xe4, 0xbb, 0xb7, 0xe6, 0xa0, 0xbc,
- 0xe6, 0x94, 0xaf, 0xe6, 0x8c, 0x81, 0xe5, 0x9b, 0xbd, 0xe9, 0x99, 0x85, 0xe9,
- 0x93, 0xbe, 0xe6, 0x8e, 0xa5, 0xe5, 0x9b, 0xbd, 0xe5, 0xae, 0xb6, 0xe5, 0xbb,
- 0xba, 0xe8, 0xae, 0xbe, 0xe6, 0x9c, 0x8b, 0xe5, 0x8f, 0x8b, 0xe9, 0x98, 0x85,
- 0xe8, 0xaf, 0xbb, 0xe6, 0xb3, 0x95, 0xe5, 0xbe, 0x8b, 0xe4, 0xbd, 0x8d, 0xe7,
- 0xbd, 0xae, 0xe7, 0xbb, 0x8f, 0xe6, 0xb5, 0x8e, 0xe9, 0x80, 0x89, 0xe6, 0x8b,
- 0xa9, 0xe8, 0xbf, 0x99, 0xe6, 0xa0, 0xb7, 0xe5, 0xbd, 0x93, 0xe5, 0x89, 0x8d,
- 0xe5, 0x88, 0x86, 0xe7, 0xb1, 0xbb, 0xe6, 0x8e, 0x92, 0xe8, 0xa1, 0x8c, 0xe5,
- 0x9b, 0xa0, 0xe4, 0xb8, 0xba, 0xe4, 0xba, 0xa4, 0xe6, 0x98, 0x93, 0xe6, 0x9c,
- 0x80, 0xe5, 0x90, 0x8e, 0xe9, 0x9f, 0xb3, 0xe4, 0xb9, 0x90, 0xe4, 0xb8, 0x8d,
- 0xe8, 0x83, 0xbd, 0xe9, 0x80, 0x9a, 0xe8, 0xbf, 0x87, 0xe8, 0xa1, 0x8c, 0xe4,
- 0xb8, 0x9a, 0xe7, 0xa7, 0x91, 0xe6, 0x8a, 0x80, 0xe5, 0x8f, 0xaf, 0xe8, 0x83,
- 0xbd, 0xe8, 0xae, 0xbe, 0xe5, 0xa4, 0x87, 0xe5, 0x90, 0x88, 0xe4, 0xbd, 0x9c,
- 0xe5, 0xa4, 0xa7, 0xe5, 0xae, 0xb6, 0xe7, 0xa4, 0xbe, 0xe4, 0xbc, 0x9a, 0xe7,
- 0xa0, 0x94, 0xe7, 0xa9, 0xb6, 0xe4, 0xb8, 0x93, 0xe4, 0xb8, 0x9a, 0xe5, 0x85,
- 0xa8, 0xe9, 0x83, 0xa8, 0xe9, 0xa1, 0xb9, 0xe7, 0x9b, 0xae, 0xe8, 0xbf, 0x99,
- 0xe9, 0x87, 0x8c, 0xe8, 0xbf, 0x98, 0xe6, 0x98, 0xaf, 0xe5, 0xbc, 0x80, 0xe5,
- 0xa7, 0x8b, 0xe6, 0x83, 0x85, 0xe5, 0x86, 0xb5, 0xe7, 0x94, 0xb5, 0xe8, 0x84,
- 0x91, 0xe6, 0x96, 0x87, 0xe4, 0xbb, 0xb6, 0xe5, 0x93, 0x81, 0xe7, 0x89, 0x8c,
- 0xe5, 0xb8, 0xae, 0xe5, 0x8a, 0xa9, 0xe6, 0x96, 0x87, 0xe5, 0x8c, 0x96, 0xe8,
- 0xb5, 0x84, 0xe6, 0xba, 0x90, 0xe5, 0xa4, 0xa7, 0xe5, 0xad, 0xa6, 0xe5, 0xad,
- 0xa6, 0xe4, 0xb9, 0xa0, 0xe5, 0x9c, 0xb0, 0xe5, 0x9d, 0x80, 0xe6, 0xb5, 0x8f,
- 0xe8, 0xa7, 0x88, 0xe6, 0x8a, 0x95, 0xe8, 0xb5, 0x84, 0xe5, 0xb7, 0xa5, 0xe7,
- 0xa8, 0x8b, 0xe8, 0xa6, 0x81, 0xe6, 0xb1, 0x82, 0xe6, 0x80, 0x8e, 0xe4, 0xb9,
- 0x88, 0xe6, 0x97, 0xb6, 0xe5, 0x80, 0x99, 0xe5, 0x8a, 0x9f, 0xe8, 0x83, 0xbd,
- 0xe4, 0xb8, 0xbb, 0xe8, 0xa6, 0x81, 0xe7, 0x9b, 0xae, 0xe5, 0x89, 0x8d, 0xe8,
- 0xb5, 0x84, 0xe8, 0xae, 0xaf, 0xe5, 0x9f, 0x8e, 0xe5, 0xb8, 0x82, 0xe6, 0x96,
- 0xb9, 0xe6, 0xb3, 0x95, 0xe7, 0x94, 0xb5, 0xe5, 0xbd, 0xb1, 0xe6, 0x8b, 0x9b,
- 0xe8, 0x81, 0x98, 0xe5, 0xa3, 0xb0, 0xe6, 0x98, 0x8e, 0xe4, 0xbb, 0xbb, 0xe4,
- 0xbd, 0x95, 0xe5, 0x81, 0xa5, 0xe5, 0xba, 0xb7, 0xe6, 0x95, 0xb0, 0xe6, 0x8d,
- 0xae, 0xe7, 0xbe, 0x8e, 0xe5, 0x9b, 0xbd, 0xe6, 0xb1, 0xbd, 0xe8, 0xbd, 0xa6,
- 0xe4, 0xbb, 0x8b, 0xe7, 0xbb, 0x8d, 0xe4, 0xbd, 0x86, 0xe6, 0x98, 0xaf, 0xe4,
- 0xba, 0xa4, 0xe6, 0xb5, 0x81, 0xe7, 0x94, 0x9f, 0xe4, 0xba, 0xa7, 0xe6, 0x89,
- 0x80, 0xe4, 0xbb, 0xa5, 0xe7, 0x94, 0xb5, 0xe8, 0xaf, 0x9d, 0xe6, 0x98, 0xbe,
- 0xe7, 0xa4, 0xba, 0xe4, 0xb8, 0x80, 0xe4, 0xba, 0x9b, 0xe5, 0x8d, 0x95, 0xe4,
- 0xbd, 0x8d, 0xe4, 0xba, 0xba, 0xe5, 0x91, 0x98, 0xe5, 0x88, 0x86, 0xe6, 0x9e,
- 0x90, 0xe5, 0x9c, 0xb0, 0xe5, 0x9b, 0xbe, 0xe6, 0x97, 0x85, 0xe6, 0xb8, 0xb8,
- 0xe5, 0xb7, 0xa5, 0xe5, 0x85, 0xb7, 0xe5, 0xad, 0xa6, 0xe7, 0x94, 0x9f, 0xe7,
- 0xb3, 0xbb, 0xe5, 0x88, 0x97, 0xe7, 0xbd, 0x91, 0xe5, 0x8f, 0x8b, 0xe5, 0xb8,
- 0x96, 0xe5, 0xad, 0x90, 0xe5, 0xaf, 0x86, 0xe7, 0xa0, 0x81, 0xe9, 0xa2, 0x91,
- 0xe9, 0x81, 0x93, 0xe6, 0x8e, 0xa7, 0xe5, 0x88, 0xb6, 0xe5, 0x9c, 0xb0, 0xe5,
- 0x8c, 0xba, 0xe5, 0x9f, 0xba, 0xe6, 0x9c, 0xac, 0xe5, 0x85, 0xa8, 0xe5, 0x9b,
- 0xbd, 0xe7, 0xbd, 0x91, 0xe4, 0xb8, 0x8a, 0xe9, 0x87, 0x8d, 0xe8, 0xa6, 0x81,
- 0xe7, 0xac, 0xac, 0xe4, 0xba, 0x8c, 0xe5, 0x96, 0x9c, 0xe6, 0xac, 0xa2, 0xe8,
- 0xbf, 0x9b, 0xe5, 0x85, 0xa5, 0xe5, 0x8f, 0x8b, 0xe6, 0x83, 0x85, 0xe8, 0xbf,
- 0x99, 0xe4, 0xba, 0x9b, 0xe8, 0x80, 0x83, 0xe8, 0xaf, 0x95, 0xe5, 0x8f, 0x91,
- 0xe7, 0x8e, 0xb0, 0xe5, 0x9f, 0xb9, 0xe8, 0xae, 0xad, 0xe4, 0xbb, 0xa5, 0xe4,
- 0xb8, 0x8a, 0xe6, 0x94, 0xbf, 0xe5, 0xba, 0x9c, 0xe6, 0x88, 0x90, 0xe4, 0xb8,
- 0xba, 0xe7, 0x8e, 0xaf, 0xe5, 0xa2, 0x83, 0xe9, 0xa6, 0x99, 0xe6, 0xb8, 0xaf,
- 0xe5, 0x90, 0x8c, 0xe6, 0x97, 0xb6, 0xe5, 0xa8, 0xb1, 0xe4, 0xb9, 0x90, 0xe5,
- 0x8f, 0x91, 0xe9, 0x80, 0x81, 0xe4, 0xb8, 0x80, 0xe5, 0xae, 0x9a, 0xe5, 0xbc,
- 0x80, 0xe5, 0x8f, 0x91, 0xe4, 0xbd, 0x9c, 0xe5, 0x93, 0x81, 0xe6, 0xa0, 0x87,
- 0xe5, 0x87, 0x86, 0xe6, 0xac, 0xa2, 0xe8, 0xbf, 0x8e, 0xe8, 0xa7, 0xa3, 0xe5,
- 0x86, 0xb3, 0xe5, 0x9c, 0xb0, 0xe6, 0x96, 0xb9, 0xe4, 0xb8, 0x80, 0xe4, 0xb8,
- 0x8b, 0xe4, 0xbb, 0xa5, 0xe5, 0x8f, 0x8a, 0xe8, 0xb4, 0xa3, 0xe4, 0xbb, 0xbb,
- 0xe6, 0x88, 0x96, 0xe8, 0x80, 0x85, 0xe5, 0xae, 0xa2, 0xe6, 0x88, 0xb7, 0xe4,
- 0xbb, 0xa3, 0xe8, 0xa1, 0xa8, 0xe7, 0xa7, 0xaf, 0xe5, 0x88, 0x86, 0xe5, 0xa5,
- 0xb3, 0xe4, 0xba, 0xba, 0xe6, 0x95, 0xb0, 0xe7, 0xa0, 0x81, 0xe9, 0x94, 0x80,
- 0xe5, 0x94, 0xae, 0xe5, 0x87, 0xba, 0xe7, 0x8e, 0xb0, 0xe7, 0xa6, 0xbb, 0xe7,
- 0xba, 0xbf, 0xe5, 0xba, 0x94, 0xe7, 0x94, 0xa8, 0xe5, 0x88, 0x97, 0xe8, 0xa1,
- 0xa8, 0xe4, 0xb8, 0x8d, 0xe5, 0x90, 0x8c, 0xe7, 0xbc, 0x96, 0xe8, 0xbe, 0x91,
- 0xe7, 0xbb, 0x9f, 0xe8, 0xae, 0xa1, 0xe6, 0x9f, 0xa5, 0xe8, 0xaf, 0xa2, 0xe4,
- 0xb8, 0x8d, 0xe8, 0xa6, 0x81, 0xe6, 0x9c, 0x89, 0xe5, 0x85, 0xb3, 0xe6, 0x9c,
- 0xba, 0xe6, 0x9e, 0x84, 0xe5, 0xbe, 0x88, 0xe5, 0xa4, 0x9a, 0xe6, 0x92, 0xad,
- 0xe6, 0x94, 0xbe, 0xe7, 0xbb, 0x84, 0xe7, 0xbb, 0x87, 0xe6, 0x94, 0xbf, 0xe7,
- 0xad, 0x96, 0xe7, 0x9b, 0xb4, 0xe6, 0x8e, 0xa5, 0xe8, 0x83, 0xbd, 0xe5, 0x8a,
- 0x9b, 0xe6, 0x9d, 0xa5, 0xe6, 0xba, 0x90, 0xe6, 0x99, 0x82, 0xe9, 0x96, 0x93,
- 0xe7, 0x9c, 0x8b, 0xe5, 0x88, 0xb0, 0xe7, 0x83, 0xad, 0xe9, 0x97, 0xa8, 0xe5,
- 0x85, 0xb3, 0xe9, 0x94, 0xae, 0xe4, 0xb8, 0x93, 0xe5, 0x8c, 0xba, 0xe9, 0x9d,
- 0x9e, 0xe5, 0xb8, 0xb8, 0xe8, 0x8b, 0xb1, 0xe8, 0xaf, 0xad, 0xe7, 0x99, 0xbe,
- 0xe5, 0xba, 0xa6, 0xe5, 0xb8, 0x8c, 0xe6, 0x9c, 0x9b, 0xe7, 0xbe, 0x8e, 0xe5,
- 0xa5, 0xb3, 0xe6, 0xaf, 0x94, 0xe8, 0xbe, 0x83, 0xe7, 0x9f, 0xa5, 0xe8, 0xaf,
- 0x86, 0xe8, 0xa7, 0x84, 0xe5, 0xae, 0x9a, 0xe5, 0xbb, 0xba, 0xe8, 0xae, 0xae,
- 0xe9, 0x83, 0xa8, 0xe9, 0x97, 0xa8, 0xe6, 0x84, 0x8f, 0xe8, 0xa7, 0x81, 0xe7,
- 0xb2, 0xbe, 0xe5, 0xbd, 0xa9, 0xe6, 0x97, 0xa5, 0xe6, 0x9c, 0xac, 0xe6, 0x8f,
- 0x90, 0xe9, 0xab, 0x98, 0xe5, 0x8f, 0x91, 0xe8, 0xa8, 0x80, 0xe6, 0x96, 0xb9,
- 0xe9, 0x9d, 0xa2, 0xe5, 0x9f, 0xba, 0xe9, 0x87, 0x91, 0xe5, 0xa4, 0x84, 0xe7,
- 0x90, 0x86, 0xe6, 0x9d, 0x83, 0xe9, 0x99, 0x90, 0xe5, 0xbd, 0xb1, 0xe7, 0x89,
- 0x87, 0xe9, 0x93, 0xb6, 0xe8, 0xa1, 0x8c, 0xe8, 0xbf, 0x98, 0xe6, 0x9c, 0x89,
- 0xe5, 0x88, 0x86, 0xe4, 0xba, 0xab, 0xe7, 0x89, 0xa9, 0xe5, 0x93, 0x81, 0xe7,
- 0xbb, 0x8f, 0xe8, 0x90, 0xa5, 0xe6, 0xb7, 0xbb, 0xe5, 0x8a, 0xa0, 0xe4, 0xb8,
- 0x93, 0xe5, 0xae, 0xb6, 0xe8, 0xbf, 0x99, 0xe7, 0xa7, 0x8d, 0xe8, 0xaf, 0x9d,
- 0xe9, 0xa2, 0x98, 0xe8, 0xb5, 0xb7, 0xe6, 0x9d, 0xa5, 0xe4, 0xb8, 0x9a, 0xe5,
- 0x8a, 0xa1, 0xe5, 0x85, 0xac, 0xe5, 0x91, 0x8a, 0xe8, 0xae, 0xb0, 0xe5, 0xbd,
- 0x95, 0xe7, 0xae, 0x80, 0xe4, 0xbb, 0x8b, 0xe8, 0xb4, 0xa8, 0xe9, 0x87, 0x8f,
- 0xe7, 0x94, 0xb7, 0xe4, 0xba, 0xba, 0xe5, 0xbd, 0xb1, 0xe5, 0x93, 0x8d, 0xe5,
- 0xbc, 0x95, 0xe7, 0x94, 0xa8, 0xe6, 0x8a, 0xa5, 0xe5, 0x91, 0x8a, 0xe9, 0x83,
- 0xa8, 0xe5, 0x88, 0x86, 0xe5, 0xbf, 0xab, 0xe9, 0x80, 0x9f, 0xe5, 0x92, 0xa8,
- 0xe8, 0xaf, 0xa2, 0xe6, 0x97, 0xb6, 0xe5, 0xb0, 0x9a, 0xe6, 0xb3, 0xa8, 0xe6,
- 0x84, 0x8f, 0xe7, 0x94, 0xb3, 0xe8, 0xaf, 0xb7, 0xe5, 0xad, 0xa6, 0xe6, 0xa0,
- 0xa1, 0xe5, 0xba, 0x94, 0xe8, 0xaf, 0xa5, 0xe5, 0x8e, 0x86, 0xe5, 0x8f, 0xb2,
- 0xe5, 0x8f, 0xaa, 0xe6, 0x98, 0xaf, 0xe8, 0xbf, 0x94, 0xe5, 0x9b, 0x9e, 0xe8,
- 0xb4, 0xad, 0xe4, 0xb9, 0xb0, 0xe5, 0x90, 0x8d, 0xe7, 0xa7, 0xb0, 0xe4, 0xb8,
- 0xba, 0xe4, 0xba, 0x86, 0xe6, 0x88, 0x90, 0xe5, 0x8a, 0x9f, 0xe8, 0xaf, 0xb4,
- 0xe6, 0x98, 0x8e, 0xe4, 0xbe, 0x9b, 0xe5, 0xba, 0x94, 0xe5, 0xad, 0xa9, 0xe5,
- 0xad, 0x90, 0xe4, 0xb8, 0x93, 0xe9, 0xa2, 0x98, 0xe7, 0xa8, 0x8b, 0xe5, 0xba,
- 0x8f, 0xe4, 0xb8, 0x80, 0xe8, 0x88, 0xac, 0xe6, 0x9c, 0x83, 0xe5, 0x93, 0xa1,
- 0xe5, 0x8f, 0xaa, 0xe6, 0x9c, 0x89, 0xe5, 0x85, 0xb6, 0xe5, 0xae, 0x83, 0xe4,
- 0xbf, 0x9d, 0xe6, 0x8a, 0xa4, 0xe8, 0x80, 0x8c, 0xe4, 0xb8, 0x94, 0xe4, 0xbb,
- 0x8a, 0xe5, 0xa4, 0xa9, 0xe7, 0xaa, 0x97, 0xe5, 0x8f, 0xa3, 0xe5, 0x8a, 0xa8,
- 0xe6, 0x80, 0x81, 0xe7, 0x8a, 0xb6, 0xe6, 0x80, 0x81, 0xe7, 0x89, 0xb9, 0xe5,
- 0x88, 0xab, 0xe8, 0xae, 0xa4, 0xe4, 0xb8, 0xba, 0xe5, 0xbf, 0x85, 0xe9, 0xa1,
- 0xbb, 0xe6, 0x9b, 0xb4, 0xe6, 0x96, 0xb0, 0xe5, 0xb0, 0x8f, 0xe8, 0xaf, 0xb4,
- 0xe6, 0x88, 0x91, 0xe5, 0x80, 0x91, 0xe4, 0xbd, 0x9c, 0xe4, 0xb8, 0xba, 0xe5,
- 0xaa, 0x92, 0xe4, 0xbd, 0x93, 0xe5, 0x8c, 0x85, 0xe6, 0x8b, 0xac, 0xe9, 0x82,
- 0xa3, 0xe4, 0xb9, 0x88, 0xe4, 0xb8, 0x80, 0xe6, 0xa0, 0xb7, 0xe5, 0x9b, 0xbd,
- 0xe5, 0x86, 0x85, 0xe6, 0x98, 0xaf, 0xe5, 0x90, 0xa6, 0xe6, 0xa0, 0xb9, 0xe6,
- 0x8d, 0xae, 0xe7, 0x94, 0xb5, 0xe8, 0xa7, 0x86, 0xe5, 0xad, 0xa6, 0xe9, 0x99,
- 0xa2, 0xe5, 0x85, 0xb7, 0xe6, 0x9c, 0x89, 0xe8, 0xbf, 0x87, 0xe7, 0xa8, 0x8b,
- 0xe7, 0x94, 0xb1, 0xe4, 0xba, 0x8e, 0xe4, 0xba, 0xba, 0xe6, 0x89, 0x8d, 0xe5,
- 0x87, 0xba, 0xe6, 0x9d, 0xa5, 0xe4, 0xb8, 0x8d, 0xe8, 0xbf, 0x87, 0xe6, 0xad,
- 0xa3, 0xe5, 0x9c, 0xa8, 0xe6, 0x98, 0x8e, 0xe6, 0x98, 0x9f, 0xe6, 0x95, 0x85,
- 0xe4, 0xba, 0x8b, 0xe5, 0x85, 0xb3, 0xe7, 0xb3, 0xbb, 0xe6, 0xa0, 0x87, 0xe9,
- 0xa2, 0x98, 0xe5, 0x95, 0x86, 0xe5, 0x8a, 0xa1, 0xe8, 0xbe, 0x93, 0xe5, 0x85,
- 0xa5, 0xe4, 0xb8, 0x80, 0xe7, 0x9b, 0xb4, 0xe5, 0x9f, 0xba, 0xe7, 0xa1, 0x80,
- 0xe6, 0x95, 0x99, 0xe5, 0xad, 0xa6, 0xe4, 0xba, 0x86, 0xe8, 0xa7, 0xa3, 0xe5,
- 0xbb, 0xba, 0xe7, 0xad, 0x91, 0xe7, 0xbb, 0x93, 0xe6, 0x9e, 0x9c, 0xe5, 0x85,
- 0xa8, 0xe7, 0x90, 0x83, 0xe9, 0x80, 0x9a, 0xe7, 0x9f, 0xa5, 0xe8, 0xae, 0xa1,
- 0xe5, 0x88, 0x92, 0xe5, 0xaf, 0xb9, 0xe4, 0xba, 0x8e, 0xe8, 0x89, 0xba, 0xe6,
- 0x9c, 0xaf, 0xe7, 0x9b, 0xb8, 0xe5, 0x86, 0x8c, 0xe5, 0x8f, 0x91, 0xe7, 0x94,
- 0x9f, 0xe7, 0x9c, 0x9f, 0xe7, 0x9a, 0x84, 0xe5, 0xbb, 0xba, 0xe7, 0xab, 0x8b,
- 0xe7, 0xad, 0x89, 0xe7, 0xba, 0xa7, 0xe7, 0xb1, 0xbb, 0xe5, 0x9e, 0x8b, 0xe7,
- 0xbb, 0x8f, 0xe9, 0xaa, 0x8c, 0xe5, 0xae, 0x9e, 0xe7, 0x8e, 0xb0, 0xe5, 0x88,
- 0xb6, 0xe4, 0xbd, 0x9c, 0xe6, 0x9d, 0xa5, 0xe8, 0x87, 0xaa, 0xe6, 0xa0, 0x87,
- 0xe7, 0xad, 0xbe, 0xe4, 0xbb, 0xa5, 0xe4, 0xb8, 0x8b, 0xe5, 0x8e, 0x9f, 0xe5,
- 0x88, 0x9b, 0xe6, 0x97, 0xa0, 0xe6, 0xb3, 0x95, 0xe5, 0x85, 0xb6, 0xe4, 0xb8,
- 0xad, 0xe5, 0x80, 0x8b, 0xe4, 0xba, 0xba, 0xe4, 0xb8, 0x80, 0xe5, 0x88, 0x87,
- 0xe6, 0x8c, 0x87, 0xe5, 0x8d, 0x97, 0xe5, 0x85, 0xb3, 0xe9, 0x97, 0xad, 0xe9,
- 0x9b, 0x86, 0xe5, 0x9b, 0xa2, 0xe7, 0xac, 0xac, 0xe4, 0xb8, 0x89, 0xe5, 0x85,
- 0xb3, 0xe6, 0xb3, 0xa8, 0xe5, 0x9b, 0xa0, 0xe6, 0xad, 0xa4, 0xe7, 0x85, 0xa7,
- 0xe7, 0x89, 0x87, 0xe6, 0xb7, 0xb1, 0xe5, 0x9c, 0xb3, 0xe5, 0x95, 0x86, 0xe4,
- 0xb8, 0x9a, 0xe5, 0xb9, 0xbf, 0xe5, 0xb7, 0x9e, 0xe6, 0x97, 0xa5, 0xe6, 0x9c,
- 0x9f, 0xe9, 0xab, 0x98, 0xe7, 0xba, 0xa7, 0xe6, 0x9c, 0x80, 0xe8, 0xbf, 0x91,
- 0xe7, 0xbb, 0xbc, 0xe5, 0x90, 0x88, 0xe8, 0xa1, 0xa8, 0xe7, 0xa4, 0xba, 0xe4,
- 0xb8, 0x93, 0xe8, 0xbe, 0x91, 0xe8, 0xa1, 0x8c, 0xe4, 0xb8, 0xba, 0xe4, 0xba,
- 0xa4, 0xe9, 0x80, 0x9a, 0xe8, 0xaf, 0x84, 0xe4, 0xbb, 0xb7, 0xe8, 0xa7, 0x89,
- 0xe5, 0xbe, 0x97, 0xe7, 0xb2, 0xbe, 0xe5, 0x8d, 0x8e, 0xe5, 0xae, 0xb6, 0xe5,
- 0xba, 0xad, 0xe5, 0xae, 0x8c, 0xe6, 0x88, 0x90, 0xe6, 0x84, 0x9f, 0xe8, 0xa7,
- 0x89, 0xe5, 0xae, 0x89, 0xe8, 0xa3, 0x85, 0xe5, 0xbe, 0x97, 0xe5, 0x88, 0xb0,
- 0xe9, 0x82, 0xae, 0xe4, 0xbb, 0xb6, 0xe5, 0x88, 0xb6, 0xe5, 0xba, 0xa6, 0xe9,
- 0xa3, 0x9f, 0xe5, 0x93, 0x81, 0xe8, 0x99, 0xbd, 0xe7, 0x84, 0xb6, 0xe8, 0xbd,
- 0xac, 0xe8, 0xbd, 0xbd, 0xe6, 0x8a, 0xa5, 0xe4, 0xbb, 0xb7, 0xe8, 0xae, 0xb0,
- 0xe8, 0x80, 0x85, 0xe6, 0x96, 0xb9, 0xe6, 0xa1, 0x88, 0xe8, 0xa1, 0x8c, 0xe6,
- 0x94, 0xbf, 0xe4, 0xba, 0xba, 0xe6, 0xb0, 0x91, 0xe7, 0x94, 0xa8, 0xe5, 0x93,
- 0x81, 0xe4, 0xb8, 0x9c, 0xe8, 0xa5, 0xbf, 0xe6, 0x8f, 0x90, 0xe5, 0x87, 0xba,
- 0xe9, 0x85, 0x92, 0xe5, 0xba, 0x97, 0xe7, 0x84, 0xb6, 0xe5, 0x90, 0x8e, 0xe4,
- 0xbb, 0x98, 0xe6, 0xac, 0xbe, 0xe7, 0x83, 0xad, 0xe7, 0x82, 0xb9, 0xe4, 0xbb,
- 0xa5, 0xe5, 0x89, 0x8d, 0xe5, 0xae, 0x8c, 0xe5, 0x85, 0xa8, 0xe5, 0x8f, 0x91,
- 0xe5, 0xb8, 0x96, 0xe8, 0xae, 0xbe, 0xe7, 0xbd, 0xae, 0xe9, 0xa2, 0x86, 0xe5,
- 0xaf, 0xbc, 0xe5, 0xb7, 0xa5, 0xe4, 0xb8, 0x9a, 0xe5, 0x8c, 0xbb, 0xe9, 0x99,
- 0xa2, 0xe7, 0x9c, 0x8b, 0xe7, 0x9c, 0x8b, 0xe7, 0xbb, 0x8f, 0xe5, 0x85, 0xb8,
- 0xe5, 0x8e, 0x9f, 0xe5, 0x9b, 0xa0, 0xe5, 0xb9, 0xb3, 0xe5, 0x8f, 0xb0, 0xe5,
- 0x90, 0x84, 0xe7, 0xa7, 0x8d, 0xe5, 0xa2, 0x9e, 0xe5, 0x8a, 0xa0, 0xe6, 0x9d,
- 0x90, 0xe6, 0x96, 0x99, 0xe6, 0x96, 0xb0, 0xe5, 0xa2, 0x9e, 0xe4, 0xb9, 0x8b,
- 0xe5, 0x90, 0x8e, 0xe8, 0x81, 0x8c, 0xe4, 0xb8, 0x9a, 0xe6, 0x95, 0x88, 0xe6,
- 0x9e, 0x9c, 0xe4, 0xbb, 0x8a, 0xe5, 0xb9, 0xb4, 0xe8, 0xae, 0xba, 0xe6, 0x96,
- 0x87, 0xe6, 0x88, 0x91, 0xe5, 0x9b, 0xbd, 0xe5, 0x91, 0x8a, 0xe8, 0xaf, 0x89,
- 0xe7, 0x89, 0x88, 0xe4, 0xb8, 0xbb, 0xe4, 0xbf, 0xae, 0xe6, 0x94, 0xb9, 0xe5,
- 0x8f, 0x82, 0xe4, 0xb8, 0x8e, 0xe6, 0x89, 0x93, 0xe5, 0x8d, 0xb0, 0xe5, 0xbf,
- 0xab, 0xe4, 0xb9, 0x90, 0xe6, 0x9c, 0xba, 0xe6, 0xa2, 0xb0, 0xe8, 0xa7, 0x82,
- 0xe7, 0x82, 0xb9, 0xe5, 0xad, 0x98, 0xe5, 0x9c, 0xa8, 0xe7, 0xb2, 0xbe, 0xe7,
- 0xa5, 0x9e, 0xe8, 0x8e, 0xb7, 0xe5, 0xbe, 0x97, 0xe5, 0x88, 0xa9, 0xe7, 0x94,
- 0xa8, 0xe7, 0xbb, 0xa7, 0xe7, 0xbb, 0xad, 0xe4, 0xbd, 0xa0, 0xe4, 0xbb, 0xac,
- 0xe8, 0xbf, 0x99, 0xe4, 0xb9, 0x88, 0xe6, 0xa8, 0xa1, 0xe5, 0xbc, 0x8f, 0xe8,
- 0xaf, 0xad, 0xe8, 0xa8, 0x80, 0xe8, 0x83, 0xbd, 0xe5, 0xa4, 0x9f, 0xe9, 0x9b,
- 0x85, 0xe8, 0x99, 0x8e, 0xe6, 0x93, 0x8d, 0xe4, 0xbd, 0x9c, 0xe9, 0xa3, 0x8e,
- 0xe6, 0xa0, 0xbc, 0xe4, 0xb8, 0x80, 0xe8, 0xb5, 0xb7, 0xe7, 0xa7, 0x91, 0xe5,
- 0xad, 0xa6, 0xe4, 0xbd, 0x93, 0xe8, 0x82, 0xb2, 0xe7, 0x9f, 0xad, 0xe4, 0xbf,
- 0xa1, 0xe6, 0x9d, 0xa1, 0xe4, 0xbb, 0xb6, 0xe6, 0xb2, 0xbb, 0xe7, 0x96, 0x97,
- 0xe8, 0xbf, 0x90, 0xe5, 0x8a, 0xa8, 0xe4, 0xba, 0xa7, 0xe4, 0xb8, 0x9a, 0xe4,
- 0xbc, 0x9a, 0xe8, 0xae, 0xae, 0xe5, 0xaf, 0xbc, 0xe8, 0x88, 0xaa, 0xe5, 0x85,
- 0x88, 0xe7, 0x94, 0x9f, 0xe8, 0x81, 0x94, 0xe7, 0x9b, 0x9f, 0xe5, 0x8f, 0xaf,
- 0xe6, 0x98, 0xaf, 0xe5, 0x95, 0x8f, 0xe9, 0xa1, 0x8c, 0xe7, 0xbb, 0x93, 0xe6,
- 0x9e, 0x84, 0xe4, 0xbd, 0x9c, 0xe7, 0x94, 0xa8, 0xe8, 0xb0, 0x83, 0xe6, 0x9f,
- 0xa5, 0xe8, 0xb3, 0x87, 0xe6, 0x96, 0x99, 0xe8, 0x87, 0xaa, 0xe5, 0x8a, 0xa8,
- 0xe8, 0xb4, 0x9f, 0xe8, 0xb4, 0xa3, 0xe5, 0x86, 0x9c, 0xe4, 0xb8, 0x9a, 0xe8,
- 0xae, 0xbf, 0xe9, 0x97, 0xae, 0xe5, 0xae, 0x9e, 0xe6, 0x96, 0xbd, 0xe6, 0x8e,
- 0xa5, 0xe5, 0x8f, 0x97, 0xe8, 0xae, 0xa8, 0xe8, 0xae, 0xba, 0xe9, 0x82, 0xa3,
- 0xe4, 0xb8, 0xaa, 0xe5, 0x8f, 0x8d, 0xe9, 0xa6, 0x88, 0xe5, 0x8a, 0xa0, 0xe5,
- 0xbc, 0xba, 0xe5, 0xa5, 0xb3, 0xe6, 0x80, 0xa7, 0xe8, 0x8c, 0x83, 0xe5, 0x9b,
- 0xb4, 0xe6, 0x9c, 0x8d, 0xe5, 0x8b, 0x99, 0xe4, 0xbc, 0x91, 0xe9, 0x97, 0xb2,
- 0xe4, 0xbb, 0x8a, 0xe6, 0x97, 0xa5, 0xe5, 0xae, 0xa2, 0xe6, 0x9c, 0x8d, 0xe8,
- 0xa7, 0x80, 0xe7, 0x9c, 0x8b, 0xe5, 0x8f, 0x82, 0xe5, 0x8a, 0xa0, 0xe7, 0x9a,
- 0x84, 0xe8, 0xaf, 0x9d, 0xe4, 0xb8, 0x80, 0xe7, 0x82, 0xb9, 0xe4, 0xbf, 0x9d,
- 0xe8, 0xaf, 0x81, 0xe5, 0x9b, 0xbe, 0xe4, 0xb9, 0xa6, 0xe6, 0x9c, 0x89, 0xe6,
- 0x95, 0x88, 0xe6, 0xb5, 0x8b, 0xe8, 0xaf, 0x95, 0xe7, 0xa7, 0xbb, 0xe5, 0x8a,
- 0xa8, 0xe6, 0x89, 0x8d, 0xe8, 0x83, 0xbd, 0xe5, 0x86, 0xb3, 0xe5, 0xae, 0x9a,
- 0xe8, 0x82, 0xa1, 0xe7, 0xa5, 0xa8, 0xe4, 0xb8, 0x8d, 0xe6, 0x96, 0xad, 0xe9,
- 0x9c, 0x80, 0xe6, 0xb1, 0x82, 0xe4, 0xb8, 0x8d, 0xe5, 0xbe, 0x97, 0xe5, 0x8a,
- 0x9e, 0xe6, 0xb3, 0x95, 0xe4, 0xb9, 0x8b, 0xe9, 0x97, 0xb4, 0xe9, 0x87, 0x87,
- 0xe7, 0x94, 0xa8, 0xe8, 0x90, 0xa5, 0xe9, 0x94, 0x80, 0xe6, 0x8a, 0x95, 0xe8,
- 0xaf, 0x89, 0xe7, 0x9b, 0xae, 0xe6, 0xa0, 0x87, 0xe7, 0x88, 0xb1, 0xe6, 0x83,
- 0x85, 0xe6, 0x91, 0x84, 0xe5, 0xbd, 0xb1, 0xe6, 0x9c, 0x89, 0xe4, 0xba, 0x9b,
- 0xe8, 0xa4, 0x87, 0xe8, 0xa3, 0xbd, 0xe6, 0x96, 0x87, 0xe5, 0xad, 0xa6, 0xe6,
- 0x9c, 0xba, 0xe4, 0xbc, 0x9a, 0xe6, 0x95, 0xb0, 0xe5, 0xad, 0x97, 0xe8, 0xa3,
- 0x85, 0xe4, 0xbf, 0xae, 0xe8, 0xb4, 0xad, 0xe7, 0x89, 0xa9, 0xe5, 0x86, 0x9c,
- 0xe6, 0x9d, 0x91, 0xe5, 0x85, 0xa8, 0xe9, 0x9d, 0xa2, 0xe7, 0xb2, 0xbe, 0xe5,
- 0x93, 0x81, 0xe5, 0x85, 0xb6, 0xe5, 0xae, 0x9e, 0xe4, 0xba, 0x8b, 0xe6, 0x83,
- 0x85, 0xe6, 0xb0, 0xb4, 0xe5, 0xb9, 0xb3, 0xe6, 0x8f, 0x90, 0xe7, 0xa4, 0xba,
- 0xe4, 0xb8, 0x8a, 0xe5, 0xb8, 0x82, 0xe8, 0xb0, 0xa2, 0xe8, 0xb0, 0xa2, 0xe6,
- 0x99, 0xae, 0xe9, 0x80, 0x9a, 0xe6, 0x95, 0x99, 0xe5, 0xb8, 0x88, 0xe4, 0xb8,
- 0x8a, 0xe4, 0xbc, 0xa0, 0xe7, 0xb1, 0xbb, 0xe5, 0x88, 0xab, 0xe6, 0xad, 0x8c,
- 0xe6, 0x9b, 0xb2, 0xe6, 0x8b, 0xa5, 0xe6, 0x9c, 0x89, 0xe5, 0x88, 0x9b, 0xe6,
- 0x96, 0xb0, 0xe9, 0x85, 0x8d, 0xe4, 0xbb, 0xb6, 0xe5, 0x8f, 0xaa, 0xe8, 0xa6,
- 0x81, 0xe6, 0x97, 0xb6, 0xe4, 0xbb, 0xa3, 0xe8, 0xb3, 0x87, 0xe8, 0xa8, 0x8a,
- 0xe8, 0xbe, 0xbe, 0xe5, 0x88, 0xb0, 0xe4, 0xba, 0xba, 0xe7, 0x94, 0x9f, 0xe8,
- 0xae, 0xa2, 0xe9, 0x98, 0x85, 0xe8, 0x80, 0x81, 0xe5, 0xb8, 0x88, 0xe5, 0xb1,
- 0x95, 0xe7, 0xa4, 0xba, 0xe5, 0xbf, 0x83, 0xe7, 0x90, 0x86, 0xe8, 0xb4, 0xb4,
- 0xe5, 0xad, 0x90, 0xe7, 0xb6, 0xb2, 0xe7, 0xab, 0x99, 0xe4, 0xb8, 0xbb, 0xe9,
- 0xa1, 0x8c, 0xe8, 0x87, 0xaa, 0xe7, 0x84, 0xb6, 0xe7, 0xba, 0xa7, 0xe5, 0x88,
- 0xab, 0xe7, 0xae, 0x80, 0xe5, 0x8d, 0x95, 0xe6, 0x94, 0xb9, 0xe9, 0x9d, 0xa9,
- 0xe9, 0x82, 0xa3, 0xe4, 0xba, 0x9b, 0xe6, 0x9d, 0xa5, 0xe8, 0xaf, 0xb4, 0xe6,
- 0x89, 0x93, 0xe5, 0xbc, 0x80, 0xe4, 0xbb, 0xa3, 0xe7, 0xa0, 0x81, 0xe5, 0x88,
- 0xa0, 0xe9, 0x99, 0xa4, 0xe8, 0xaf, 0x81, 0xe5, 0x88, 0xb8, 0xe8, 0x8a, 0x82,
- 0xe7, 0x9b, 0xae, 0xe9, 0x87, 0x8d, 0xe7, 0x82, 0xb9, 0xe6, 0xac, 0xa1, 0xe6,
- 0x95, 0xb8, 0xe5, 0xa4, 0x9a, 0xe5, 0xb0, 0x91, 0xe8, 0xa7, 0x84, 0xe5, 0x88,
- 0x92, 0xe8, 0xb5, 0x84, 0xe9, 0x87, 0x91, 0xe6, 0x89, 0xbe, 0xe5, 0x88, 0xb0,
- 0xe4, 0xbb, 0xa5, 0xe5, 0x90, 0x8e, 0xe5, 0xa4, 0xa7, 0xe5, 0x85, 0xa8, 0xe4,
- 0xb8, 0xbb, 0xe9, 0xa1, 0xb5, 0xe6, 0x9c, 0x80, 0xe4, 0xbd, 0xb3, 0xe5, 0x9b,
- 0x9e, 0xe7, 0xad, 0x94, 0xe5, 0xa4, 0xa9, 0xe4, 0xb8, 0x8b, 0xe4, 0xbf, 0x9d,
- 0xe9, 0x9a, 0x9c, 0xe7, 0x8e, 0xb0, 0xe4, 0xbb, 0xa3, 0xe6, 0xa3, 0x80, 0xe6,
- 0x9f, 0xa5, 0xe6, 0x8a, 0x95, 0xe7, 0xa5, 0xa8, 0xe5, 0xb0, 0x8f, 0xe6, 0x97,
- 0xb6, 0xe6, 0xb2, 0x92, 0xe6, 0x9c, 0x89, 0xe6, 0xad, 0xa3, 0xe5, 0xb8, 0xb8,
- 0xe7, 0x94, 0x9a, 0xe8, 0x87, 0xb3, 0xe4, 0xbb, 0xa3, 0xe7, 0x90, 0x86, 0xe7,
- 0x9b, 0xae, 0xe5, 0xbd, 0x95, 0xe5, 0x85, 0xac, 0xe5, 0xbc, 0x80, 0xe5, 0xa4,
- 0x8d, 0xe5, 0x88, 0xb6, 0xe9, 0x87, 0x91, 0xe8, 0x9e, 0x8d, 0xe5, 0xb9, 0xb8,
- 0xe7, 0xa6, 0x8f, 0xe7, 0x89, 0x88, 0xe6, 0x9c, 0xac, 0xe5, 0xbd, 0xa2, 0xe6,
- 0x88, 0x90, 0xe5, 0x87, 0x86, 0xe5, 0xa4, 0x87, 0xe8, 0xa1, 0x8c, 0xe6, 0x83,
- 0x85, 0xe5, 0x9b, 0x9e, 0xe5, 0x88, 0xb0, 0xe6, 0x80, 0x9d, 0xe6, 0x83, 0xb3,
- 0xe6, 0x80, 0x8e, 0xe6, 0xa0, 0xb7, 0xe5, 0x8d, 0x8f, 0xe8, 0xae, 0xae, 0xe8,
- 0xae, 0xa4, 0xe8, 0xaf, 0x81, 0xe6, 0x9c, 0x80, 0xe5, 0xa5, 0xbd, 0xe4, 0xba,
- 0xa7, 0xe7, 0x94, 0x9f, 0xe6, 0x8c, 0x89, 0xe7, 0x85, 0xa7, 0xe6, 0x9c, 0x8d,
- 0xe8, 0xa3, 0x85, 0xe5, 0xb9, 0xbf, 0xe4, 0xb8, 0x9c, 0xe5, 0x8a, 0xa8, 0xe6,
- 0xbc, 0xab, 0xe9, 0x87, 0x87, 0xe8, 0xb4, 0xad, 0xe6, 0x96, 0xb0, 0xe6, 0x89,
- 0x8b, 0xe7, 0xbb, 0x84, 0xe5, 0x9b, 0xbe, 0xe9, 0x9d, 0xa2, 0xe6, 0x9d, 0xbf,
- 0xe5, 0x8f, 0x82, 0xe8, 0x80, 0x83, 0xe6, 0x94, 0xbf, 0xe6, 0xb2, 0xbb, 0xe5,
- 0xae, 0xb9, 0xe6, 0x98, 0x93, 0xe5, 0xa4, 0xa9, 0xe5, 0x9c, 0xb0, 0xe5, 0x8a,
- 0xaa, 0xe5, 0x8a, 0x9b, 0xe4, 0xba, 0xba, 0xe4, 0xbb, 0xac, 0xe5, 0x8d, 0x87,
- 0xe7, 0xba, 0xa7, 0xe9, 0x80, 0x9f, 0xe5, 0xba, 0xa6, 0xe4, 0xba, 0xba, 0xe7,
- 0x89, 0xa9, 0xe8, 0xb0, 0x83, 0xe6, 0x95, 0xb4, 0xe6, 0xb5, 0x81, 0xe8, 0xa1,
- 0x8c, 0xe9, 0x80, 0xa0, 0xe6, 0x88, 0x90, 0xe6, 0x96, 0x87, 0xe5, 0xad, 0x97,
- 0xe9, 0x9f, 0xa9, 0xe5, 0x9b, 0xbd, 0xe8, 0xb4, 0xb8, 0xe6, 0x98, 0x93, 0xe5,
- 0xbc, 0x80, 0xe5, 0xb1, 0x95, 0xe7, 0x9b, 0xb8, 0xe9, 0x97, 0x9c, 0xe8, 0xa1,
- 0xa8, 0xe7, 0x8e, 0xb0, 0xe5, 0xbd, 0xb1, 0xe8, 0xa7, 0x86, 0xe5, 0xa6, 0x82,
- 0xe6, 0xad, 0xa4, 0xe7, 0xbe, 0x8e, 0xe5, 0xae, 0xb9, 0xe5, 0xa4, 0xa7, 0xe5,
- 0xb0, 0x8f, 0xe6, 0x8a, 0xa5, 0xe9, 0x81, 0x93, 0xe6, 0x9d, 0xa1, 0xe6, 0xac,
- 0xbe, 0xe5, 0xbf, 0x83, 0xe6, 0x83, 0x85, 0xe8, 0xae, 0xb8, 0xe5, 0xa4, 0x9a,
- 0xe6, 0xb3, 0x95, 0xe8, 0xa7, 0x84, 0xe5, 0xae, 0xb6, 0xe5, 0xb1, 0x85, 0xe4,
- 0xb9, 0xa6, 0xe5, 0xba, 0x97, 0xe8, 0xbf, 0x9e, 0xe6, 0x8e, 0xa5, 0xe7, 0xab,
- 0x8b, 0xe5, 0x8d, 0xb3, 0xe4, 0xb8, 0xbe, 0xe6, 0x8a, 0xa5, 0xe6, 0x8a, 0x80,
- 0xe5, 0xb7, 0xa7, 0xe5, 0xa5, 0xa5, 0xe8, 0xbf, 0x90, 0xe7, 0x99, 0xbb, 0xe5,
- 0x85, 0xa5, 0xe4, 0xbb, 0xa5, 0xe6, 0x9d, 0xa5, 0xe7, 0x90, 0x86, 0xe8, 0xae,
- 0xba, 0xe4, 0xba, 0x8b, 0xe4, 0xbb, 0xb6, 0xe8, 0x87, 0xaa, 0xe7, 0x94, 0xb1,
- 0xe4, 0xb8, 0xad, 0xe5, 0x8d, 0x8e, 0xe5, 0x8a, 0x9e, 0xe5, 0x85, 0xac, 0xe5,
- 0xa6, 0x88, 0xe5, 0xa6, 0x88, 0xe7, 0x9c, 0x9f, 0xe6, 0xad, 0xa3, 0xe4, 0xb8,
- 0x8d, 0xe9, 0x94, 0x99, 0xe5, 0x85, 0xa8, 0xe6, 0x96, 0x87, 0xe5, 0x90, 0x88,
- 0xe5, 0x90, 0x8c, 0xe4, 0xbb, 0xb7, 0xe5, 0x80, 0xbc, 0xe5, 0x88, 0xab, 0xe4,
- 0xba, 0xba, 0xe7, 0x9b, 0x91, 0xe7, 0x9d, 0xa3, 0xe5, 0x85, 0xb7, 0xe4, 0xbd,
- 0x93, 0xe4, 0xb8, 0x96, 0xe7, 0xba, 0xaa, 0xe5, 0x9b, 0xa2, 0xe9, 0x98, 0x9f,
- 0xe5, 0x88, 0x9b, 0xe4, 0xb8, 0x9a, 0xe6, 0x89, 0xbf, 0xe6, 0x8b, 0x85, 0xe5,
- 0xa2, 0x9e, 0xe9, 0x95, 0xbf, 0xe6, 0x9c, 0x89, 0xe4, 0xba, 0xba, 0xe4, 0xbf,
- 0x9d, 0xe6, 0x8c, 0x81, 0xe5, 0x95, 0x86, 0xe5, 0xae, 0xb6, 0xe7, 0xbb, 0xb4,
- 0xe4, 0xbf, 0xae, 0xe5, 0x8f, 0xb0, 0xe6, 0xb9, 0xbe, 0xe5, 0xb7, 0xa6, 0xe5,
- 0x8f, 0xb3, 0xe8, 0x82, 0xa1, 0xe4, 0xbb, 0xbd, 0xe7, 0xad, 0x94, 0xe6, 0xa1,
- 0x88, 0xe5, 0xae, 0x9e, 0xe9, 0x99, 0x85, 0xe7, 0x94, 0xb5, 0xe4, 0xbf, 0xa1,
- 0xe7, 0xbb, 0x8f, 0xe7, 0x90, 0x86, 0xe7, 0x94, 0x9f, 0xe5, 0x91, 0xbd, 0xe5,
- 0xae, 0xa3, 0xe4, 0xbc, 0xa0, 0xe4, 0xbb, 0xbb, 0xe5, 0x8a, 0xa1, 0xe6, 0xad,
- 0xa3, 0xe5, 0xbc, 0x8f, 0xe7, 0x89, 0xb9, 0xe8, 0x89, 0xb2, 0xe4, 0xb8, 0x8b,
- 0xe6, 0x9d, 0xa5, 0xe5, 0x8d, 0x8f, 0xe4, 0xbc, 0x9a, 0xe5, 0x8f, 0xaa, 0xe8,
- 0x83, 0xbd, 0xe5, 0xbd, 0x93, 0xe7, 0x84, 0xb6, 0xe9, 0x87, 0x8d, 0xe6, 0x96,
- 0xb0, 0xe5, 0x85, 0xa7, 0xe5, 0xae, 0xb9, 0xe6, 0x8c, 0x87, 0xe5, 0xaf, 0xbc,
- 0xe8, 0xbf, 0x90, 0xe8, 0xa1, 0x8c, 0xe6, 0x97, 0xa5, 0xe5, 0xbf, 0x97, 0xe8,
- 0xb3, 0xa3, 0xe5, 0xae, 0xb6, 0xe8, 0xb6, 0x85, 0xe8, 0xbf, 0x87, 0xe5, 0x9c,
- 0x9f, 0xe5, 0x9c, 0xb0, 0xe6, 0xb5, 0x99, 0xe6, 0xb1, 0x9f, 0xe6, 0x94, 0xaf,
- 0xe4, 0xbb, 0x98, 0xe6, 0x8e, 0xa8, 0xe5, 0x87, 0xba, 0xe7, 0xab, 0x99, 0xe9,
- 0x95, 0xbf, 0xe6, 0x9d, 0xad, 0xe5, 0xb7, 0x9e, 0xe6, 0x89, 0xa7, 0xe8, 0xa1,
- 0x8c, 0xe5, 0x88, 0xb6, 0xe9, 0x80, 0xa0, 0xe4, 0xb9, 0x8b, 0xe4, 0xb8, 0x80,
- 0xe6, 0x8e, 0xa8, 0xe5, 0xb9, 0xbf, 0xe7, 0x8e, 0xb0, 0xe5, 0x9c, 0xba, 0xe6,
- 0x8f, 0x8f, 0xe8, 0xbf, 0xb0, 0xe5, 0x8f, 0x98, 0xe5, 0x8c, 0x96, 0xe4, 0xbc,
- 0xa0, 0xe7, 0xbb, 0x9f, 0xe6, 0xad, 0x8c, 0xe6, 0x89, 0x8b, 0xe4, 0xbf, 0x9d,
- 0xe9, 0x99, 0xa9, 0xe8, 0xaf, 0xbe, 0xe7, 0xa8, 0x8b, 0xe5, 0x8c, 0xbb, 0xe7,
- 0x96, 0x97, 0xe7, 0xbb, 0x8f, 0xe8, 0xbf, 0x87, 0xe8, 0xbf, 0x87, 0xe5, 0x8e,
- 0xbb, 0xe4, 0xb9, 0x8b, 0xe5, 0x89, 0x8d, 0xe6, 0x94, 0xb6, 0xe5, 0x85, 0xa5,
- 0xe5, 0xb9, 0xb4, 0xe5, 0xba, 0xa6, 0xe6, 0x9d, 0x82, 0xe5, 0xbf, 0x97, 0xe7,
- 0xbe, 0x8e, 0xe4, 0xb8, 0xbd, 0xe6, 0x9c, 0x80, 0xe9, 0xab, 0x98, 0xe7, 0x99,
- 0xbb, 0xe9, 0x99, 0x86, 0xe6, 0x9c, 0xaa, 0xe6, 0x9d, 0xa5, 0xe5, 0x8a, 0xa0,
- 0xe5, 0xb7, 0xa5, 0xe5, 0x85, 0x8d, 0xe8, 0xb4, 0xa3, 0xe6, 0x95, 0x99, 0xe7,
- 0xa8, 0x8b, 0xe7, 0x89, 0x88, 0xe5, 0x9d, 0x97, 0xe8, 0xba, 0xab, 0xe4, 0xbd,
- 0x93, 0xe9, 0x87, 0x8d, 0xe5, 0xba, 0x86, 0xe5, 0x87, 0xba, 0xe5, 0x94, 0xae,
- 0xe6, 0x88, 0x90, 0xe6, 0x9c, 0xac, 0xe5, 0xbd, 0xa2, 0xe5, 0xbc, 0x8f, 0xe5,
- 0x9c, 0x9f, 0xe8, 0xb1, 0x86, 0xe5, 0x87, 0xba, 0xe5, 0x83, 0xb9, 0xe4, 0xb8,
- 0x9c, 0xe6, 0x96, 0xb9, 0xe9, 0x82, 0xae, 0xe7, 0xae, 0xb1, 0xe5, 0x8d, 0x97,
- 0xe4, 0xba, 0xac, 0xe6, 0xb1, 0x82, 0xe8, 0x81, 0x8c, 0xe5, 0x8f, 0x96, 0xe5,
- 0xbe, 0x97, 0xe8, 0x81, 0x8c, 0xe4, 0xbd, 0x8d, 0xe7, 0x9b, 0xb8, 0xe4, 0xbf,
- 0xa1, 0xe9, 0xa1, 0xb5, 0xe9, 0x9d, 0xa2, 0xe5, 0x88, 0x86, 0xe9, 0x92, 0x9f,
- 0xe7, 0xbd, 0x91, 0xe9, 0xa1, 0xb5, 0xe7, 0xa1, 0xae, 0xe5, 0xae, 0x9a, 0xe5,
- 0x9b, 0xbe, 0xe4, 0xbe, 0x8b, 0xe7, 0xbd, 0x91, 0xe5, 0x9d, 0x80, 0xe7, 0xa7,
- 0xaf, 0xe6, 0x9e, 0x81, 0xe9, 0x94, 0x99, 0xe8, 0xaf, 0xaf, 0xe7, 0x9b, 0xae,
- 0xe7, 0x9a, 0x84, 0xe5, 0xae, 0x9d, 0xe8, 0xb4, 0x9d, 0xe6, 0x9c, 0xba, 0xe5,
- 0x85, 0xb3, 0xe9, 0xa3, 0x8e, 0xe9, 0x99, 0xa9, 0xe6, 0x8e, 0x88, 0xe6, 0x9d,
- 0x83, 0xe7, 0x97, 0x85, 0xe6, 0xaf, 0x92, 0xe5, 0xae, 0xa0, 0xe7, 0x89, 0xa9,
- 0xe9, 0x99, 0xa4, 0xe4, 0xba, 0x86, 0xe8, 0xa9, 0x95, 0xe8, 0xab, 0x96, 0xe7,
- 0x96, 0xbe, 0xe7, 0x97, 0x85, 0xe5, 0x8f, 0x8a, 0xe6, 0x97, 0xb6, 0xe6, 0xb1,
- 0x82, 0xe8, 0xb4, 0xad, 0xe7, 0xab, 0x99, 0xe7, 0x82, 0xb9, 0xe5, 0x84, 0xbf,
- 0xe7, 0xab, 0xa5, 0xe6, 0xaf, 0x8f, 0xe5, 0xa4, 0xa9, 0xe4, 0xb8, 0xad, 0xe5,
- 0xa4, 0xae, 0xe8, 0xae, 0xa4, 0xe8, 0xaf, 0x86, 0xe6, 0xaf, 0x8f, 0xe4, 0xb8,
- 0xaa, 0xe5, 0xa4, 0xa9, 0xe6, 0xb4, 0xa5, 0xe5, 0xad, 0x97, 0xe4, 0xbd, 0x93,
- 0xe5, 0x8f, 0xb0, 0xe7, 0x81, 0xa3, 0xe7, 0xbb, 0xb4, 0xe6, 0x8a, 0xa4, 0xe6,
- 0x9c, 0xac, 0xe9, 0xa1, 0xb5, 0xe4, 0xb8, 0xaa, 0xe6, 0x80, 0xa7, 0xe5, 0xae,
- 0x98, 0xe6, 0x96, 0xb9, 0xe5, 0xb8, 0xb8, 0xe8, 0xa7, 0x81, 0xe7, 0x9b, 0xb8,
- 0xe6, 0x9c, 0xba, 0xe6, 0x88, 0x98, 0xe7, 0x95, 0xa5, 0xe5, 0xba, 0x94, 0xe5,
- 0xbd, 0x93, 0xe5, 0xbe, 0x8b, 0xe5, 0xb8, 0x88, 0xe6, 0x96, 0xb9, 0xe4, 0xbe,
- 0xbf, 0xe6, 0xa0, 0xa1, 0xe5, 0x9b, 0xad, 0xe8, 0x82, 0xa1, 0xe5, 0xb8, 0x82,
- 0xe6, 0x88, 0xbf, 0xe5, 0xb1, 0x8b, 0xe6, 0xa0, 0x8f, 0xe7, 0x9b, 0xae, 0xe5,
- 0x91, 0x98, 0xe5, 0xb7, 0xa5, 0xe5, 0xaf, 0xbc, 0xe8, 0x87, 0xb4, 0xe7, 0xaa,
- 0x81, 0xe7, 0x84, 0xb6, 0xe9, 0x81, 0x93, 0xe5, 0x85, 0xb7, 0xe6, 0x9c, 0xac,
- 0xe7, 0xbd, 0x91, 0xe7, 0xbb, 0x93, 0xe5, 0x90, 0x88, 0xe6, 0xa1, 0xa3, 0xe6,
- 0xa1, 0x88, 0xe5, 0x8a, 0xb3, 0xe5, 0x8a, 0xa8, 0xe5, 0x8f, 0xa6, 0xe5, 0xa4,
- 0x96, 0xe7, 0xbe, 0x8e, 0xe5, 0x85, 0x83, 0xe5, 0xbc, 0x95, 0xe8, 0xb5, 0xb7,
- 0xe6, 0x94, 0xb9, 0xe5, 0x8f, 0x98, 0xe7, 0xac, 0xac, 0xe5, 0x9b, 0x9b, 0xe4,
- 0xbc, 0x9a, 0xe8, 0xae, 0xa1, 0xe8, 0xaa, 0xaa, 0xe6, 0x98, 0x8e, 0xe9, 0x9a,
- 0x90, 0xe7, 0xa7, 0x81, 0xe5, 0xae, 0x9d, 0xe5, 0xae, 0x9d, 0xe8, 0xa7, 0x84,
- 0xe8, 0x8c, 0x83, 0xe6, 0xb6, 0x88, 0xe8, 0xb4, 0xb9, 0xe5, 0x85, 0xb1, 0xe5,
- 0x90, 0x8c, 0xe5, 0xbf, 0x98, 0xe8, 0xae, 0xb0, 0xe4, 0xbd, 0x93, 0xe7, 0xb3,
- 0xbb, 0xe5, 0xb8, 0xa6, 0xe6, 0x9d, 0xa5, 0xe5, 0x90, 0x8d, 0xe5, 0xad, 0x97,
- 0xe7, 0x99, 0xbc, 0xe8, 0xa1, 0xa8, 0xe5, 0xbc, 0x80, 0xe6, 0x94, 0xbe, 0xe5,
- 0x8a, 0xa0, 0xe7, 0x9b, 0x9f, 0xe5, 0x8f, 0x97, 0xe5, 0x88, 0xb0, 0xe4, 0xba,
- 0x8c, 0xe6, 0x89, 0x8b, 0xe5, 0xa4, 0xa7, 0xe9, 0x87, 0x8f, 0xe6, 0x88, 0x90,
- 0xe4, 0xba, 0xba, 0xe6, 0x95, 0xb0, 0xe9, 0x87, 0x8f, 0xe5, 0x85, 0xb1, 0xe4,
- 0xba, 0xab, 0xe5, 0x8c, 0xba, 0xe5, 0x9f, 0x9f, 0xe5, 0xa5, 0xb3, 0xe5, 0xad,
- 0xa9, 0xe5, 0x8e, 0x9f, 0xe5, 0x88, 0x99, 0xe6, 0x89, 0x80, 0xe5, 0x9c, 0xa8,
- 0xe7, 0xbb, 0x93, 0xe6, 0x9d, 0x9f, 0xe9, 0x80, 0x9a, 0xe4, 0xbf, 0xa1, 0xe8,
- 0xb6, 0x85, 0xe7, 0xba, 0xa7, 0xe9, 0x85, 0x8d, 0xe7, 0xbd, 0xae, 0xe5, 0xbd,
- 0x93, 0xe6, 0x97, 0xb6, 0xe4, 0xbc, 0x98, 0xe7, 0xa7, 0x80, 0xe6, 0x80, 0xa7,
- 0xe6, 0x84, 0x9f, 0xe6, 0x88, 0xbf, 0xe4, 0xba, 0xa7, 0xe9, 0x81, 0x8a, 0xe6,
- 0x88, 0xb2, 0xe5, 0x87, 0xba, 0xe5, 0x8f, 0xa3, 0xe6, 0x8f, 0x90, 0xe4, 0xba,
- 0xa4, 0xe5, 0xb0, 0xb1, 0xe4, 0xb8, 0x9a, 0xe4, 0xbf, 0x9d, 0xe5, 0x81, 0xa5,
- 0xe7, 0xa8, 0x8b, 0xe5, 0xba, 0xa6, 0xe5, 0x8f, 0x82, 0xe6, 0x95, 0xb0, 0xe4,
- 0xba, 0x8b, 0xe4, 0xb8, 0x9a, 0xe6, 0x95, 0xb4, 0xe4, 0xb8, 0xaa, 0xe5, 0xb1,
- 0xb1, 0xe4, 0xb8, 0x9c, 0xe6, 0x83, 0x85, 0xe6, 0x84, 0x9f, 0xe7, 0x89, 0xb9,
- 0xe6, 0xae, 0x8a, 0xe5, 0x88, 0x86, 0xe9, 0xa1, 0x9e, 0xe6, 0x90, 0x9c, 0xe5,
- 0xb0, 0x8b, 0xe5, 0xb1, 0x9e, 0xe4, 0xba, 0x8e, 0xe9, 0x97, 0xa8, 0xe6, 0x88,
- 0xb7, 0xe8, 0xb4, 0xa2, 0xe5, 0x8a, 0xa1, 0xe5, 0xa3, 0xb0, 0xe9, 0x9f, 0xb3,
- 0xe5, 0x8f, 0x8a, 0xe5, 0x85, 0xb6, 0xe8, 0xb4, 0xa2, 0xe7, 0xbb, 0x8f, 0xe5,
- 0x9d, 0x9a, 0xe6, 0x8c, 0x81, 0xe5, 0xb9, 0xb2, 0xe9, 0x83, 0xa8, 0xe6, 0x88,
- 0x90, 0xe7, 0xab, 0x8b, 0xe5, 0x88, 0xa9, 0xe7, 0x9b, 0x8a, 0xe8, 0x80, 0x83,
- 0xe8, 0x99, 0x91, 0xe6, 0x88, 0x90, 0xe9, 0x83, 0xbd, 0xe5, 0x8c, 0x85, 0xe8,
- 0xa3, 0x85, 0xe7, 0x94, 0xa8, 0xe6, 0x88, 0xb6, 0xe6, 0xaf, 0x94, 0xe8, 0xb5,
- 0x9b, 0xe6, 0x96, 0x87, 0xe6, 0x98, 0x8e, 0xe6, 0x8b, 0x9b, 0xe5, 0x95, 0x86,
- 0xe5, 0xae, 0x8c, 0xe6, 0x95, 0xb4, 0xe7, 0x9c, 0x9f, 0xe6, 0x98, 0xaf, 0xe7,
- 0x9c, 0xbc, 0xe7, 0x9d, 0x9b, 0xe4, 0xbc, 0x99, 0xe4, 0xbc, 0xb4, 0xe5, 0xa8,
- 0x81, 0xe6, 0x9c, 0x9b, 0xe9, 0xa2, 0x86, 0xe5, 0x9f, 0x9f, 0xe5, 0x8d, 0xab,
- 0xe7, 0x94, 0x9f, 0xe4, 0xbc, 0x98, 0xe6, 0x83, 0xa0, 0xe8, 0xab, 0x96, 0xe5,
- 0xa3, 0x87, 0xe5, 0x85, 0xac, 0xe5, 0x85, 0xb1, 0xe8, 0x89, 0xaf, 0xe5, 0xa5,
- 0xbd, 0xe5, 0x85, 0x85, 0xe5, 0x88, 0x86, 0xe7, 0xac, 0xa6, 0xe5, 0x90, 0x88,
- 0xe9, 0x99, 0x84, 0xe4, 0xbb, 0xb6, 0xe7, 0x89, 0xb9, 0xe7, 0x82, 0xb9, 0xe4,
- 0xb8, 0x8d, 0xe5, 0x8f, 0xaf, 0xe8, 0x8b, 0xb1, 0xe6, 0x96, 0x87, 0xe8, 0xb5,
- 0x84, 0xe4, 0xba, 0xa7, 0xe6, 0xa0, 0xb9, 0xe6, 0x9c, 0xac, 0xe6, 0x98, 0x8e,
- 0xe6, 0x98, 0xbe, 0xe5, 0xaf, 0x86, 0xe7, 0xa2, 0xbc, 0xe5, 0x85, 0xac, 0xe4,
- 0xbc, 0x97, 0xe6, 0xb0, 0x91, 0xe6, 0x97, 0x8f, 0xe6, 0x9b, 0xb4, 0xe5, 0x8a,
- 0xa0, 0xe4, 0xba, 0xab, 0xe5, 0x8f, 0x97, 0xe5, 0x90, 0x8c, 0xe5, 0xad, 0xa6,
- 0xe5, 0x90, 0xaf, 0xe5, 0x8a, 0xa8, 0xe9, 0x80, 0x82, 0xe5, 0x90, 0x88, 0xe5,
- 0x8e, 0x9f, 0xe6, 0x9d, 0xa5, 0xe9, 0x97, 0xae, 0xe7, 0xad, 0x94, 0xe6, 0x9c,
- 0xac, 0xe6, 0x96, 0x87, 0xe7, 0xbe, 0x8e, 0xe9, 0xa3, 0x9f, 0xe7, 0xbb, 0xbf,
- 0xe8, 0x89, 0xb2, 0xe7, 0xa8, 0xb3, 0xe5, 0xae, 0x9a, 0xe7, 0xbb, 0x88, 0xe4,
- 0xba, 0x8e, 0xe7, 0x94, 0x9f, 0xe7, 0x89, 0xa9, 0xe4, 0xbe, 0x9b, 0xe6, 0xb1,
- 0x82, 0xe6, 0x90, 0x9c, 0xe7, 0x8b, 0x90, 0xe5, 0x8a, 0x9b, 0xe9, 0x87, 0x8f,
- 0xe4, 0xb8, 0xa5, 0xe9, 0x87, 0x8d, 0xe6, 0xb0, 0xb8, 0xe8, 0xbf, 0x9c, 0xe5,
- 0x86, 0x99, 0xe7, 0x9c, 0x9f, 0xe6, 0x9c, 0x89, 0xe9, 0x99, 0x90, 0xe7, 0xab,
- 0x9e, 0xe4, 0xba, 0x89, 0xe5, 0xaf, 0xb9, 0xe8, 0xb1, 0xa1, 0xe8, 0xb4, 0xb9,
- 0xe7, 0x94, 0xa8, 0xe4, 0xb8, 0x8d, 0xe5, 0xa5, 0xbd, 0xe7, 0xbb, 0x9d, 0xe5,
- 0xaf, 0xb9, 0xe5, 0x8d, 0x81, 0xe5, 0x88, 0x86, 0xe4, 0xbf, 0x83, 0xe8, 0xbf,
- 0x9b, 0xe7, 0x82, 0xb9, 0xe8, 0xaf, 0x84, 0xe5, 0xbd, 0xb1, 0xe9, 0x9f, 0xb3,
- 0xe4, 0xbc, 0x98, 0xe5, 0x8a, 0xbf, 0xe4, 0xb8, 0x8d, 0xe5, 0xb0, 0x91, 0xe6,
- 0xac, 0xa3, 0xe8, 0xb5, 0x8f, 0xe5, 0xb9, 0xb6, 0xe4, 0xb8, 0x94, 0xe6, 0x9c,
- 0x89, 0xe7, 0x82, 0xb9, 0xe6, 0x96, 0xb9, 0xe5, 0x90, 0x91, 0xe5, 0x85, 0xa8,
- 0xe6, 0x96, 0xb0, 0xe4, 0xbf, 0xa1, 0xe7, 0x94, 0xa8, 0xe8, 0xae, 0xbe, 0xe6,
- 0x96, 0xbd, 0xe5, 0xbd, 0xa2, 0xe8, 0xb1, 0xa1, 0xe8, 0xb5, 0x84, 0xe6, 0xa0,
- 0xbc, 0xe7, 0xaa, 0x81, 0xe7, 0xa0, 0xb4, 0xe9, 0x9a, 0x8f, 0xe7, 0x9d, 0x80,
- 0xe9, 0x87, 0x8d, 0xe5, 0xa4, 0xa7, 0xe4, 0xba, 0x8e, 0xe6, 0x98, 0xaf, 0xe6,
- 0xaf, 0x95, 0xe4, 0xb8, 0x9a, 0xe6, 0x99, 0xba, 0xe8, 0x83, 0xbd, 0xe5, 0x8c,
- 0x96, 0xe5, 0xb7, 0xa5, 0xe5, 0xae, 0x8c, 0xe7, 0xbe, 0x8e, 0xe5, 0x95, 0x86,
- 0xe5, 0x9f, 0x8e, 0xe7, 0xbb, 0x9f, 0xe4, 0xb8, 0x80, 0xe5, 0x87, 0xba, 0xe7,
- 0x89, 0x88, 0xe6, 0x89, 0x93, 0xe9, 0x80, 0xa0, 0xe7, 0x94, 0xa2, 0xe5, 0x93,
- 0x81, 0xe6, 0xa6, 0x82, 0xe5, 0x86, 0xb5, 0xe7, 0x94, 0xa8, 0xe4, 0xba, 0x8e,
- 0xe4, 0xbf, 0x9d, 0xe7, 0x95, 0x99, 0xe5, 0x9b, 0xa0, 0xe7, 0xb4, 0xa0, 0xe4,
- 0xb8, 0xad, 0xe5, 0x9c, 0x8b, 0xe5, 0xad, 0x98, 0xe5, 0x82, 0xa8, 0xe8, 0xb4,
- 0xb4, 0xe5, 0x9b, 0xbe, 0xe6, 0x9c, 0x80, 0xe6, 0x84, 0x9b, 0xe9, 0x95, 0xbf,
- 0xe6, 0x9c, 0x9f, 0xe5, 0x8f, 0xa3, 0xe4, 0xbb, 0xb7, 0xe7, 0x90, 0x86, 0xe8,
- 0xb4, 0xa2, 0xe5, 0x9f, 0xba, 0xe5, 0x9c, 0xb0, 0xe5, 0xae, 0x89, 0xe6, 0x8e,
- 0x92, 0xe6, 0xad, 0xa6, 0xe6, 0xb1, 0x89, 0xe9, 0x87, 0x8c, 0xe9, 0x9d, 0xa2,
- 0xe5, 0x88, 0x9b, 0xe5, 0xbb, 0xba, 0xe5, 0xa4, 0xa9, 0xe7, 0xa9, 0xba, 0xe9,
- 0xa6, 0x96, 0xe5, 0x85, 0x88, 0xe5, 0xae, 0x8c, 0xe5, 0x96, 0x84, 0xe9, 0xa9,
- 0xb1, 0xe5, 0x8a, 0xa8, 0xe4, 0xb8, 0x8b, 0xe9, 0x9d, 0xa2, 0xe4, 0xb8, 0x8d,
- 0xe5, 0x86, 0x8d, 0xe8, 0xaf, 0x9a, 0xe4, 0xbf, 0xa1, 0xe6, 0x84, 0x8f, 0xe4,
- 0xb9, 0x89, 0xe9, 0x98, 0xb3, 0xe5, 0x85, 0x89, 0xe8, 0x8b, 0xb1, 0xe5, 0x9b,
- 0xbd, 0xe6, 0xbc, 0x82, 0xe4, 0xba, 0xae, 0xe5, 0x86, 0x9b, 0xe4, 0xba, 0x8b,
- 0xe7, 0x8e, 0xa9, 0xe5, 0xae, 0xb6, 0xe7, 0xbe, 0xa4, 0xe4, 0xbc, 0x97, 0xe5,
- 0x86, 0x9c, 0xe6, 0xb0, 0x91, 0xe5, 0x8d, 0xb3, 0xe5, 0x8f, 0xaf, 0xe5, 0x90,
- 0x8d, 0xe7, 0xa8, 0xb1, 0xe5, 0xae, 0xb6, 0xe5, 0x85, 0xb7, 0xe5, 0x8a, 0xa8,
- 0xe7, 0x94, 0xbb, 0xe6, 0x83, 0xb3, 0xe5, 0x88, 0xb0, 0xe6, 0xb3, 0xa8, 0xe6,
- 0x98, 0x8e, 0xe5, 0xb0, 0x8f, 0xe5, 0xad, 0xa6, 0xe6, 0x80, 0xa7, 0xe8, 0x83,
- 0xbd, 0xe8, 0x80, 0x83, 0xe7, 0xa0, 0x94, 0xe7, 0xa1, 0xac, 0xe4, 0xbb, 0xb6,
- 0xe8, 0xa7, 0x82, 0xe7, 0x9c, 0x8b, 0xe6, 0xb8, 0x85, 0xe6, 0xa5, 0x9a, 0xe6,
- 0x90, 0x9e, 0xe7, 0xac, 0x91, 0xe9, 0xa6, 0x96, 0xe9, 0xa0, 0x81, 0xe9, 0xbb,
- 0x84, 0xe9, 0x87, 0x91, 0xe9, 0x80, 0x82, 0xe7, 0x94, 0xa8, 0xe6, 0xb1, 0x9f,
- 0xe8, 0x8b, 0x8f, 0xe7, 0x9c, 0x9f, 0xe5, 0xae, 0x9e, 0xe4, 0xb8, 0xbb, 0xe7,
- 0xae, 0xa1, 0xe9, 0x98, 0xb6, 0xe6, 0xae, 0xb5, 0xe8, 0xa8, 0xbb, 0xe5, 0x86,
- 0x8a, 0xe7, 0xbf, 0xbb, 0xe8, 0xaf, 0x91, 0xe6, 0x9d, 0x83, 0xe5, 0x88, 0xa9,
- 0xe5, 0x81, 0x9a, 0xe5, 0xa5, 0xbd, 0xe4, 0xbc, 0xbc, 0xe4, 0xb9, 0x8e, 0xe9,
- 0x80, 0x9a, 0xe8, 0xae, 0xaf, 0xe6, 0x96, 0xbd, 0xe5, 0xb7, 0xa5, 0xe7, 0x8b,
- 0x80, 0xe6, 0x85, 0x8b, 0xe4, 0xb9, 0x9f, 0xe8, 0xae, 0xb8, 0xe7, 0x8e, 0xaf,
- 0xe4, 0xbf, 0x9d, 0xe5, 0x9f, 0xb9, 0xe5, 0x85, 0xbb, 0xe6, 0xa6, 0x82, 0xe5,
- 0xbf, 0xb5, 0xe5, 0xa4, 0xa7, 0xe5, 0x9e, 0x8b, 0xe6, 0x9c, 0xba, 0xe7, 0xa5,
- 0xa8, 0xe7, 0x90, 0x86, 0xe8, 0xa7, 0xa3, 0xe5, 0x8c, 0xbf, 0xe5, 0x90, 0x8d,
- 0x63, 0x75, 0x61, 0x6e, 0x64, 0x6f, 0x65, 0x6e, 0x76, 0x69, 0x61, 0x72, 0x6d,
- 0x61, 0x64, 0x72, 0x69, 0x64, 0x62, 0x75, 0x73, 0x63, 0x61, 0x72, 0x69, 0x6e,
- 0x69, 0x63, 0x69, 0x6f, 0x74, 0x69, 0x65, 0x6d, 0x70, 0x6f, 0x70, 0x6f, 0x72,
- 0x71, 0x75, 0x65, 0x63, 0x75, 0x65, 0x6e, 0x74, 0x61, 0x65, 0x73, 0x74, 0x61,
- 0x64, 0x6f, 0x70, 0x75, 0x65, 0x64, 0x65, 0x6e, 0x6a, 0x75, 0x65, 0x67, 0x6f,
- 0x73, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x61, 0x65, 0x73, 0x74, 0xc3, 0xa1, 0x6e,
- 0x6e, 0x6f, 0x6d, 0x62, 0x72, 0x65, 0x74, 0x69, 0x65, 0x6e, 0x65, 0x6e, 0x70,
- 0x65, 0x72, 0x66, 0x69, 0x6c, 0x6d, 0x61, 0x6e, 0x65, 0x72, 0x61, 0x61, 0x6d,
- 0x69, 0x67, 0x6f, 0x73, 0x63, 0x69, 0x75, 0x64, 0x61, 0x64, 0x63, 0x65, 0x6e,
- 0x74, 0x72, 0x6f, 0x61, 0x75, 0x6e, 0x71, 0x75, 0x65, 0x70, 0x75, 0x65, 0x64,
- 0x65, 0x73, 0x64, 0x65, 0x6e, 0x74, 0x72, 0x6f, 0x70, 0x72, 0x69, 0x6d, 0x65,
- 0x72, 0x70, 0x72, 0x65, 0x63, 0x69, 0x6f, 0x73, 0x65, 0x67, 0xc3, 0xba, 0x6e,
- 0x62, 0x75, 0x65, 0x6e, 0x6f, 0x73, 0x76, 0x6f, 0x6c, 0x76, 0x65, 0x72, 0x70,
- 0x75, 0x6e, 0x74, 0x6f, 0x73, 0x73, 0x65, 0x6d, 0x61, 0x6e, 0x61, 0x68, 0x61,
- 0x62, 0xc3, 0xad, 0x61, 0x61, 0x67, 0x6f, 0x73, 0x74, 0x6f, 0x6e, 0x75, 0x65,
- 0x76, 0x6f, 0x73, 0x75, 0x6e, 0x69, 0x64, 0x6f, 0x73, 0x63, 0x61, 0x72, 0x6c,
- 0x6f, 0x73, 0x65, 0x71, 0x75, 0x69, 0x70, 0x6f, 0x6e, 0x69, 0xc3, 0xb1, 0x6f,
- 0x73, 0x6d, 0x75, 0x63, 0x68, 0x6f, 0x73, 0x61, 0x6c, 0x67, 0x75, 0x6e, 0x61,
- 0x63, 0x6f, 0x72, 0x72, 0x65, 0x6f, 0x69, 0x6d, 0x61, 0x67, 0x65, 0x6e, 0x70,
- 0x61, 0x72, 0x74, 0x69, 0x72, 0x61, 0x72, 0x72, 0x69, 0x62, 0x61, 0x6d, 0x61,
- 0x72, 0xc3, 0xad, 0x61, 0x68, 0x6f, 0x6d, 0x62, 0x72, 0x65, 0x65, 0x6d, 0x70,
- 0x6c, 0x65, 0x6f, 0x76, 0x65, 0x72, 0x64, 0x61, 0x64, 0x63, 0x61, 0x6d, 0x62,
- 0x69, 0x6f, 0x6d, 0x75, 0x63, 0x68, 0x61, 0x73, 0x66, 0x75, 0x65, 0x72, 0x6f,
- 0x6e, 0x70, 0x61, 0x73, 0x61, 0x64, 0x6f, 0x6c, 0xc3, 0xad, 0x6e, 0x65, 0x61,
- 0x70, 0x61, 0x72, 0x65, 0x63, 0x65, 0x6e, 0x75, 0x65, 0x76, 0x61, 0x73, 0x63,
- 0x75, 0x72, 0x73, 0x6f, 0x73, 0x65, 0x73, 0x74, 0x61, 0x62, 0x61, 0x71, 0x75,
- 0x69, 0x65, 0x72, 0x6f, 0x6c, 0x69, 0x62, 0x72, 0x6f, 0x73, 0x63, 0x75, 0x61,
- 0x6e, 0x74, 0x6f, 0x61, 0x63, 0x63, 0x65, 0x73, 0x6f, 0x6d, 0x69, 0x67, 0x75,
- 0x65, 0x6c, 0x76, 0x61, 0x72, 0x69, 0x6f, 0x73, 0x63, 0x75, 0x61, 0x74, 0x72,
- 0x6f, 0x74, 0x69, 0x65, 0x6e, 0x65, 0x73, 0x67, 0x72, 0x75, 0x70, 0x6f, 0x73,
- 0x73, 0x65, 0x72, 0xc3, 0xa1, 0x6e, 0x65, 0x75, 0x72, 0x6f, 0x70, 0x61, 0x6d,
- 0x65, 0x64, 0x69, 0x6f, 0x73, 0x66, 0x72, 0x65, 0x6e, 0x74, 0x65, 0x61, 0x63,
- 0x65, 0x72, 0x63, 0x61, 0x64, 0x65, 0x6d, 0xc3, 0xa1, 0x73, 0x6f, 0x66, 0x65,
- 0x72, 0x74, 0x61, 0x63, 0x6f, 0x63, 0x68, 0x65, 0x73, 0x6d, 0x6f, 0x64, 0x65,
- 0x6c, 0x6f, 0x69, 0x74, 0x61, 0x6c, 0x69, 0x61, 0x6c, 0x65, 0x74, 0x72, 0x61,
- 0x73, 0x61, 0x6c, 0x67, 0xc3, 0xba, 0x6e, 0x63, 0x6f, 0x6d, 0x70, 0x72, 0x61,
- 0x63, 0x75, 0x61, 0x6c, 0x65, 0x73, 0x65, 0x78, 0x69, 0x73, 0x74, 0x65, 0x63,
- 0x75, 0x65, 0x72, 0x70, 0x6f, 0x73, 0x69, 0x65, 0x6e, 0x64, 0x6f, 0x70, 0x72,
- 0x65, 0x6e, 0x73, 0x61, 0x6c, 0x6c, 0x65, 0x67, 0x61, 0x72, 0x76, 0x69, 0x61,
- 0x6a, 0x65, 0x73, 0x64, 0x69, 0x6e, 0x65, 0x72, 0x6f, 0x6d, 0x75, 0x72, 0x63,
- 0x69, 0x61, 0x70, 0x6f, 0x64, 0x72, 0xc3, 0xa1, 0x70, 0x75, 0x65, 0x73, 0x74,
- 0x6f, 0x64, 0x69, 0x61, 0x72, 0x69, 0x6f, 0x70, 0x75, 0x65, 0x62, 0x6c, 0x6f,
- 0x71, 0x75, 0x69, 0x65, 0x72, 0x65, 0x6d, 0x61, 0x6e, 0x75, 0x65, 0x6c, 0x70,
- 0x72, 0x6f, 0x70, 0x69, 0x6f, 0x63, 0x72, 0x69, 0x73, 0x69, 0x73, 0x63, 0x69,
- 0x65, 0x72, 0x74, 0x6f, 0x73, 0x65, 0x67, 0x75, 0x72, 0x6f, 0x6d, 0x75, 0x65,
- 0x72, 0x74, 0x65, 0x66, 0x75, 0x65, 0x6e, 0x74, 0x65, 0x63, 0x65, 0x72, 0x72,
- 0x61, 0x72, 0x67, 0x72, 0x61, 0x6e, 0x64, 0x65, 0x65, 0x66, 0x65, 0x63, 0x74,
- 0x6f, 0x70, 0x61, 0x72, 0x74, 0x65, 0x73, 0x6d, 0x65, 0x64, 0x69, 0x64, 0x61,
- 0x70, 0x72, 0x6f, 0x70, 0x69, 0x61, 0x6f, 0x66, 0x72, 0x65, 0x63, 0x65, 0x74,
- 0x69, 0x65, 0x72, 0x72, 0x61, 0x65, 0x2d, 0x6d, 0x61, 0x69, 0x6c, 0x76, 0x61,
- 0x72, 0x69, 0x61, 0x73, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x73, 0x66, 0x75, 0x74,
- 0x75, 0x72, 0x6f, 0x6f, 0x62, 0x6a, 0x65, 0x74, 0x6f, 0x73, 0x65, 0x67, 0x75,
- 0x69, 0x72, 0x72, 0x69, 0x65, 0x73, 0x67, 0x6f, 0x6e, 0x6f, 0x72, 0x6d, 0x61,
- 0x73, 0x6d, 0x69, 0x73, 0x6d, 0x6f, 0x73, 0xc3, 0xba, 0x6e, 0x69, 0x63, 0x6f,
- 0x63, 0x61, 0x6d, 0x69, 0x6e, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x6f, 0x73, 0x72,
- 0x61, 0x7a, 0xc3, 0xb3, 0x6e, 0x64, 0x65, 0x62, 0x69, 0x64, 0x6f, 0x70, 0x72,
- 0x75, 0x65, 0x62, 0x61, 0x74, 0x6f, 0x6c, 0x65, 0x64, 0x6f, 0x74, 0x65, 0x6e,
- 0xc3, 0xad, 0x61, 0x6a, 0x65, 0x73, 0xc3, 0xba, 0x73, 0x65, 0x73, 0x70, 0x65,
- 0x72, 0x6f, 0x63, 0x6f, 0x63, 0x69, 0x6e, 0x61, 0x6f, 0x72, 0x69, 0x67, 0x65,
- 0x6e, 0x74, 0x69, 0x65, 0x6e, 0x64, 0x61, 0x63, 0x69, 0x65, 0x6e, 0x74, 0x6f,
- 0x63, 0xc3, 0xa1, 0x64, 0x69, 0x7a, 0x68, 0x61, 0x62, 0x6c, 0x61, 0x72, 0x73,
- 0x65, 0x72, 0xc3, 0xad, 0x61, 0x6c, 0x61, 0x74, 0x69, 0x6e, 0x61, 0x66, 0x75,
- 0x65, 0x72, 0x7a, 0x61, 0x65, 0x73, 0x74, 0x69, 0x6c, 0x6f, 0x67, 0x75, 0x65,
- 0x72, 0x72, 0x61, 0x65, 0x6e, 0x74, 0x72, 0x61, 0x72, 0xc3, 0xa9, 0x78, 0x69,
- 0x74, 0x6f, 0x6c, 0xc3, 0xb3, 0x70, 0x65, 0x7a, 0x61, 0x67, 0x65, 0x6e, 0x64,
- 0x61, 0x76, 0xc3, 0xad, 0x64, 0x65, 0x6f, 0x65, 0x76, 0x69, 0x74, 0x61, 0x72,
- 0x70, 0x61, 0x67, 0x69, 0x6e, 0x61, 0x6d, 0x65, 0x74, 0x72, 0x6f, 0x73, 0x6a,
- 0x61, 0x76, 0x69, 0x65, 0x72, 0x70, 0x61, 0x64, 0x72, 0x65, 0x73, 0x66, 0xc3,
- 0xa1, 0x63, 0x69, 0x6c, 0x63, 0x61, 0x62, 0x65, 0x7a, 0x61, 0xc3, 0xa1, 0x72,
- 0x65, 0x61, 0x73, 0x73, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x65, 0x6e, 0x76, 0xc3,
- 0xad, 0x6f, 0x6a, 0x61, 0x70, 0xc3, 0xb3, 0x6e, 0x61, 0x62, 0x75, 0x73, 0x6f,
- 0x73, 0x62, 0x69, 0x65, 0x6e, 0x65, 0x73, 0x74, 0x65, 0x78, 0x74, 0x6f, 0x73,
- 0x6c, 0x6c, 0x65, 0x76, 0x61, 0x72, 0x70, 0x75, 0x65, 0x64, 0x61, 0x6e, 0x66,
- 0x75, 0x65, 0x72, 0x74, 0x65, 0x63, 0x6f, 0x6d, 0xc3, 0xba, 0x6e, 0x63, 0x6c,
- 0x61, 0x73, 0x65, 0x73, 0x68, 0x75, 0x6d, 0x61, 0x6e, 0x6f, 0x74, 0x65, 0x6e,
- 0x69, 0x64, 0x6f, 0x62, 0x69, 0x6c, 0x62, 0x61, 0x6f, 0x75, 0x6e, 0x69, 0x64,
- 0x61, 0x64, 0x65, 0x73, 0x74, 0xc3, 0xa1, 0x73, 0x65, 0x64, 0x69, 0x74, 0x61,
- 0x72, 0x63, 0x72, 0x65, 0x61, 0x64, 0x6f, 0xd0, 0xb4, 0xd0, 0xbb, 0xd1, 0x8f,
- 0xd1, 0x87, 0xd1, 0x82, 0xd0, 0xbe, 0xd0, 0xba, 0xd0, 0xb0, 0xd0, 0xba, 0xd0,
- 0xb8, 0xd0, 0xbb, 0xd0, 0xb8, 0xd1, 0x8d, 0xd1, 0x82, 0xd0, 0xbe, 0xd0, 0xb2,
- 0xd1, 0x81, 0xd0, 0xb5, 0xd0, 0xb5, 0xd0, 0xb3, 0xd0, 0xbe, 0xd0, 0xbf, 0xd1,
- 0x80, 0xd0, 0xb8, 0xd1, 0x82, 0xd0, 0xb0, 0xd0, 0xba, 0xd0, 0xb5, 0xd1, 0x89,
- 0xd0, 0xb5, 0xd1, 0x83, 0xd0, 0xb6, 0xd0, 0xb5, 0xd0, 0x9a, 0xd0, 0xb0, 0xd0,
- 0xba, 0xd0, 0xb1, 0xd0, 0xb5, 0xd0, 0xb7, 0xd0, 0xb1, 0xd1, 0x8b, 0xd0, 0xbb,
- 0xd0, 0xbe, 0xd0, 0xbd, 0xd0, 0xb8, 0xd0, 0x92, 0xd1, 0x81, 0xd0, 0xb5, 0xd0,
- 0xbf, 0xd0, 0xbe, 0xd0, 0xb4, 0xd0, 0xad, 0xd1, 0x82, 0xd0, 0xbe, 0xd1, 0x82,
- 0xd0, 0xbe, 0xd0, 0xbc, 0xd1, 0x87, 0xd0, 0xb5, 0xd0, 0xbc, 0xd0, 0xbd, 0xd0,
- 0xb5, 0xd1, 0x82, 0xd0, 0xbb, 0xd0, 0xb5, 0xd1, 0x82, 0xd1, 0x80, 0xd0, 0xb0,
- 0xd0, 0xb7, 0xd0, 0xbe, 0xd0, 0xbd, 0xd0, 0xb0, 0xd0, 0xb3, 0xd0, 0xb4, 0xd0,
- 0xb5, 0xd0, 0xbc, 0xd0, 0xbd, 0xd0, 0xb5, 0xd0, 0x94, 0xd0, 0xbb, 0xd1, 0x8f,
- 0xd0, 0x9f, 0xd1, 0x80, 0xd0, 0xb8, 0xd0, 0xbd, 0xd0, 0xb0, 0xd1, 0x81, 0xd0,
- 0xbd, 0xd0, 0xb8, 0xd1, 0x85, 0xd1, 0x82, 0xd0, 0xb5, 0xd0, 0xbc, 0xd0, 0xba,
- 0xd1, 0x82, 0xd0, 0xbe, 0xd0, 0xb3, 0xd0, 0xbe, 0xd0, 0xb4, 0xd0, 0xb2, 0xd0,
- 0xbe, 0xd1, 0x82, 0xd1, 0x82, 0xd0, 0xb0, 0xd0, 0xbc, 0xd0, 0xa1, 0xd0, 0xa8,
- 0xd0, 0x90, 0xd0, 0xbc, 0xd0, 0xb0, 0xd1, 0x8f, 0xd0, 0xa7, 0xd1, 0x82, 0xd0,
- 0xbe, 0xd0, 0xb2, 0xd0, 0xb0, 0xd1, 0x81, 0xd0, 0xb2, 0xd0, 0xb0, 0xd0, 0xbc,
- 0xd0, 0xb5, 0xd0, 0xbc, 0xd1, 0x83, 0xd0, 0xa2, 0xd0, 0xb0, 0xd0, 0xba, 0xd0,
- 0xb4, 0xd0, 0xb2, 0xd0, 0xb0, 0xd0, 0xbd, 0xd0, 0xb0, 0xd0, 0xbc, 0xd1, 0x8d,
- 0xd1, 0x82, 0xd0, 0xb8, 0xd1, 0x8d, 0xd1, 0x82, 0xd1, 0x83, 0xd0, 0x92, 0xd0,
- 0xb0, 0xd0, 0xbc, 0xd1, 0x82, 0xd0, 0xb5, 0xd1, 0x85, 0xd0, 0xbf, 0xd1, 0x80,
- 0xd0, 0xbe, 0xd1, 0x82, 0xd1, 0x83, 0xd1, 0x82, 0xd0, 0xbd, 0xd0, 0xb0, 0xd0,
- 0xb4, 0xd0, 0xb4, 0xd0, 0xbd, 0xd1, 0x8f, 0xd0, 0x92, 0xd0, 0xbe, 0xd1, 0x82,
- 0xd1, 0x82, 0xd1, 0x80, 0xd0, 0xb8, 0xd0, 0xbd, 0xd0, 0xb5, 0xd0, 0xb9, 0xd0,
- 0x92, 0xd0, 0xb0, 0xd1, 0x81, 0xd0, 0xbd, 0xd0, 0xb8, 0xd0, 0xbc, 0xd1, 0x81,
- 0xd0, 0xb0, 0xd0, 0xbc, 0xd1, 0x82, 0xd0, 0xbe, 0xd1, 0x82, 0xd1, 0x80, 0xd1,
- 0x83, 0xd0, 0xb1, 0xd0, 0x9e, 0xd0, 0xbd, 0xd0, 0xb8, 0xd0, 0xbc, 0xd0, 0xb8,
- 0xd1, 0x80, 0xd0, 0xbd, 0xd0, 0xb5, 0xd0, 0xb5, 0xd0, 0x9e, 0xd0, 0x9e, 0xd0,
- 0x9e, 0xd0, 0xbb, 0xd0, 0xb8, 0xd1, 0x86, 0xd1, 0x8d, 0xd1, 0x82, 0xd0, 0xb0,
- 0xd0, 0x9e, 0xd0, 0xbd, 0xd0, 0xb0, 0xd0, 0xbd, 0xd0, 0xb5, 0xd0, 0xbc, 0xd0,
- 0xb4, 0xd0, 0xbe, 0xd0, 0xbc, 0xd0, 0xbc, 0xd0, 0xbe, 0xd0, 0xb9, 0xd0, 0xb4,
- 0xd0, 0xb2, 0xd0, 0xb5, 0xd0, 0xbe, 0xd0, 0xbd, 0xd0, 0xbe, 0xd1, 0x81, 0xd1,
- 0x83, 0xd0, 0xb4, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb9, 0xe0,
- 0xa5, 0x88, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xb8, 0xe0, 0xa5,
- 0x87, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x8b,
- 0xe0, 0xa4, 0x94, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xb0, 0xe0,
- 0xa4, 0xa8, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x8f, 0xe0, 0xa4, 0x95, 0xe0, 0xa4,
- 0x95, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xad, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0x87,
- 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xa4, 0xe0,
- 0xa5, 0x8b, 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x86, 0xe0, 0xa4,
- 0xaa, 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xb9,
- 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0x95, 0xe0,
- 0xa4, 0xa5, 0xe0, 0xa4, 0xbe, 0x6a, 0x61, 0x67, 0x72, 0x61, 0x6e, 0xe0, 0xa4,
- 0x86, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0x9c, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x85,
- 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xa6, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x97, 0xe0,
- 0xa4, 0x88, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x97, 0xe0, 0xa4,
- 0x8f, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0x87, 0xe0, 0xa4, 0xa8,
- 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xaf, 0xe0, 0xa5, 0x87, 0xe0,
- 0xa4, 0xa5, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xa5, 0xe0, 0xa5, 0x80, 0xe0, 0xa4,
- 0x98, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xa6,
- 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0x88, 0xe0, 0xa4, 0x9c, 0xe0,
- 0xa5, 0x80, 0xe0, 0xa4, 0xb5, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4,
- 0x88, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0x8f, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xb0,
- 0xe0, 0xa4, 0x89, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xae, 0xe0, 0xa5, 0x87, 0xe0,
- 0xa4, 0x95, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xb5, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4,
- 0xb2, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xae,
- 0xe0, 0xa4, 0x88, 0xe0, 0xa4, 0xa6, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x93, 0xe0,
- 0xa4, 0xb0, 0xe0, 0xa4, 0x86, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xac, 0xe0, 0xa4,
- 0xb8, 0xe0, 0xa4, 0xad, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xa8,
- 0xe0, 0xa4, 0x9a, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xa8, 0xe0,
- 0xa4, 0x86, 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0xb8, 0xe0, 0xa5, 0x80, 0xe0, 0xa4,
- 0xb2, 0xe0, 0xa5, 0x80, 0xd8, 0xb9, 0xd9, 0x84, 0xd9, 0x89, 0xd8, 0xa5, 0xd9,
- 0x84, 0xd9, 0x89, 0xd9, 0x87, 0xd8, 0xb0, 0xd8, 0xa7, 0xd8, 0xa2, 0xd8, 0xae,
- 0xd8, 0xb1, 0xd8, 0xb9, 0xd8, 0xaf, 0xd8, 0xaf, 0xd8, 0xa7, 0xd9, 0x84, 0xd9,
- 0x89, 0xd9, 0x87, 0xd8, 0xb0, 0xd9, 0x87, 0xd8, 0xb5, 0xd9, 0x88, 0xd8, 0xb1,
- 0xd8, 0xba, 0xd9, 0x8a, 0xd8, 0xb1, 0xd9, 0x83, 0xd8, 0xa7, 0xd9, 0x86, 0xd9,
- 0x88, 0xd9, 0x84, 0xd8, 0xa7, 0xd8, 0xa8, 0xd9, 0x8a, 0xd9, 0x86, 0xd8, 0xb9,
- 0xd8, 0xb1, 0xd8, 0xb6, 0xd8, 0xb0, 0xd9, 0x84, 0xd9, 0x83, 0xd9, 0x87, 0xd9,
- 0x86, 0xd8, 0xa7, 0xd9, 0x8a, 0xd9, 0x88, 0xd9, 0x85, 0xd9, 0x82, 0xd8, 0xa7,
- 0xd9, 0x84, 0xd8, 0xb9, 0xd9, 0x84, 0xd9, 0x8a, 0xd8, 0xa7, 0xd9, 0x86, 0xd8,
- 0xa7, 0xd9, 0x84, 0xd9, 0x83, 0xd9, 0x86, 0xd8, 0xad, 0xd8, 0xaa, 0xd9, 0x89,
- 0xd9, 0x82, 0xd8, 0xa8, 0xd9, 0x84, 0xd9, 0x88, 0xd8, 0xad, 0xd8, 0xa9, 0xd8,
- 0xa7, 0xd8, 0xae, 0xd8, 0xb1, 0xd9, 0x81, 0xd9, 0x82, 0xd8, 0xb7, 0xd8, 0xb9,
- 0xd8, 0xa8, 0xd8, 0xaf, 0xd8, 0xb1, 0xd9, 0x83, 0xd9, 0x86, 0xd8, 0xa5, 0xd8,
- 0xb0, 0xd8, 0xa7, 0xd9, 0x83, 0xd9, 0x85, 0xd8, 0xa7, 0xd8, 0xa7, 0xd8, 0xad,
- 0xd8, 0xaf, 0xd8, 0xa5, 0xd9, 0x84, 0xd8, 0xa7, 0xd9, 0x81, 0xd9, 0x8a, 0xd9,
- 0x87, 0xd8, 0xa8, 0xd8, 0xb9, 0xd8, 0xb6, 0xd9, 0x83, 0xd9, 0x8a, 0xd9, 0x81,
- 0xd8, 0xa8, 0xd8, 0xad, 0xd8, 0xab, 0xd9, 0x88, 0xd9, 0x85, 0xd9, 0x86, 0xd9,
- 0x88, 0xd9, 0x87, 0xd9, 0x88, 0xd8, 0xa3, 0xd9, 0x86, 0xd8, 0xa7, 0xd8, 0xac,
- 0xd8, 0xaf, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x87, 0xd8, 0xa7, 0xd8, 0xb3, 0xd9,
- 0x84, 0xd9, 0x85, 0xd8, 0xb9, 0xd9, 0x86, 0xd8, 0xaf, 0xd9, 0x84, 0xd9, 0x8a,
- 0xd8, 0xb3, 0xd8, 0xb9, 0xd8, 0xa8, 0xd8, 0xb1, 0xd8, 0xb5, 0xd9, 0x84, 0xd9,
- 0x89, 0xd9, 0x85, 0xd9, 0x86, 0xd8, 0xb0, 0xd8, 0xa8, 0xd9, 0x87, 0xd8, 0xa7,
- 0xd8, 0xa3, 0xd9, 0x86, 0xd9, 0x87, 0xd9, 0x85, 0xd8, 0xab, 0xd9, 0x84, 0xd9,
- 0x83, 0xd9, 0x86, 0xd8, 0xaa, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa7, 0xd8, 0xad,
- 0xd9, 0x8a, 0xd8, 0xab, 0xd9, 0x85, 0xd8, 0xb5, 0xd8, 0xb1, 0xd8, 0xb4, 0xd8,
- 0xb1, 0xd8, 0xad, 0xd8, 0xad, 0xd9, 0x88, 0xd9, 0x84, 0xd9, 0x88, 0xd9, 0x81,
- 0xd9, 0x8a, 0xd8, 0xa7, 0xd8, 0xb0, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x83, 0xd9,
- 0x84, 0xd9, 0x85, 0xd8, 0xb1, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x86, 0xd8, 0xaa,
- 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x81, 0xd8, 0xa3, 0xd8, 0xa8, 0xd9, 0x88, 0xd8,
- 0xae, 0xd8, 0xa7, 0xd8, 0xb5, 0xd8, 0xa3, 0xd9, 0x86, 0xd8, 0xaa, 0xd8, 0xa7,
- 0xd9, 0x86, 0xd9, 0x87, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x8a, 0xd8, 0xb9, 0xd8,
- 0xb6, 0xd9, 0x88, 0xd9, 0x88, 0xd9, 0x82, 0xd8, 0xaf, 0xd8, 0xa7, 0xd8, 0xa8,
- 0xd9, 0x86, 0xd8, 0xae, 0xd9, 0x8a, 0xd8, 0xb1, 0xd8, 0xa8, 0xd9, 0x86, 0xd8,
- 0xaa, 0xd9, 0x84, 0xd9, 0x83, 0xd9, 0x85, 0xd8, 0xb4, 0xd8, 0xa7, 0xd8, 0xa1,
- 0xd9, 0x88, 0xd9, 0x87, 0xd9, 0x8a, 0xd8, 0xa7, 0xd8, 0xa8, 0xd9, 0x88, 0xd9,
- 0x82, 0xd8, 0xb5, 0xd8, 0xb5, 0xd9, 0x88, 0xd9, 0x85, 0xd8, 0xa7, 0xd8, 0xb1,
- 0xd9, 0x82, 0xd9, 0x85, 0xd8, 0xa3, 0xd8, 0xad, 0xd8, 0xaf, 0xd9, 0x86, 0xd8,
- 0xad, 0xd9, 0x86, 0xd8, 0xb9, 0xd8, 0xaf, 0xd9, 0x85, 0xd8, 0xb1, 0xd8, 0xa3,
- 0xd9, 0x8a, 0xd8, 0xa7, 0xd8, 0xad, 0xd8, 0xa9, 0xd9, 0x83, 0xd8, 0xaa, 0xd8,
- 0xa8, 0xd8, 0xaf, 0xd9, 0x88, 0xd9, 0x86, 0xd9, 0x8a, 0xd8, 0xac, 0xd8, 0xa8,
- 0xd9, 0x85, 0xd9, 0x86, 0xd9, 0x87, 0xd8, 0xaa, 0xd8, 0xad, 0xd8, 0xaa, 0xd8,
- 0xac, 0xd9, 0x87, 0xd8, 0xa9, 0xd8, 0xb3, 0xd9, 0x86, 0xd8, 0xa9, 0xd9, 0x8a,
- 0xd8, 0xaa, 0xd9, 0x85, 0xd9, 0x83, 0xd8, 0xb1, 0xd8, 0xa9, 0xd8, 0xba, 0xd8,
- 0xb2, 0xd8, 0xa9, 0xd9, 0x86, 0xd9, 0x81, 0xd8, 0xb3, 0xd8, 0xa8, 0xd9, 0x8a,
- 0xd8, 0xaa, 0xd9, 0x84, 0xd9, 0x84, 0xd9, 0x87, 0xd9, 0x84, 0xd9, 0x86, 0xd8,
- 0xa7, 0xd8, 0xaa, 0xd9, 0x84, 0xd9, 0x83, 0xd9, 0x82, 0xd9, 0x84, 0xd8, 0xa8,
- 0xd9, 0x84, 0xd9, 0x85, 0xd8, 0xa7, 0xd8, 0xb9, 0xd9, 0x86, 0xd9, 0x87, 0xd8,
- 0xa3, 0xd9, 0x88, 0xd9, 0x84, 0xd8, 0xb4, 0xd9, 0x8a, 0xd8, 0xa1, 0xd9, 0x86,
- 0xd9, 0x88, 0xd8, 0xb1, 0xd8, 0xa3, 0xd9, 0x85, 0xd8, 0xa7, 0xd9, 0x81, 0xd9,
- 0x8a, 0xd9, 0x83, 0xd8, 0xa8, 0xd9, 0x83, 0xd9, 0x84, 0xd8, 0xb0, 0xd8, 0xa7,
- 0xd8, 0xaa, 0xd8, 0xb1, 0xd8, 0xaa, 0xd8, 0xa8, 0xd8, 0xa8, 0xd8, 0xa3, 0xd9,
- 0x86, 0xd9, 0x87, 0xd9, 0x85, 0xd8, 0xb3, 0xd8, 0xa7, 0xd9, 0x86, 0xd9, 0x83,
- 0xd8, 0xa8, 0xd9, 0x8a, 0xd8, 0xb9, 0xd9, 0x81, 0xd9, 0x82, 0xd8, 0xaf, 0xd8,
- 0xad, 0xd8, 0xb3, 0xd9, 0x86, 0xd9, 0x84, 0xd9, 0x87, 0xd9, 0x85, 0xd8, 0xb4,
- 0xd8, 0xb9, 0xd8, 0xb1, 0xd8, 0xa3, 0xd9, 0x87, 0xd9, 0x84, 0xd8, 0xb4, 0xd9,
- 0x87, 0xd8, 0xb1, 0xd9, 0x82, 0xd8, 0xb7, 0xd8, 0xb1, 0xd8, 0xb7, 0xd9, 0x84,
- 0xd8, 0xa8, 0x70, 0x72, 0x6f, 0x66, 0x69, 0x6c, 0x65, 0x73, 0x65, 0x72, 0x76,
- 0x69, 0x63, 0x65, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x68, 0x69, 0x6d,
- 0x73, 0x65, 0x6c, 0x66, 0x64, 0x65, 0x74, 0x61, 0x69, 0x6c, 0x73, 0x63, 0x6f,
- 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x73, 0x75, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x73,
- 0x74, 0x61, 0x72, 0x74, 0x65, 0x64, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65,
- 0x73, 0x75, 0x63, 0x63, 0x65, 0x73, 0x73, 0x66, 0x61, 0x73, 0x68, 0x69, 0x6f,
- 0x6e, 0x3c, 0x74, 0x69, 0x74, 0x6c, 0x65, 0x3e, 0x63, 0x6f, 0x75, 0x6e, 0x74,
- 0x72, 0x79, 0x61, 0x63, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x63, 0x72, 0x65, 0x61,
- 0x74, 0x65, 0x64, 0x73, 0x74, 0x6f, 0x72, 0x69, 0x65, 0x73, 0x72, 0x65, 0x73,
- 0x75, 0x6c, 0x74, 0x73, 0x72, 0x75, 0x6e, 0x6e, 0x69, 0x6e, 0x67, 0x70, 0x72,
- 0x6f, 0x63, 0x65, 0x73, 0x73, 0x77, 0x72, 0x69, 0x74, 0x69, 0x6e, 0x67, 0x6f,
- 0x62, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x76, 0x69, 0x73, 0x69, 0x62, 0x6c, 0x65,
- 0x77, 0x65, 0x6c, 0x63, 0x6f, 0x6d, 0x65, 0x61, 0x72, 0x74, 0x69, 0x63, 0x6c,
- 0x65, 0x75, 0x6e, 0x6b, 0x6e, 0x6f, 0x77, 0x6e, 0x6e, 0x65, 0x74, 0x77, 0x6f,
- 0x72, 0x6b, 0x63, 0x6f, 0x6d, 0x70, 0x61, 0x6e, 0x79, 0x64, 0x79, 0x6e, 0x61,
- 0x6d, 0x69, 0x63, 0x62, 0x72, 0x6f, 0x77, 0x73, 0x65, 0x72, 0x70, 0x72, 0x69,
- 0x76, 0x61, 0x63, 0x79, 0x70, 0x72, 0x6f, 0x62, 0x6c, 0x65, 0x6d, 0x53, 0x65,
- 0x72, 0x76, 0x69, 0x63, 0x65, 0x72, 0x65, 0x73, 0x70, 0x65, 0x63, 0x74, 0x64,
- 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74,
- 0x72, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x77, 0x65, 0x62, 0x73, 0x69, 0x74,
- 0x65, 0x68, 0x69, 0x73, 0x74, 0x6f, 0x72, 0x79, 0x66, 0x72, 0x69, 0x65, 0x6e,
- 0x64, 0x73, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x77, 0x6f, 0x72, 0x6b,
- 0x69, 0x6e, 0x67, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x6d, 0x69, 0x6c,
- 0x6c, 0x69, 0x6f, 0x6e, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x77, 0x69,
- 0x6e, 0x64, 0x6f, 0x77, 0x2e, 0x61, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x76,
- 0x69, 0x73, 0x69, 0x74, 0x65, 0x64, 0x77, 0x65, 0x61, 0x74, 0x68, 0x65, 0x72,
- 0x63, 0x6f, 0x72, 0x72, 0x65, 0x63, 0x74, 0x70, 0x72, 0x6f, 0x64, 0x75, 0x63,
- 0x74, 0x65, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x66, 0x6f, 0x72, 0x77, 0x61,
- 0x72, 0x64, 0x79, 0x6f, 0x75, 0x20, 0x63, 0x61, 0x6e, 0x72, 0x65, 0x6d, 0x6f,
- 0x76, 0x65, 0x64, 0x73, 0x75, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x63, 0x6f, 0x6e,
- 0x74, 0x72, 0x6f, 0x6c, 0x61, 0x72, 0x63, 0x68, 0x69, 0x76, 0x65, 0x63, 0x75,
- 0x72, 0x72, 0x65, 0x6e, 0x74, 0x72, 0x65, 0x61, 0x64, 0x69, 0x6e, 0x67, 0x6c,
- 0x69, 0x62, 0x72, 0x61, 0x72, 0x79, 0x6c, 0x69, 0x6d, 0x69, 0x74, 0x65, 0x64,
- 0x6d, 0x61, 0x6e, 0x61, 0x67, 0x65, 0x72, 0x66, 0x75, 0x72, 0x74, 0x68, 0x65,
- 0x72, 0x73, 0x75, 0x6d, 0x6d, 0x61, 0x72, 0x79, 0x6d, 0x61, 0x63, 0x68, 0x69,
- 0x6e, 0x65, 0x6d, 0x69, 0x6e, 0x75, 0x74, 0x65, 0x73, 0x70, 0x72, 0x69, 0x76,
- 0x61, 0x74, 0x65, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x70, 0x72, 0x6f,
- 0x67, 0x72, 0x61, 0x6d, 0x73, 0x6f, 0x63, 0x69, 0x65, 0x74, 0x79, 0x6e, 0x75,
- 0x6d, 0x62, 0x65, 0x72, 0x73, 0x77, 0x72, 0x69, 0x74, 0x74, 0x65, 0x6e, 0x65,
- 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x74, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72,
- 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x73, 0x6c, 0x6f, 0x61, 0x64, 0x69, 0x6e,
- 0x67, 0x65, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x70, 0x61, 0x72, 0x74, 0x6e,
- 0x65, 0x72, 0x66, 0x69, 0x6e, 0x61, 0x6c, 0x6c, 0x79, 0x70, 0x65, 0x72, 0x66,
- 0x65, 0x63, 0x74, 0x6d, 0x65, 0x61, 0x6e, 0x69, 0x6e, 0x67, 0x73, 0x79, 0x73,
- 0x74, 0x65, 0x6d, 0x73, 0x6b, 0x65, 0x65, 0x70, 0x69, 0x6e, 0x67, 0x63, 0x75,
- 0x6c, 0x74, 0x75, 0x72, 0x65, 0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b, 0x2c, 0x6a,
- 0x6f, 0x75, 0x72, 0x6e, 0x61, 0x6c, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74,
- 0x73, 0x75, 0x72, 0x66, 0x61, 0x63, 0x65, 0x73, 0x26, 0x71, 0x75, 0x6f, 0x74,
- 0x3b, 0x65, 0x78, 0x70, 0x69, 0x72, 0x65, 0x73, 0x72, 0x65, 0x76, 0x69, 0x65,
- 0x77, 0x73, 0x62, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x65, 0x45, 0x6e, 0x67, 0x6c,
- 0x69, 0x73, 0x68, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x74, 0x68, 0x72,
- 0x6f, 0x75, 0x67, 0x68, 0x50, 0x6c, 0x65, 0x61, 0x73, 0x65, 0x20, 0x6f, 0x70,
- 0x69, 0x6e, 0x69, 0x6f, 0x6e, 0x63, 0x6f, 0x6e, 0x74, 0x61, 0x63, 0x74, 0x61,
- 0x76, 0x65, 0x72, 0x61, 0x67, 0x65, 0x70, 0x72, 0x69, 0x6d, 0x61, 0x72, 0x79,
- 0x76, 0x69, 0x6c, 0x6c, 0x61, 0x67, 0x65, 0x53, 0x70, 0x61, 0x6e, 0x69, 0x73,
- 0x68, 0x67, 0x61, 0x6c, 0x6c, 0x65, 0x72, 0x79, 0x64, 0x65, 0x63, 0x6c, 0x69,
- 0x6e, 0x65, 0x6d, 0x65, 0x65, 0x74, 0x69, 0x6e, 0x67, 0x6d, 0x69, 0x73, 0x73,
- 0x69, 0x6f, 0x6e, 0x70, 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x72, 0x71, 0x75, 0x61,
- 0x6c, 0x69, 0x74, 0x79, 0x6d, 0x65, 0x61, 0x73, 0x75, 0x72, 0x65, 0x67, 0x65,
- 0x6e, 0x65, 0x72, 0x61, 0x6c, 0x73, 0x70, 0x65, 0x63, 0x69, 0x65, 0x73, 0x73,
- 0x65, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e,
- 0x77, 0x72, 0x69, 0x74, 0x65, 0x72, 0x73, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x65,
- 0x72, 0x69, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x72, 0x65, 0x70, 0x6f, 0x72,
- 0x74, 0x73, 0x66, 0x69, 0x67, 0x75, 0x72, 0x65, 0x73, 0x6d, 0x65, 0x6d, 0x62,
- 0x65, 0x72, 0x73, 0x68, 0x6f, 0x6c, 0x64, 0x69, 0x6e, 0x67, 0x64, 0x69, 0x73,
- 0x70, 0x75, 0x74, 0x65, 0x65, 0x61, 0x72, 0x6c, 0x69, 0x65, 0x72, 0x65, 0x78,
- 0x70, 0x72, 0x65, 0x73, 0x73, 0x64, 0x69, 0x67, 0x69, 0x74, 0x61, 0x6c, 0x70,
- 0x69, 0x63, 0x74, 0x75, 0x72, 0x65, 0x41, 0x6e, 0x6f, 0x74, 0x68, 0x65, 0x72,
- 0x6d, 0x61, 0x72, 0x72, 0x69, 0x65, 0x64, 0x74, 0x72, 0x61, 0x66, 0x66, 0x69,
- 0x63, 0x6c, 0x65, 0x61, 0x64, 0x69, 0x6e, 0x67, 0x63, 0x68, 0x61, 0x6e, 0x67,
- 0x65, 0x64, 0x63, 0x65, 0x6e, 0x74, 0x72, 0x61, 0x6c, 0x76, 0x69, 0x63, 0x74,
- 0x6f, 0x72, 0x79, 0x69, 0x6d, 0x61, 0x67, 0x65, 0x73, 0x2f, 0x72, 0x65, 0x61,
- 0x73, 0x6f, 0x6e, 0x73, 0x73, 0x74, 0x75, 0x64, 0x69, 0x65, 0x73, 0x66, 0x65,
- 0x61, 0x74, 0x75, 0x72, 0x65, 0x6c, 0x69, 0x73, 0x74, 0x69, 0x6e, 0x67, 0x6d,
- 0x75, 0x73, 0x74, 0x20, 0x62, 0x65, 0x73, 0x63, 0x68, 0x6f, 0x6f, 0x6c, 0x73,
- 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x75, 0x73, 0x75, 0x61, 0x6c, 0x6c,
- 0x79, 0x65, 0x70, 0x69, 0x73, 0x6f, 0x64, 0x65, 0x70, 0x6c, 0x61, 0x79, 0x69,
- 0x6e, 0x67, 0x67, 0x72, 0x6f, 0x77, 0x69, 0x6e, 0x67, 0x6f, 0x62, 0x76, 0x69,
- 0x6f, 0x75, 0x73, 0x6f, 0x76, 0x65, 0x72, 0x6c, 0x61, 0x79, 0x70, 0x72, 0x65,
- 0x73, 0x65, 0x6e, 0x74, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x3c, 0x2f,
- 0x75, 0x6c, 0x3e, 0x0d, 0x0a, 0x77, 0x72, 0x61, 0x70, 0x70, 0x65, 0x72, 0x61,
- 0x6c, 0x72, 0x65, 0x61, 0x64, 0x79, 0x63, 0x65, 0x72, 0x74, 0x61, 0x69, 0x6e,
- 0x72, 0x65, 0x61, 0x6c, 0x69, 0x74, 0x79, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67,
- 0x65, 0x61, 0x6e, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x64, 0x65, 0x73, 0x6b, 0x74,
- 0x6f, 0x70, 0x6f, 0x66, 0x66, 0x65, 0x72, 0x65, 0x64, 0x70, 0x61, 0x74, 0x74,
- 0x65, 0x72, 0x6e, 0x75, 0x6e, 0x75, 0x73, 0x75, 0x61, 0x6c, 0x44, 0x69, 0x67,
- 0x69, 0x74, 0x61, 0x6c, 0x63, 0x61, 0x70, 0x69, 0x74, 0x61, 0x6c, 0x57, 0x65,
- 0x62, 0x73, 0x69, 0x74, 0x65, 0x66, 0x61, 0x69, 0x6c, 0x75, 0x72, 0x65, 0x63,
- 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x72, 0x65, 0x64, 0x75, 0x63, 0x65, 0x64,
- 0x41, 0x6e, 0x64, 0x72, 0x6f, 0x69, 0x64, 0x64, 0x65, 0x63, 0x61, 0x64, 0x65,
- 0x73, 0x72, 0x65, 0x67, 0x75, 0x6c, 0x61, 0x72, 0x20, 0x26, 0x61, 0x6d, 0x70,
- 0x3b, 0x20, 0x61, 0x6e, 0x69, 0x6d, 0x61, 0x6c, 0x73, 0x72, 0x65, 0x6c, 0x65,
- 0x61, 0x73, 0x65, 0x41, 0x75, 0x74, 0x6f, 0x6d, 0x61, 0x74, 0x67, 0x65, 0x74,
- 0x74, 0x69, 0x6e, 0x67, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x73, 0x6e, 0x6f,
- 0x74, 0x68, 0x69, 0x6e, 0x67, 0x50, 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x72, 0x63,
- 0x61, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x6c, 0x65, 0x74, 0x74, 0x65, 0x72, 0x73,
- 0x63, 0x61, 0x70, 0x74, 0x75, 0x72, 0x65, 0x73, 0x63, 0x69, 0x65, 0x6e, 0x63,
- 0x65, 0x6c, 0x69, 0x63, 0x65, 0x6e, 0x73, 0x65, 0x63, 0x68, 0x61, 0x6e, 0x67,
- 0x65, 0x73, 0x45, 0x6e, 0x67, 0x6c, 0x61, 0x6e, 0x64, 0x3d, 0x31, 0x26, 0x61,
- 0x6d, 0x70, 0x3b, 0x48, 0x69, 0x73, 0x74, 0x6f, 0x72, 0x79, 0x20, 0x3d, 0x20,
- 0x6e, 0x65, 0x77, 0x20, 0x43, 0x65, 0x6e, 0x74, 0x72, 0x61, 0x6c, 0x75, 0x70,
- 0x64, 0x61, 0x74, 0x65, 0x64, 0x53, 0x70, 0x65, 0x63, 0x69, 0x61, 0x6c, 0x4e,
- 0x65, 0x74, 0x77, 0x6f, 0x72, 0x6b, 0x72, 0x65, 0x71, 0x75, 0x69, 0x72, 0x65,
- 0x63, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x77, 0x61, 0x72, 0x6e, 0x69, 0x6e,
- 0x67, 0x43, 0x6f, 0x6c, 0x6c, 0x65, 0x67, 0x65, 0x74, 0x6f, 0x6f, 0x6c, 0x62,
- 0x61, 0x72, 0x72, 0x65, 0x6d, 0x61, 0x69, 0x6e, 0x73, 0x62, 0x65, 0x63, 0x61,
- 0x75, 0x73, 0x65, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x65, 0x64, 0x44, 0x65, 0x75,
- 0x74, 0x73, 0x63, 0x68, 0x66, 0x69, 0x6e, 0x61, 0x6e, 0x63, 0x65, 0x77, 0x6f,
- 0x72, 0x6b, 0x65, 0x72, 0x73, 0x71, 0x75, 0x69, 0x63, 0x6b, 0x6c, 0x79, 0x62,
- 0x65, 0x74, 0x77, 0x65, 0x65, 0x6e, 0x65, 0x78, 0x61, 0x63, 0x74, 0x6c, 0x79,
- 0x73, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x64, 0x69, 0x73, 0x65, 0x61, 0x73,
- 0x65, 0x53, 0x6f, 0x63, 0x69, 0x65, 0x74, 0x79, 0x77, 0x65, 0x61, 0x70, 0x6f,
- 0x6e, 0x73, 0x65, 0x78, 0x68, 0x69, 0x62, 0x69, 0x74, 0x26, 0x6c, 0x74, 0x3b,
- 0x21, 0x2d, 0x2d, 0x43, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x63, 0x6c, 0x61,
- 0x73, 0x73, 0x65, 0x73, 0x63, 0x6f, 0x76, 0x65, 0x72, 0x65, 0x64, 0x6f, 0x75,
- 0x74, 0x6c, 0x69, 0x6e, 0x65, 0x61, 0x74, 0x74, 0x61, 0x63, 0x6b, 0x73, 0x64,
- 0x65, 0x76, 0x69, 0x63, 0x65, 0x73, 0x28, 0x77, 0x69, 0x6e, 0x64, 0x6f, 0x77,
- 0x70, 0x75, 0x72, 0x70, 0x6f, 0x73, 0x65, 0x74, 0x69, 0x74, 0x6c, 0x65, 0x3d,
- 0x22, 0x4d, 0x6f, 0x62, 0x69, 0x6c, 0x65, 0x20, 0x6b, 0x69, 0x6c, 0x6c, 0x69,
- 0x6e, 0x67, 0x73, 0x68, 0x6f, 0x77, 0x69, 0x6e, 0x67, 0x49, 0x74, 0x61, 0x6c,
- 0x69, 0x61, 0x6e, 0x64, 0x72, 0x6f, 0x70, 0x70, 0x65, 0x64, 0x68, 0x65, 0x61,
- 0x76, 0x69, 0x6c, 0x79, 0x65, 0x66, 0x66, 0x65, 0x63, 0x74, 0x73, 0x2d, 0x31,
- 0x27, 0x5d, 0x29, 0x3b, 0x0a, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x72, 0x6d, 0x43,
- 0x75, 0x72, 0x72, 0x65, 0x6e, 0x74, 0x61, 0x64, 0x76, 0x61, 0x6e, 0x63, 0x65,
- 0x73, 0x68, 0x61, 0x72, 0x69, 0x6e, 0x67, 0x6f, 0x70, 0x65, 0x6e, 0x69, 0x6e,
- 0x67, 0x64, 0x72, 0x61, 0x77, 0x69, 0x6e, 0x67, 0x62, 0x69, 0x6c, 0x6c, 0x69,
- 0x6f, 0x6e, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x65, 0x64, 0x47, 0x65, 0x72, 0x6d,
- 0x61, 0x6e, 0x79, 0x72, 0x65, 0x6c, 0x61, 0x74, 0x65, 0x64, 0x3c, 0x2f, 0x66,
- 0x6f, 0x72, 0x6d, 0x3e, 0x69, 0x6e, 0x63, 0x6c, 0x75, 0x64, 0x65, 0x77, 0x68,
- 0x65, 0x74, 0x68, 0x65, 0x72, 0x64, 0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, 0x53,
- 0x63, 0x69, 0x65, 0x6e, 0x63, 0x65, 0x63, 0x61, 0x74, 0x61, 0x6c, 0x6f, 0x67,
- 0x41, 0x72, 0x74, 0x69, 0x63, 0x6c, 0x65, 0x62, 0x75, 0x74, 0x74, 0x6f, 0x6e,
- 0x73, 0x6c, 0x61, 0x72, 0x67, 0x65, 0x73, 0x74, 0x75, 0x6e, 0x69, 0x66, 0x6f,
- 0x72, 0x6d, 0x6a, 0x6f, 0x75, 0x72, 0x6e, 0x65, 0x79, 0x73, 0x69, 0x64, 0x65,
- 0x62, 0x61, 0x72, 0x43, 0x68, 0x69, 0x63, 0x61, 0x67, 0x6f, 0x68, 0x6f, 0x6c,
- 0x69, 0x64, 0x61, 0x79, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x6c, 0x70, 0x61,
- 0x73, 0x73, 0x61, 0x67, 0x65, 0x2c, 0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b, 0x61,
- 0x6e, 0x69, 0x6d, 0x61, 0x74, 0x65, 0x66, 0x65, 0x65, 0x6c, 0x69, 0x6e, 0x67,
- 0x61, 0x72, 0x72, 0x69, 0x76, 0x65, 0x64, 0x70, 0x61, 0x73, 0x73, 0x69, 0x6e,
- 0x67, 0x6e, 0x61, 0x74, 0x75, 0x72, 0x61, 0x6c, 0x72, 0x6f, 0x75, 0x67, 0x68,
- 0x6c, 0x79, 0x2e, 0x0a, 0x0a, 0x54, 0x68, 0x65, 0x20, 0x62, 0x75, 0x74, 0x20,
- 0x6e, 0x6f, 0x74, 0x64, 0x65, 0x6e, 0x73, 0x69, 0x74, 0x79, 0x42, 0x72, 0x69,
- 0x74, 0x61, 0x69, 0x6e, 0x43, 0x68, 0x69, 0x6e, 0x65, 0x73, 0x65, 0x6c, 0x61,
- 0x63, 0x6b, 0x20, 0x6f, 0x66, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x65, 0x49,
- 0x72, 0x65, 0x6c, 0x61, 0x6e, 0x64, 0x22, 0x20, 0x64, 0x61, 0x74, 0x61, 0x2d,
- 0x66, 0x61, 0x63, 0x74, 0x6f, 0x72, 0x73, 0x72, 0x65, 0x63, 0x65, 0x69, 0x76,
- 0x65, 0x74, 0x68, 0x61, 0x74, 0x20, 0x69, 0x73, 0x4c, 0x69, 0x62, 0x72, 0x61,
- 0x72, 0x79, 0x68, 0x75, 0x73, 0x62, 0x61, 0x6e, 0x64, 0x69, 0x6e, 0x20, 0x66,
- 0x61, 0x63, 0x74, 0x61, 0x66, 0x66, 0x61, 0x69, 0x72, 0x73, 0x43, 0x68, 0x61,
- 0x72, 0x6c, 0x65, 0x73, 0x72, 0x61, 0x64, 0x69, 0x63, 0x61, 0x6c, 0x62, 0x72,
- 0x6f, 0x75, 0x67, 0x68, 0x74, 0x66, 0x69, 0x6e, 0x64, 0x69, 0x6e, 0x67, 0x6c,
- 0x61, 0x6e, 0x64, 0x69, 0x6e, 0x67, 0x3a, 0x6c, 0x61, 0x6e, 0x67, 0x3d, 0x22,
- 0x72, 0x65, 0x74, 0x75, 0x72, 0x6e, 0x20, 0x6c, 0x65, 0x61, 0x64, 0x65, 0x72,
- 0x73, 0x70, 0x6c, 0x61, 0x6e, 0x6e, 0x65, 0x64, 0x70, 0x72, 0x65, 0x6d, 0x69,
- 0x75, 0x6d, 0x70, 0x61, 0x63, 0x6b, 0x61, 0x67, 0x65, 0x41, 0x6d, 0x65, 0x72,
- 0x69, 0x63, 0x61, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x5d, 0x26, 0x71,
- 0x75, 0x6f, 0x74, 0x3b, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x6e, 0x65,
- 0x65, 0x64, 0x20, 0x74, 0x6f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3d, 0x22, 0x63,
- 0x6f, 0x6d, 0x70, 0x6c, 0x65, 0x78, 0x6c, 0x6f, 0x6f, 0x6b, 0x69, 0x6e, 0x67,
- 0x73, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x62, 0x65, 0x6c, 0x69, 0x65, 0x76,
- 0x65, 0x73, 0x6d, 0x61, 0x6c, 0x6c, 0x65, 0x72, 0x2d, 0x6d, 0x6f, 0x62, 0x69,
- 0x6c, 0x65, 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x73, 0x77, 0x61, 0x6e, 0x74,
- 0x20, 0x74, 0x6f, 0x6b, 0x69, 0x6e, 0x64, 0x20, 0x6f, 0x66, 0x46, 0x69, 0x72,
- 0x65, 0x66, 0x6f, 0x78, 0x79, 0x6f, 0x75, 0x20, 0x61, 0x72, 0x65, 0x73, 0x69,
- 0x6d, 0x69, 0x6c, 0x61, 0x72, 0x73, 0x74, 0x75, 0x64, 0x69, 0x65, 0x64, 0x6d,
- 0x61, 0x78, 0x69, 0x6d, 0x75, 0x6d, 0x68, 0x65, 0x61, 0x64, 0x69, 0x6e, 0x67,
- 0x72, 0x61, 0x70, 0x69, 0x64, 0x6c, 0x79, 0x63, 0x6c, 0x69, 0x6d, 0x61, 0x74,
- 0x65, 0x6b, 0x69, 0x6e, 0x67, 0x64, 0x6f, 0x6d, 0x65, 0x6d, 0x65, 0x72, 0x67,
- 0x65, 0x64, 0x61, 0x6d, 0x6f, 0x75, 0x6e, 0x74, 0x73, 0x66, 0x6f, 0x75, 0x6e,
- 0x64, 0x65, 0x64, 0x70, 0x69, 0x6f, 0x6e, 0x65, 0x65, 0x72, 0x66, 0x6f, 0x72,
- 0x6d, 0x75, 0x6c, 0x61, 0x64, 0x79, 0x6e, 0x61, 0x73, 0x74, 0x79, 0x68, 0x6f,
- 0x77, 0x20, 0x74, 0x6f, 0x20, 0x53, 0x75, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x72,
- 0x65, 0x76, 0x65, 0x6e, 0x75, 0x65, 0x65, 0x63, 0x6f, 0x6e, 0x6f, 0x6d, 0x79,
- 0x52, 0x65, 0x73, 0x75, 0x6c, 0x74, 0x73, 0x62, 0x72, 0x6f, 0x74, 0x68, 0x65,
- 0x72, 0x73, 0x6f, 0x6c, 0x64, 0x69, 0x65, 0x72, 0x6c, 0x61, 0x72, 0x67, 0x65,
- 0x6c, 0x79, 0x63, 0x61, 0x6c, 0x6c, 0x69, 0x6e, 0x67, 0x2e, 0x26, 0x71, 0x75,
- 0x6f, 0x74, 0x3b, 0x41, 0x63, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x45, 0x64, 0x77,
- 0x61, 0x72, 0x64, 0x20, 0x73, 0x65, 0x67, 0x6d, 0x65, 0x6e, 0x74, 0x52, 0x6f,
- 0x62, 0x65, 0x72, 0x74, 0x20, 0x65, 0x66, 0x66, 0x6f, 0x72, 0x74, 0x73, 0x50,
- 0x61, 0x63, 0x69, 0x66, 0x69, 0x63, 0x6c, 0x65, 0x61, 0x72, 0x6e, 0x65, 0x64,
- 0x75, 0x70, 0x20, 0x77, 0x69, 0x74, 0x68, 0x68, 0x65, 0x69, 0x67, 0x68, 0x74,
- 0x3a, 0x77, 0x65, 0x20, 0x68, 0x61, 0x76, 0x65, 0x41, 0x6e, 0x67, 0x65, 0x6c,
- 0x65, 0x73, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x5f, 0x73, 0x65, 0x61,
- 0x72, 0x63, 0x68, 0x61, 0x70, 0x70, 0x6c, 0x69, 0x65, 0x64, 0x61, 0x63, 0x71,
- 0x75, 0x69, 0x72, 0x65, 0x6d, 0x61, 0x73, 0x73, 0x69, 0x76, 0x65, 0x67, 0x72,
- 0x61, 0x6e, 0x74, 0x65, 0x64, 0x3a, 0x20, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x74,
- 0x72, 0x65, 0x61, 0x74, 0x65, 0x64, 0x62, 0x69, 0x67, 0x67, 0x65, 0x73, 0x74,
- 0x62, 0x65, 0x6e, 0x65, 0x66, 0x69, 0x74, 0x64, 0x72, 0x69, 0x76, 0x69, 0x6e,
- 0x67, 0x53, 0x74, 0x75, 0x64, 0x69, 0x65, 0x73, 0x6d, 0x69, 0x6e, 0x69, 0x6d,
- 0x75, 0x6d, 0x70, 0x65, 0x72, 0x68, 0x61, 0x70, 0x73, 0x6d, 0x6f, 0x72, 0x6e,
- 0x69, 0x6e, 0x67, 0x73, 0x65, 0x6c, 0x6c, 0x69, 0x6e, 0x67, 0x69, 0x73, 0x20,
- 0x75, 0x73, 0x65, 0x64, 0x72, 0x65, 0x76, 0x65, 0x72, 0x73, 0x65, 0x76, 0x61,
- 0x72, 0x69, 0x61, 0x6e, 0x74, 0x20, 0x72, 0x6f, 0x6c, 0x65, 0x3d, 0x22, 0x6d,
- 0x69, 0x73, 0x73, 0x69, 0x6e, 0x67, 0x61, 0x63, 0x68, 0x69, 0x65, 0x76, 0x65,
- 0x70, 0x72, 0x6f, 0x6d, 0x6f, 0x74, 0x65, 0x73, 0x74, 0x75, 0x64, 0x65, 0x6e,
- 0x74, 0x73, 0x6f, 0x6d, 0x65, 0x6f, 0x6e, 0x65, 0x65, 0x78, 0x74, 0x72, 0x65,
- 0x6d, 0x65, 0x72, 0x65, 0x73, 0x74, 0x6f, 0x72, 0x65, 0x62, 0x6f, 0x74, 0x74,
- 0x6f, 0x6d, 0x3a, 0x65, 0x76, 0x6f, 0x6c, 0x76, 0x65, 0x64, 0x61, 0x6c, 0x6c,
- 0x20, 0x74, 0x68, 0x65, 0x73, 0x69, 0x74, 0x65, 0x6d, 0x61, 0x70, 0x65, 0x6e,
- 0x67, 0x6c, 0x69, 0x73, 0x68, 0x77, 0x61, 0x79, 0x20, 0x74, 0x6f, 0x20, 0x20,
- 0x41, 0x75, 0x67, 0x75, 0x73, 0x74, 0x73, 0x79, 0x6d, 0x62, 0x6f, 0x6c, 0x73,
- 0x43, 0x6f, 0x6d, 0x70, 0x61, 0x6e, 0x79, 0x6d, 0x61, 0x74, 0x74, 0x65, 0x72,
- 0x73, 0x6d, 0x75, 0x73, 0x69, 0x63, 0x61, 0x6c, 0x61, 0x67, 0x61, 0x69, 0x6e,
- 0x73, 0x74, 0x73, 0x65, 0x72, 0x76, 0x69, 0x6e, 0x67, 0x7d, 0x29, 0x28, 0x29,
- 0x3b, 0x0d, 0x0a, 0x70, 0x61, 0x79, 0x6d, 0x65, 0x6e, 0x74, 0x74, 0x72, 0x6f,
- 0x75, 0x62, 0x6c, 0x65, 0x63, 0x6f, 0x6e, 0x63, 0x65, 0x70, 0x74, 0x63, 0x6f,
- 0x6d, 0x70, 0x61, 0x72, 0x65, 0x70, 0x61, 0x72, 0x65, 0x6e, 0x74, 0x73, 0x70,
- 0x6c, 0x61, 0x79, 0x65, 0x72, 0x73, 0x72, 0x65, 0x67, 0x69, 0x6f, 0x6e, 0x73,
- 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x20, 0x27, 0x27, 0x54, 0x68, 0x65,
- 0x20, 0x77, 0x69, 0x6e, 0x6e, 0x69, 0x6e, 0x67, 0x65, 0x78, 0x70, 0x6c, 0x6f,
- 0x72, 0x65, 0x61, 0x64, 0x61, 0x70, 0x74, 0x65, 0x64, 0x47, 0x61, 0x6c, 0x6c,
- 0x65, 0x72, 0x79, 0x70, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x65, 0x61, 0x62, 0x69,
- 0x6c, 0x69, 0x74, 0x79, 0x65, 0x6e, 0x68, 0x61, 0x6e, 0x63, 0x65, 0x63, 0x61,
- 0x72, 0x65, 0x65, 0x72, 0x73, 0x29, 0x2e, 0x20, 0x54, 0x68, 0x65, 0x20, 0x63,
- 0x6f, 0x6c, 0x6c, 0x65, 0x63, 0x74, 0x53, 0x65, 0x61, 0x72, 0x63, 0x68, 0x20,
- 0x61, 0x6e, 0x63, 0x69, 0x65, 0x6e, 0x74, 0x65, 0x78, 0x69, 0x73, 0x74, 0x65,
- 0x64, 0x66, 0x6f, 0x6f, 0x74, 0x65, 0x72, 0x20, 0x68, 0x61, 0x6e, 0x64, 0x6c,
- 0x65, 0x72, 0x70, 0x72, 0x69, 0x6e, 0x74, 0x65, 0x64, 0x63, 0x6f, 0x6e, 0x73,
- 0x6f, 0x6c, 0x65, 0x45, 0x61, 0x73, 0x74, 0x65, 0x72, 0x6e, 0x65, 0x78, 0x70,
- 0x6f, 0x72, 0x74, 0x73, 0x77, 0x69, 0x6e, 0x64, 0x6f, 0x77, 0x73, 0x43, 0x68,
- 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x69, 0x6c, 0x6c, 0x65, 0x67, 0x61, 0x6c, 0x6e,
- 0x65, 0x75, 0x74, 0x72, 0x61, 0x6c, 0x73, 0x75, 0x67, 0x67, 0x65, 0x73, 0x74,
- 0x5f, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x69, 0x67, 0x6e, 0x69, 0x6e,
- 0x67, 0x2e, 0x68, 0x74, 0x6d, 0x6c, 0x22, 0x3e, 0x73, 0x65, 0x74, 0x74, 0x6c,
- 0x65, 0x64, 0x77, 0x65, 0x73, 0x74, 0x65, 0x72, 0x6e, 0x63, 0x61, 0x75, 0x73,
- 0x69, 0x6e, 0x67, 0x2d, 0x77, 0x65, 0x62, 0x6b, 0x69, 0x74, 0x63, 0x6c, 0x61,
- 0x69, 0x6d, 0x65, 0x64, 0x4a, 0x75, 0x73, 0x74, 0x69, 0x63, 0x65, 0x63, 0x68,
- 0x61, 0x70, 0x74, 0x65, 0x72, 0x76, 0x69, 0x63, 0x74, 0x69, 0x6d, 0x73, 0x54,
- 0x68, 0x6f, 0x6d, 0x61, 0x73, 0x20, 0x6d, 0x6f, 0x7a, 0x69, 0x6c, 0x6c, 0x61,
- 0x70, 0x72, 0x6f, 0x6d, 0x69, 0x73, 0x65, 0x70, 0x61, 0x72, 0x74, 0x69, 0x65,
- 0x73, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x6f, 0x75, 0x74, 0x73, 0x69,
- 0x64, 0x65, 0x3a, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x2c, 0x68, 0x75, 0x6e, 0x64,
- 0x72, 0x65, 0x64, 0x4f, 0x6c, 0x79, 0x6d, 0x70, 0x69, 0x63, 0x5f, 0x62, 0x75,
- 0x74, 0x74, 0x6f, 0x6e, 0x61, 0x75, 0x74, 0x68, 0x6f, 0x72, 0x73, 0x72, 0x65,
- 0x61, 0x63, 0x68, 0x65, 0x64, 0x63, 0x68, 0x72, 0x6f, 0x6e, 0x69, 0x63, 0x64,
- 0x65, 0x6d, 0x61, 0x6e, 0x64, 0x73, 0x73, 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x73,
- 0x70, 0x72, 0x6f, 0x74, 0x65, 0x63, 0x74, 0x61, 0x64, 0x6f, 0x70, 0x74, 0x65,
- 0x64, 0x70, 0x72, 0x65, 0x70, 0x61, 0x72, 0x65, 0x6e, 0x65, 0x69, 0x74, 0x68,
- 0x65, 0x72, 0x67, 0x72, 0x65, 0x61, 0x74, 0x6c, 0x79, 0x67, 0x72, 0x65, 0x61,
- 0x74, 0x65, 0x72, 0x6f, 0x76, 0x65, 0x72, 0x61, 0x6c, 0x6c, 0x69, 0x6d, 0x70,
- 0x72, 0x6f, 0x76, 0x65, 0x63, 0x6f, 0x6d, 0x6d, 0x61, 0x6e, 0x64, 0x73, 0x70,
- 0x65, 0x63, 0x69, 0x61, 0x6c, 0x73, 0x65, 0x61, 0x72, 0x63, 0x68, 0x2e, 0x77,
- 0x6f, 0x72, 0x73, 0x68, 0x69, 0x70, 0x66, 0x75, 0x6e, 0x64, 0x69, 0x6e, 0x67,
- 0x74, 0x68, 0x6f, 0x75, 0x67, 0x68, 0x74, 0x68, 0x69, 0x67, 0x68, 0x65, 0x73,
- 0x74, 0x69, 0x6e, 0x73, 0x74, 0x65, 0x61, 0x64, 0x75, 0x74, 0x69, 0x6c, 0x69,
- 0x74, 0x79, 0x71, 0x75, 0x61, 0x72, 0x74, 0x65, 0x72, 0x43, 0x75, 0x6c, 0x74,
- 0x75, 0x72, 0x65, 0x74, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x67, 0x63, 0x6c, 0x65,
- 0x61, 0x72, 0x6c, 0x79, 0x65, 0x78, 0x70, 0x6f, 0x73, 0x65, 0x64, 0x42, 0x72,
- 0x6f, 0x77, 0x73, 0x65, 0x72, 0x6c, 0x69, 0x62, 0x65, 0x72, 0x61, 0x6c, 0x7d,
- 0x20, 0x63, 0x61, 0x74, 0x63, 0x68, 0x50, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74,
- 0x65, 0x78, 0x61, 0x6d, 0x70, 0x6c, 0x65, 0x68, 0x69, 0x64, 0x65, 0x28, 0x29,
- 0x3b, 0x46, 0x6c, 0x6f, 0x72, 0x69, 0x64, 0x61, 0x61, 0x6e, 0x73, 0x77, 0x65,
- 0x72, 0x73, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x65, 0x64, 0x45, 0x6d, 0x70, 0x65,
- 0x72, 0x6f, 0x72, 0x64, 0x65, 0x66, 0x65, 0x6e, 0x73, 0x65, 0x73, 0x65, 0x72,
- 0x69, 0x6f, 0x75, 0x73, 0x66, 0x72, 0x65, 0x65, 0x64, 0x6f, 0x6d, 0x53, 0x65,
- 0x76, 0x65, 0x72, 0x61, 0x6c, 0x2d, 0x62, 0x75, 0x74, 0x74, 0x6f, 0x6e, 0x46,
- 0x75, 0x72, 0x74, 0x68, 0x65, 0x72, 0x6f, 0x75, 0x74, 0x20, 0x6f, 0x66, 0x20,
- 0x21, 0x3d, 0x20, 0x6e, 0x75, 0x6c, 0x6c, 0x74, 0x72, 0x61, 0x69, 0x6e, 0x65,
- 0x64, 0x44, 0x65, 0x6e, 0x6d, 0x61, 0x72, 0x6b, 0x76, 0x6f, 0x69, 0x64, 0x28,
- 0x30, 0x29, 0x2f, 0x61, 0x6c, 0x6c, 0x2e, 0x6a, 0x73, 0x70, 0x72, 0x65, 0x76,
- 0x65, 0x6e, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x53, 0x74, 0x65,
- 0x70, 0x68, 0x65, 0x6e, 0x0a, 0x0a, 0x57, 0x68, 0x65, 0x6e, 0x20, 0x6f, 0x62,
- 0x73, 0x65, 0x72, 0x76, 0x65, 0x3c, 0x2f, 0x68, 0x32, 0x3e, 0x0d, 0x0a, 0x4d,
- 0x6f, 0x64, 0x65, 0x72, 0x6e, 0x20, 0x70, 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65,
- 0x22, 0x20, 0x61, 0x6c, 0x74, 0x3d, 0x22, 0x62, 0x6f, 0x72, 0x64, 0x65, 0x72,
- 0x73, 0x2e, 0x0a, 0x0a, 0x46, 0x6f, 0x72, 0x20, 0x0a, 0x0a, 0x4d, 0x61, 0x6e,
- 0x79, 0x20, 0x61, 0x72, 0x74, 0x69, 0x73, 0x74, 0x73, 0x70, 0x6f, 0x77, 0x65,
- 0x72, 0x65, 0x64, 0x70, 0x65, 0x72, 0x66, 0x6f, 0x72, 0x6d, 0x66, 0x69, 0x63,
- 0x74, 0x69, 0x6f, 0x6e, 0x74, 0x79, 0x70, 0x65, 0x20, 0x6f, 0x66, 0x6d, 0x65,
- 0x64, 0x69, 0x63, 0x61, 0x6c, 0x74, 0x69, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x6f,
- 0x70, 0x70, 0x6f, 0x73, 0x65, 0x64, 0x43, 0x6f, 0x75, 0x6e, 0x63, 0x69, 0x6c,
- 0x77, 0x69, 0x74, 0x6e, 0x65, 0x73, 0x73, 0x6a, 0x75, 0x73, 0x74, 0x69, 0x63,
- 0x65, 0x47, 0x65, 0x6f, 0x72, 0x67, 0x65, 0x20, 0x42, 0x65, 0x6c, 0x67, 0x69,
- 0x75, 0x6d, 0x2e, 0x2e, 0x2e, 0x3c, 0x2f, 0x61, 0x3e, 0x74, 0x77, 0x69, 0x74,
- 0x74, 0x65, 0x72, 0x6e, 0x6f, 0x74, 0x61, 0x62, 0x6c, 0x79, 0x77, 0x61, 0x69,
- 0x74, 0x69, 0x6e, 0x67, 0x77, 0x61, 0x72, 0x66, 0x61, 0x72, 0x65, 0x20, 0x4f,
- 0x74, 0x68, 0x65, 0x72, 0x20, 0x72, 0x61, 0x6e, 0x6b, 0x69, 0x6e, 0x67, 0x70,
- 0x68, 0x72, 0x61, 0x73, 0x65, 0x73, 0x6d, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e,
- 0x73, 0x75, 0x72, 0x76, 0x69, 0x76, 0x65, 0x73, 0x63, 0x68, 0x6f, 0x6c, 0x61,
- 0x72, 0x3c, 0x2f, 0x70, 0x3e, 0x0d, 0x0a, 0x20, 0x43, 0x6f, 0x75, 0x6e, 0x74,
- 0x72, 0x79, 0x69, 0x67, 0x6e, 0x6f, 0x72, 0x65, 0x64, 0x6c, 0x6f, 0x73, 0x73,
- 0x20, 0x6f, 0x66, 0x6a, 0x75, 0x73, 0x74, 0x20, 0x61, 0x73, 0x47, 0x65, 0x6f,
- 0x72, 0x67, 0x69, 0x61, 0x73, 0x74, 0x72, 0x61, 0x6e, 0x67, 0x65, 0x3c, 0x68,
- 0x65, 0x61, 0x64, 0x3e, 0x3c, 0x73, 0x74, 0x6f, 0x70, 0x70, 0x65, 0x64, 0x31,
- 0x27, 0x5d, 0x29, 0x3b, 0x0d, 0x0a, 0x69, 0x73, 0x6c, 0x61, 0x6e, 0x64, 0x73,
- 0x6e, 0x6f, 0x74, 0x61, 0x62, 0x6c, 0x65, 0x62, 0x6f, 0x72, 0x64, 0x65, 0x72,
- 0x3a, 0x6c, 0x69, 0x73, 0x74, 0x20, 0x6f, 0x66, 0x63, 0x61, 0x72, 0x72, 0x69,
- 0x65, 0x64, 0x31, 0x30, 0x30, 0x2c, 0x30, 0x30, 0x30, 0x3c, 0x2f, 0x68, 0x33,
- 0x3e, 0x0a, 0x20, 0x73, 0x65, 0x76, 0x65, 0x72, 0x61, 0x6c, 0x62, 0x65, 0x63,
- 0x6f, 0x6d, 0x65, 0x73, 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x20, 0x77, 0x65,
- 0x64, 0x64, 0x69, 0x6e, 0x67, 0x30, 0x30, 0x2e, 0x68, 0x74, 0x6d, 0x6c, 0x6d,
- 0x6f, 0x6e, 0x61, 0x72, 0x63, 0x68, 0x6f, 0x66, 0x66, 0x20, 0x74, 0x68, 0x65,
- 0x74, 0x65, 0x61, 0x63, 0x68, 0x65, 0x72, 0x68, 0x69, 0x67, 0x68, 0x6c, 0x79,
- 0x20, 0x62, 0x69, 0x6f, 0x6c, 0x6f, 0x67, 0x79, 0x6c, 0x69, 0x66, 0x65, 0x20,
- 0x6f, 0x66, 0x6f, 0x72, 0x20, 0x65, 0x76, 0x65, 0x6e, 0x72, 0x69, 0x73, 0x65,
- 0x20, 0x6f, 0x66, 0x26, 0x72, 0x61, 0x71, 0x75, 0x6f, 0x3b, 0x70, 0x6c, 0x75,
- 0x73, 0x6f, 0x6e, 0x65, 0x68, 0x75, 0x6e, 0x74, 0x69, 0x6e, 0x67, 0x28, 0x74,
- 0x68, 0x6f, 0x75, 0x67, 0x68, 0x44, 0x6f, 0x75, 0x67, 0x6c, 0x61, 0x73, 0x6a,
- 0x6f, 0x69, 0x6e, 0x69, 0x6e, 0x67, 0x63, 0x69, 0x72, 0x63, 0x6c, 0x65, 0x73,
- 0x46, 0x6f, 0x72, 0x20, 0x74, 0x68, 0x65, 0x41, 0x6e, 0x63, 0x69, 0x65, 0x6e,
- 0x74, 0x56, 0x69, 0x65, 0x74, 0x6e, 0x61, 0x6d, 0x76, 0x65, 0x68, 0x69, 0x63,
- 0x6c, 0x65, 0x73, 0x75, 0x63, 0x68, 0x20, 0x61, 0x73, 0x63, 0x72, 0x79, 0x73,
- 0x74, 0x61, 0x6c, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x20, 0x3d, 0x57, 0x69, 0x6e,
- 0x64, 0x6f, 0x77, 0x73, 0x65, 0x6e, 0x6a, 0x6f, 0x79, 0x65, 0x64, 0x61, 0x20,
- 0x73, 0x6d, 0x61, 0x6c, 0x6c, 0x61, 0x73, 0x73, 0x75, 0x6d, 0x65, 0x64, 0x3c,
- 0x61, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x66, 0x6f, 0x72, 0x65, 0x69, 0x67, 0x6e,
- 0x20, 0x41, 0x6c, 0x6c, 0x20, 0x72, 0x69, 0x68, 0x6f, 0x77, 0x20, 0x74, 0x68,
- 0x65, 0x44, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x72, 0x65, 0x74, 0x69, 0x72,
- 0x65, 0x64, 0x68, 0x6f, 0x77, 0x65, 0x76, 0x65, 0x72, 0x68, 0x69, 0x64, 0x64,
- 0x65, 0x6e, 0x3b, 0x62, 0x61, 0x74, 0x74, 0x6c, 0x65, 0x73, 0x73, 0x65, 0x65,
- 0x6b, 0x69, 0x6e, 0x67, 0x63, 0x61, 0x62, 0x69, 0x6e, 0x65, 0x74, 0x77, 0x61,
- 0x73, 0x20, 0x6e, 0x6f, 0x74, 0x6c, 0x6f, 0x6f, 0x6b, 0x20, 0x61, 0x74, 0x63,
- 0x6f, 0x6e, 0x64, 0x75, 0x63, 0x74, 0x67, 0x65, 0x74, 0x20, 0x74, 0x68, 0x65,
- 0x4a, 0x61, 0x6e, 0x75, 0x61, 0x72, 0x79, 0x68, 0x61, 0x70, 0x70, 0x65, 0x6e,
- 0x73, 0x74, 0x75, 0x72, 0x6e, 0x69, 0x6e, 0x67, 0x61, 0x3a, 0x68, 0x6f, 0x76,
- 0x65, 0x72, 0x4f, 0x6e, 0x6c, 0x69, 0x6e, 0x65, 0x20, 0x46, 0x72, 0x65, 0x6e,
- 0x63, 0x68, 0x20, 0x6c, 0x61, 0x63, 0x6b, 0x69, 0x6e, 0x67, 0x74, 0x79, 0x70,
- 0x69, 0x63, 0x61, 0x6c, 0x65, 0x78, 0x74, 0x72, 0x61, 0x63, 0x74, 0x65, 0x6e,
- 0x65, 0x6d, 0x69, 0x65, 0x73, 0x65, 0x76, 0x65, 0x6e, 0x20, 0x69, 0x66, 0x67,
- 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x64, 0x65, 0x63, 0x69, 0x64, 0x65, 0x64,
- 0x61, 0x72, 0x65, 0x20, 0x6e, 0x6f, 0x74, 0x2f, 0x73, 0x65, 0x61, 0x72, 0x63,
- 0x68, 0x62, 0x65, 0x6c, 0x69, 0x65, 0x66, 0x73, 0x2d, 0x69, 0x6d, 0x61, 0x67,
- 0x65, 0x3a, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x65, 0x64, 0x73, 0x74, 0x61, 0x74,
- 0x69, 0x63, 0x2e, 0x6c, 0x6f, 0x67, 0x69, 0x6e, 0x22, 0x3e, 0x63, 0x6f, 0x6e,
- 0x76, 0x65, 0x72, 0x74, 0x76, 0x69, 0x6f, 0x6c, 0x65, 0x6e, 0x74, 0x65, 0x6e,
- 0x74, 0x65, 0x72, 0x65, 0x64, 0x66, 0x69, 0x72, 0x73, 0x74, 0x22, 0x3e, 0x63,
- 0x69, 0x72, 0x63, 0x75, 0x69, 0x74, 0x46, 0x69, 0x6e, 0x6c, 0x61, 0x6e, 0x64,
- 0x63, 0x68, 0x65, 0x6d, 0x69, 0x73, 0x74, 0x73, 0x68, 0x65, 0x20, 0x77, 0x61,
- 0x73, 0x31, 0x30, 0x70, 0x78, 0x3b, 0x22, 0x3e, 0x61, 0x73, 0x20, 0x73, 0x75,
- 0x63, 0x68, 0x64, 0x69, 0x76, 0x69, 0x64, 0x65, 0x64, 0x3c, 0x2f, 0x73, 0x70,
- 0x61, 0x6e, 0x3e, 0x77, 0x69, 0x6c, 0x6c, 0x20, 0x62, 0x65, 0x6c, 0x69, 0x6e,
- 0x65, 0x20, 0x6f, 0x66, 0x61, 0x20, 0x67, 0x72, 0x65, 0x61, 0x74, 0x6d, 0x79,
- 0x73, 0x74, 0x65, 0x72, 0x79, 0x2f, 0x69, 0x6e, 0x64, 0x65, 0x78, 0x2e, 0x66,
- 0x61, 0x6c, 0x6c, 0x69, 0x6e, 0x67, 0x64, 0x75, 0x65, 0x20, 0x74, 0x6f, 0x20,
- 0x72, 0x61, 0x69, 0x6c, 0x77, 0x61, 0x79, 0x63, 0x6f, 0x6c, 0x6c, 0x65, 0x67,
- 0x65, 0x6d, 0x6f, 0x6e, 0x73, 0x74, 0x65, 0x72, 0x64, 0x65, 0x73, 0x63, 0x65,
- 0x6e, 0x74, 0x69, 0x74, 0x20, 0x77, 0x69, 0x74, 0x68, 0x6e, 0x75, 0x63, 0x6c,
- 0x65, 0x61, 0x72, 0x4a, 0x65, 0x77, 0x69, 0x73, 0x68, 0x20, 0x70, 0x72, 0x6f,
- 0x74, 0x65, 0x73, 0x74, 0x42, 0x72, 0x69, 0x74, 0x69, 0x73, 0x68, 0x66, 0x6c,
- 0x6f, 0x77, 0x65, 0x72, 0x73, 0x70, 0x72, 0x65, 0x64, 0x69, 0x63, 0x74, 0x72,
- 0x65, 0x66, 0x6f, 0x72, 0x6d, 0x73, 0x62, 0x75, 0x74, 0x74, 0x6f, 0x6e, 0x20,
- 0x77, 0x68, 0x6f, 0x20, 0x77, 0x61, 0x73, 0x6c, 0x65, 0x63, 0x74, 0x75, 0x72,
- 0x65, 0x69, 0x6e, 0x73, 0x74, 0x61, 0x6e, 0x74, 0x73, 0x75, 0x69, 0x63, 0x69,
- 0x64, 0x65, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x69, 0x63, 0x70, 0x65, 0x72, 0x69,
- 0x6f, 0x64, 0x73, 0x6d, 0x61, 0x72, 0x6b, 0x65, 0x74, 0x73, 0x53, 0x6f, 0x63,
- 0x69, 0x61, 0x6c, 0x20, 0x66, 0x69, 0x73, 0x68, 0x69, 0x6e, 0x67, 0x63, 0x6f,
- 0x6d, 0x62, 0x69, 0x6e, 0x65, 0x67, 0x72, 0x61, 0x70, 0x68, 0x69, 0x63, 0x77,
- 0x69, 0x6e, 0x6e, 0x65, 0x72, 0x73, 0x3c, 0x62, 0x72, 0x20, 0x2f, 0x3e, 0x3c,
- 0x62, 0x79, 0x20, 0x74, 0x68, 0x65, 0x20, 0x4e, 0x61, 0x74, 0x75, 0x72, 0x61,
- 0x6c, 0x50, 0x72, 0x69, 0x76, 0x61, 0x63, 0x79, 0x63, 0x6f, 0x6f, 0x6b, 0x69,
- 0x65, 0x73, 0x6f, 0x75, 0x74, 0x63, 0x6f, 0x6d, 0x65, 0x72, 0x65, 0x73, 0x6f,
- 0x6c, 0x76, 0x65, 0x53, 0x77, 0x65, 0x64, 0x69, 0x73, 0x68, 0x62, 0x72, 0x69,
- 0x65, 0x66, 0x6c, 0x79, 0x50, 0x65, 0x72, 0x73, 0x69, 0x61, 0x6e, 0x73, 0x6f,
- 0x20, 0x6d, 0x75, 0x63, 0x68, 0x43, 0x65, 0x6e, 0x74, 0x75, 0x72, 0x79, 0x64,
- 0x65, 0x70, 0x69, 0x63, 0x74, 0x73, 0x63, 0x6f, 0x6c, 0x75, 0x6d, 0x6e, 0x73,
- 0x68, 0x6f, 0x75, 0x73, 0x69, 0x6e, 0x67, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
- 0x73, 0x6e, 0x65, 0x78, 0x74, 0x20, 0x74, 0x6f, 0x62, 0x65, 0x61, 0x72, 0x69,
- 0x6e, 0x67, 0x6d, 0x61, 0x70, 0x70, 0x69, 0x6e, 0x67, 0x72, 0x65, 0x76, 0x69,
- 0x73, 0x65, 0x64, 0x6a, 0x51, 0x75, 0x65, 0x72, 0x79, 0x28, 0x2d, 0x77, 0x69,
- 0x64, 0x74, 0x68, 0x3a, 0x74, 0x69, 0x74, 0x6c, 0x65, 0x22, 0x3e, 0x74, 0x6f,
- 0x6f, 0x6c, 0x74, 0x69, 0x70, 0x53, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x64,
- 0x65, 0x73, 0x69, 0x67, 0x6e, 0x73, 0x54, 0x75, 0x72, 0x6b, 0x69, 0x73, 0x68,
- 0x79, 0x6f, 0x75, 0x6e, 0x67, 0x65, 0x72, 0x2e, 0x6d, 0x61, 0x74, 0x63, 0x68,
- 0x28, 0x7d, 0x29, 0x28, 0x29, 0x3b, 0x0a, 0x0a, 0x62, 0x75, 0x72, 0x6e, 0x69,
- 0x6e, 0x67, 0x6f, 0x70, 0x65, 0x72, 0x61, 0x74, 0x65, 0x64, 0x65, 0x67, 0x72,
- 0x65, 0x65, 0x73, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x3d, 0x52, 0x69, 0x63,
- 0x68, 0x61, 0x72, 0x64, 0x63, 0x6c, 0x6f, 0x73, 0x65, 0x6c, 0x79, 0x70, 0x6c,
- 0x61, 0x73, 0x74, 0x69, 0x63, 0x65, 0x6e, 0x74, 0x72, 0x69, 0x65, 0x73, 0x3c,
- 0x2f, 0x74, 0x72, 0x3e, 0x0d, 0x0a, 0x63, 0x6f, 0x6c, 0x6f, 0x72, 0x3a, 0x23,
- 0x75, 0x6c, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x70, 0x6f, 0x73, 0x73, 0x65, 0x73,
- 0x73, 0x72, 0x6f, 0x6c, 0x6c, 0x69, 0x6e, 0x67, 0x70, 0x68, 0x79, 0x73, 0x69,
- 0x63, 0x73, 0x66, 0x61, 0x69, 0x6c, 0x69, 0x6e, 0x67, 0x65, 0x78, 0x65, 0x63,
- 0x75, 0x74, 0x65, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x73, 0x74, 0x6c, 0x69, 0x6e,
- 0x6b, 0x20, 0x74, 0x6f, 0x44, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x3c, 0x62,
- 0x72, 0x20, 0x2f, 0x3e, 0x0a, 0x3a, 0x20, 0x74, 0x72, 0x75, 0x65, 0x2c, 0x63,
- 0x68, 0x61, 0x72, 0x74, 0x65, 0x72, 0x74, 0x6f, 0x75, 0x72, 0x69, 0x73, 0x6d,
- 0x63, 0x6c, 0x61, 0x73, 0x73, 0x69, 0x63, 0x70, 0x72, 0x6f, 0x63, 0x65, 0x65,
- 0x64, 0x65, 0x78, 0x70, 0x6c, 0x61, 0x69, 0x6e, 0x3c, 0x2f, 0x68, 0x31, 0x3e,
- 0x0d, 0x0a, 0x6f, 0x6e, 0x6c, 0x69, 0x6e, 0x65, 0x2e, 0x3f, 0x78, 0x6d, 0x6c,
- 0x20, 0x76, 0x65, 0x68, 0x65, 0x6c, 0x70, 0x69, 0x6e, 0x67, 0x64, 0x69, 0x61,
- 0x6d, 0x6f, 0x6e, 0x64, 0x75, 0x73, 0x65, 0x20, 0x74, 0x68, 0x65, 0x61, 0x69,
- 0x72, 0x6c, 0x69, 0x6e, 0x65, 0x65, 0x6e, 0x64, 0x20, 0x2d, 0x2d, 0x3e, 0x29,
- 0x2e, 0x61, 0x74, 0x74, 0x72, 0x28, 0x72, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73,
- 0x68, 0x6f, 0x73, 0x74, 0x69, 0x6e, 0x67, 0x23, 0x66, 0x66, 0x66, 0x66, 0x66,
- 0x66, 0x72, 0x65, 0x61, 0x6c, 0x69, 0x7a, 0x65, 0x56, 0x69, 0x6e, 0x63, 0x65,
- 0x6e, 0x74, 0x73, 0x69, 0x67, 0x6e, 0x61, 0x6c, 0x73, 0x20, 0x73, 0x72, 0x63,
- 0x3d, 0x22, 0x2f, 0x50, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x74, 0x64, 0x65, 0x73,
- 0x70, 0x69, 0x74, 0x65, 0x64, 0x69, 0x76, 0x65, 0x72, 0x73, 0x65, 0x74, 0x65,
- 0x6c, 0x6c, 0x69, 0x6e, 0x67, 0x50, 0x75, 0x62, 0x6c, 0x69, 0x63, 0x20, 0x68,
- 0x65, 0x6c, 0x64, 0x20, 0x69, 0x6e, 0x4a, 0x6f, 0x73, 0x65, 0x70, 0x68, 0x20,
- 0x74, 0x68, 0x65, 0x61, 0x74, 0x72, 0x65, 0x61, 0x66, 0x66, 0x65, 0x63, 0x74,
- 0x73, 0x3c, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3e, 0x61, 0x20, 0x6c, 0x61, 0x72,
- 0x67, 0x65, 0x64, 0x6f, 0x65, 0x73, 0x6e, 0x27, 0x74, 0x6c, 0x61, 0x74, 0x65,
- 0x72, 0x2c, 0x20, 0x45, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x66, 0x61, 0x76,
- 0x69, 0x63, 0x6f, 0x6e, 0x63, 0x72, 0x65, 0x61, 0x74, 0x6f, 0x72, 0x48, 0x75,
- 0x6e, 0x67, 0x61, 0x72, 0x79, 0x41, 0x69, 0x72, 0x70, 0x6f, 0x72, 0x74, 0x73,
- 0x65, 0x65, 0x20, 0x74, 0x68, 0x65, 0x73, 0x6f, 0x20, 0x74, 0x68, 0x61, 0x74,
- 0x4d, 0x69, 0x63, 0x68, 0x61, 0x65, 0x6c, 0x53, 0x79, 0x73, 0x74, 0x65, 0x6d,
- 0x73, 0x50, 0x72, 0x6f, 0x67, 0x72, 0x61, 0x6d, 0x73, 0x2c, 0x20, 0x61, 0x6e,
- 0x64, 0x20, 0x20, 0x77, 0x69, 0x64, 0x74, 0x68, 0x3d, 0x65, 0x26, 0x71, 0x75,
- 0x6f, 0x74, 0x3b, 0x74, 0x72, 0x61, 0x64, 0x69, 0x6e, 0x67, 0x6c, 0x65, 0x66,
- 0x74, 0x22, 0x3e, 0x0a, 0x70, 0x65, 0x72, 0x73, 0x6f, 0x6e, 0x73, 0x47, 0x6f,
- 0x6c, 0x64, 0x65, 0x6e, 0x20, 0x41, 0x66, 0x66, 0x61, 0x69, 0x72, 0x73, 0x67,
- 0x72, 0x61, 0x6d, 0x6d, 0x61, 0x72, 0x66, 0x6f, 0x72, 0x6d, 0x69, 0x6e, 0x67,
- 0x64, 0x65, 0x73, 0x74, 0x72, 0x6f, 0x79, 0x69, 0x64, 0x65, 0x61, 0x20, 0x6f,
- 0x66, 0x63, 0x61, 0x73, 0x65, 0x20, 0x6f, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x73,
- 0x74, 0x20, 0x74, 0x68, 0x69, 0x73, 0x20, 0x69, 0x73, 0x2e, 0x73, 0x72, 0x63,
- 0x20, 0x3d, 0x20, 0x63, 0x61, 0x72, 0x74, 0x6f, 0x6f, 0x6e, 0x72, 0x65, 0x67,
- 0x69, 0x73, 0x74, 0x72, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x73, 0x4d, 0x75,
- 0x73, 0x6c, 0x69, 0x6d, 0x73, 0x57, 0x68, 0x61, 0x74, 0x20, 0x69, 0x73, 0x69,
- 0x6e, 0x20, 0x6d, 0x61, 0x6e, 0x79, 0x6d, 0x61, 0x72, 0x6b, 0x69, 0x6e, 0x67,
- 0x72, 0x65, 0x76, 0x65, 0x61, 0x6c, 0x73, 0x49, 0x6e, 0x64, 0x65, 0x65, 0x64,
- 0x2c, 0x65, 0x71, 0x75, 0x61, 0x6c, 0x6c, 0x79, 0x2f, 0x73, 0x68, 0x6f, 0x77,
- 0x5f, 0x61, 0x6f, 0x75, 0x74, 0x64, 0x6f, 0x6f, 0x72, 0x65, 0x73, 0x63, 0x61,
- 0x70, 0x65, 0x28, 0x41, 0x75, 0x73, 0x74, 0x72, 0x69, 0x61, 0x67, 0x65, 0x6e,
- 0x65, 0x74, 0x69, 0x63, 0x73, 0x79, 0x73, 0x74, 0x65, 0x6d, 0x2c, 0x49, 0x6e,
- 0x20, 0x74, 0x68, 0x65, 0x20, 0x73, 0x69, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x48,
- 0x65, 0x20, 0x61, 0x6c, 0x73, 0x6f, 0x49, 0x73, 0x6c, 0x61, 0x6e, 0x64, 0x73,
- 0x41, 0x63, 0x61, 0x64, 0x65, 0x6d, 0x79, 0x0a, 0x09, 0x09, 0x3c, 0x21, 0x2d,
- 0x2d, 0x44, 0x61, 0x6e, 0x69, 0x65, 0x6c, 0x20, 0x62, 0x69, 0x6e, 0x64, 0x69,
- 0x6e, 0x67, 0x62, 0x6c, 0x6f, 0x63, 0x6b, 0x22, 0x3e, 0x69, 0x6d, 0x70, 0x6f,
- 0x73, 0x65, 0x64, 0x75, 0x74, 0x69, 0x6c, 0x69, 0x7a, 0x65, 0x41, 0x62, 0x72,
- 0x61, 0x68, 0x61, 0x6d, 0x28, 0x65, 0x78, 0x63, 0x65, 0x70, 0x74, 0x7b, 0x77,
- 0x69, 0x64, 0x74, 0x68, 0x3a, 0x70, 0x75, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x29,
- 0x2e, 0x68, 0x74, 0x6d, 0x6c, 0x28, 0x7c, 0x7c, 0x20, 0x5b, 0x5d, 0x3b, 0x0a,
- 0x44, 0x41, 0x54, 0x41, 0x5b, 0x20, 0x2a, 0x6b, 0x69, 0x74, 0x63, 0x68, 0x65,
- 0x6e, 0x6d, 0x6f, 0x75, 0x6e, 0x74, 0x65, 0x64, 0x61, 0x63, 0x74, 0x75, 0x61,
- 0x6c, 0x20, 0x64, 0x69, 0x61, 0x6c, 0x65, 0x63, 0x74, 0x6d, 0x61, 0x69, 0x6e,
- 0x6c, 0x79, 0x20, 0x5f, 0x62, 0x6c, 0x61, 0x6e, 0x6b, 0x27, 0x69, 0x6e, 0x73,
- 0x74, 0x61, 0x6c, 0x6c, 0x65, 0x78, 0x70, 0x65, 0x72, 0x74, 0x73, 0x69, 0x66,
- 0x28, 0x74, 0x79, 0x70, 0x65, 0x49, 0x74, 0x20, 0x61, 0x6c, 0x73, 0x6f, 0x26,
- 0x63, 0x6f, 0x70, 0x79, 0x3b, 0x20, 0x22, 0x3e, 0x54, 0x65, 0x72, 0x6d, 0x73,
- 0x62, 0x6f, 0x72, 0x6e, 0x20, 0x69, 0x6e, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e,
- 0x73, 0x65, 0x61, 0x73, 0x74, 0x65, 0x72, 0x6e, 0x74, 0x61, 0x6c, 0x6b, 0x69,
- 0x6e, 0x67, 0x63, 0x6f, 0x6e, 0x63, 0x65, 0x72, 0x6e, 0x67, 0x61, 0x69, 0x6e,
- 0x65, 0x64, 0x20, 0x6f, 0x6e, 0x67, 0x6f, 0x69, 0x6e, 0x67, 0x6a, 0x75, 0x73,
- 0x74, 0x69, 0x66, 0x79, 0x63, 0x72, 0x69, 0x74, 0x69, 0x63, 0x73, 0x66, 0x61,
- 0x63, 0x74, 0x6f, 0x72, 0x79, 0x69, 0x74, 0x73, 0x20, 0x6f, 0x77, 0x6e, 0x61,
- 0x73, 0x73, 0x61, 0x75, 0x6c, 0x74, 0x69, 0x6e, 0x76, 0x69, 0x74, 0x65, 0x64,
- 0x6c, 0x61, 0x73, 0x74, 0x69, 0x6e, 0x67, 0x68, 0x69, 0x73, 0x20, 0x6f, 0x77,
- 0x6e, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x2f, 0x22, 0x20, 0x72, 0x65, 0x6c,
- 0x3d, 0x22, 0x64, 0x65, 0x76, 0x65, 0x6c, 0x6f, 0x70, 0x63, 0x6f, 0x6e, 0x63,
- 0x65, 0x72, 0x74, 0x64, 0x69, 0x61, 0x67, 0x72, 0x61, 0x6d, 0x64, 0x6f, 0x6c,
- 0x6c, 0x61, 0x72, 0x73, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x70, 0x68,
- 0x70, 0x3f, 0x69, 0x64, 0x3d, 0x61, 0x6c, 0x63, 0x6f, 0x68, 0x6f, 0x6c, 0x29,
- 0x3b, 0x7d, 0x29, 0x28, 0x29, 0x3b, 0x75, 0x73, 0x69, 0x6e, 0x67, 0x20, 0x61,
- 0x3e, 0x3c, 0x73, 0x70, 0x61, 0x6e, 0x3e, 0x76, 0x65, 0x73, 0x73, 0x65, 0x6c,
- 0x73, 0x72, 0x65, 0x76, 0x69, 0x76, 0x61, 0x6c, 0x41, 0x64, 0x64, 0x72, 0x65,
- 0x73, 0x73, 0x61, 0x6d, 0x61, 0x74, 0x65, 0x75, 0x72, 0x61, 0x6e, 0x64, 0x72,
- 0x6f, 0x69, 0x64, 0x61, 0x6c, 0x6c, 0x65, 0x67, 0x65, 0x64, 0x69, 0x6c, 0x6c,
- 0x6e, 0x65, 0x73, 0x73, 0x77, 0x61, 0x6c, 0x6b, 0x69, 0x6e, 0x67, 0x63, 0x65,
- 0x6e, 0x74, 0x65, 0x72, 0x73, 0x71, 0x75, 0x61, 0x6c, 0x69, 0x66, 0x79, 0x6d,
- 0x61, 0x74, 0x63, 0x68, 0x65, 0x73, 0x75, 0x6e, 0x69, 0x66, 0x69, 0x65, 0x64,
- 0x65, 0x78, 0x74, 0x69, 0x6e, 0x63, 0x74, 0x44, 0x65, 0x66, 0x65, 0x6e, 0x73,
- 0x65, 0x64, 0x69, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x0a, 0x09, 0x3c, 0x21, 0x2d,
- 0x2d, 0x20, 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x73, 0x6c, 0x69, 0x6e, 0x6b,
- 0x69, 0x6e, 0x67, 0x4c, 0x69, 0x74, 0x74, 0x6c, 0x65, 0x20, 0x42, 0x6f, 0x6f,
- 0x6b, 0x20, 0x6f, 0x66, 0x65, 0x76, 0x65, 0x6e, 0x69, 0x6e, 0x67, 0x6d, 0x69,
- 0x6e, 0x2e, 0x6a, 0x73, 0x3f, 0x61, 0x72, 0x65, 0x20, 0x74, 0x68, 0x65, 0x6b,
- 0x6f, 0x6e, 0x74, 0x61, 0x6b, 0x74, 0x74, 0x6f, 0x64, 0x61, 0x79, 0x27, 0x73,
- 0x2e, 0x68, 0x74, 0x6d, 0x6c, 0x22, 0x20, 0x74, 0x61, 0x72, 0x67, 0x65, 0x74,
- 0x3d, 0x77, 0x65, 0x61, 0x72, 0x69, 0x6e, 0x67, 0x41, 0x6c, 0x6c, 0x20, 0x52,
- 0x69, 0x67, 0x3b, 0x0a, 0x7d, 0x29, 0x28, 0x29, 0x3b, 0x72, 0x61, 0x69, 0x73,
- 0x69, 0x6e, 0x67, 0x20, 0x41, 0x6c, 0x73, 0x6f, 0x2c, 0x20, 0x63, 0x72, 0x75,
- 0x63, 0x69, 0x61, 0x6c, 0x61, 0x62, 0x6f, 0x75, 0x74, 0x22, 0x3e, 0x64, 0x65,
- 0x63, 0x6c, 0x61, 0x72, 0x65, 0x2d, 0x2d, 0x3e, 0x0a, 0x3c, 0x73, 0x63, 0x66,
- 0x69, 0x72, 0x65, 0x66, 0x6f, 0x78, 0x61, 0x73, 0x20, 0x6d, 0x75, 0x63, 0x68,
- 0x61, 0x70, 0x70, 0x6c, 0x69, 0x65, 0x73, 0x69, 0x6e, 0x64, 0x65, 0x78, 0x2c,
- 0x20, 0x73, 0x2c, 0x20, 0x62, 0x75, 0x74, 0x20, 0x74, 0x79, 0x70, 0x65, 0x20,
- 0x3d, 0x20, 0x0a, 0x0d, 0x0a, 0x3c, 0x21, 0x2d, 0x2d, 0x74, 0x6f, 0x77, 0x61,
- 0x72, 0x64, 0x73, 0x52, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x73, 0x50, 0x72, 0x69,
- 0x76, 0x61, 0x74, 0x65, 0x46, 0x6f, 0x72, 0x65, 0x69, 0x67, 0x6e, 0x50, 0x72,
- 0x65, 0x6d, 0x69, 0x65, 0x72, 0x63, 0x68, 0x6f, 0x69, 0x63, 0x65, 0x73, 0x56,
- 0x69, 0x72, 0x74, 0x75, 0x61, 0x6c, 0x72, 0x65, 0x74, 0x75, 0x72, 0x6e, 0x73,
- 0x43, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x50, 0x6f, 0x77, 0x65, 0x72, 0x65,
- 0x64, 0x69, 0x6e, 0x6c, 0x69, 0x6e, 0x65, 0x3b, 0x70, 0x6f, 0x76, 0x65, 0x72,
- 0x74, 0x79, 0x63, 0x68, 0x61, 0x6d, 0x62, 0x65, 0x72, 0x4c, 0x69, 0x76, 0x69,
- 0x6e, 0x67, 0x20, 0x76, 0x6f, 0x6c, 0x75, 0x6d, 0x65, 0x73, 0x41, 0x6e, 0x74,
- 0x68, 0x6f, 0x6e, 0x79, 0x6c, 0x6f, 0x67, 0x69, 0x6e, 0x22, 0x20, 0x52, 0x65,
- 0x6c, 0x61, 0x74, 0x65, 0x64, 0x45, 0x63, 0x6f, 0x6e, 0x6f, 0x6d, 0x79, 0x72,
- 0x65, 0x61, 0x63, 0x68, 0x65, 0x73, 0x63, 0x75, 0x74, 0x74, 0x69, 0x6e, 0x67,
- 0x67, 0x72, 0x61, 0x76, 0x69, 0x74, 0x79, 0x6c, 0x69, 0x66, 0x65, 0x20, 0x69,
- 0x6e, 0x43, 0x68, 0x61, 0x70, 0x74, 0x65, 0x72, 0x2d, 0x73, 0x68, 0x61, 0x64,
- 0x6f, 0x77, 0x4e, 0x6f, 0x74, 0x61, 0x62, 0x6c, 0x65, 0x3c, 0x2f, 0x74, 0x64,
- 0x3e, 0x0d, 0x0a, 0x20, 0x72, 0x65, 0x74, 0x75, 0x72, 0x6e, 0x73, 0x74, 0x61,
- 0x64, 0x69, 0x75, 0x6d, 0x77, 0x69, 0x64, 0x67, 0x65, 0x74, 0x73, 0x76, 0x61,
- 0x72, 0x79, 0x69, 0x6e, 0x67, 0x74, 0x72, 0x61, 0x76, 0x65, 0x6c, 0x73, 0x68,
- 0x65, 0x6c, 0x64, 0x20, 0x62, 0x79, 0x77, 0x68, 0x6f, 0x20, 0x61, 0x72, 0x65,
- 0x77, 0x6f, 0x72, 0x6b, 0x20, 0x69, 0x6e, 0x66, 0x61, 0x63, 0x75, 0x6c, 0x74,
- 0x79, 0x61, 0x6e, 0x67, 0x75, 0x6c, 0x61, 0x72, 0x77, 0x68, 0x6f, 0x20, 0x68,
- 0x61, 0x64, 0x61, 0x69, 0x72, 0x70, 0x6f, 0x72, 0x74, 0x74, 0x6f, 0x77, 0x6e,
- 0x20, 0x6f, 0x66, 0x0a, 0x0a, 0x53, 0x6f, 0x6d, 0x65, 0x20, 0x27, 0x63, 0x6c,
- 0x69, 0x63, 0x6b, 0x27, 0x63, 0x68, 0x61, 0x72, 0x67, 0x65, 0x73, 0x6b, 0x65,
- 0x79, 0x77, 0x6f, 0x72, 0x64, 0x69, 0x74, 0x20, 0x77, 0x69, 0x6c, 0x6c, 0x63,
- 0x69, 0x74, 0x79, 0x20, 0x6f, 0x66, 0x28, 0x74, 0x68, 0x69, 0x73, 0x29, 0x3b,
- 0x41, 0x6e, 0x64, 0x72, 0x65, 0x77, 0x20, 0x75, 0x6e, 0x69, 0x71, 0x75, 0x65,
- 0x20, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x65, 0x64, 0x6f, 0x72, 0x20, 0x6d, 0x6f,
- 0x72, 0x65, 0x33, 0x30, 0x30, 0x70, 0x78, 0x3b, 0x20, 0x72, 0x65, 0x74, 0x75,
- 0x72, 0x6e, 0x3b, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x3d, 0x22, 0x70, 0x6c, 0x75,
- 0x67, 0x69, 0x6e, 0x73, 0x77, 0x69, 0x74, 0x68, 0x69, 0x6e, 0x20, 0x68, 0x65,
- 0x72, 0x73, 0x65, 0x6c, 0x66, 0x53, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x46,
- 0x65, 0x64, 0x65, 0x72, 0x61, 0x6c, 0x76, 0x65, 0x6e, 0x74, 0x75, 0x72, 0x65,
- 0x70, 0x75, 0x62, 0x6c, 0x69, 0x73, 0x68, 0x73, 0x65, 0x6e, 0x74, 0x20, 0x74,
- 0x6f, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x61, 0x63, 0x74, 0x72, 0x65,
- 0x73, 0x73, 0x63, 0x6f, 0x6d, 0x65, 0x20, 0x74, 0x6f, 0x66, 0x69, 0x6e, 0x67,
- 0x65, 0x72, 0x73, 0x44, 0x75, 0x6b, 0x65, 0x20, 0x6f, 0x66, 0x70, 0x65, 0x6f,
- 0x70, 0x6c, 0x65, 0x2c, 0x65, 0x78, 0x70, 0x6c, 0x6f, 0x69, 0x74, 0x77, 0x68,
- 0x61, 0x74, 0x20, 0x69, 0x73, 0x68, 0x61, 0x72, 0x6d, 0x6f, 0x6e, 0x79, 0x61,
- 0x20, 0x6d, 0x61, 0x6a, 0x6f, 0x72, 0x22, 0x3a, 0x22, 0x68, 0x74, 0x74, 0x70,
- 0x69, 0x6e, 0x20, 0x68, 0x69, 0x73, 0x20, 0x6d, 0x65, 0x6e, 0x75, 0x22, 0x3e,
- 0x0a, 0x6d, 0x6f, 0x6e, 0x74, 0x68, 0x6c, 0x79, 0x6f, 0x66, 0x66, 0x69, 0x63,
- 0x65, 0x72, 0x63, 0x6f, 0x75, 0x6e, 0x63, 0x69, 0x6c, 0x67, 0x61, 0x69, 0x6e,
- 0x69, 0x6e, 0x67, 0x65, 0x76, 0x65, 0x6e, 0x20, 0x69, 0x6e, 0x53, 0x75, 0x6d,
- 0x6d, 0x61, 0x72, 0x79, 0x64, 0x61, 0x74, 0x65, 0x20, 0x6f, 0x66, 0x6c, 0x6f,
- 0x79, 0x61, 0x6c, 0x74, 0x79, 0x66, 0x69, 0x74, 0x6e, 0x65, 0x73, 0x73, 0x61,
- 0x6e, 0x64, 0x20, 0x77, 0x61, 0x73, 0x65, 0x6d, 0x70, 0x65, 0x72, 0x6f, 0x72,
- 0x73, 0x75, 0x70, 0x72, 0x65, 0x6d, 0x65, 0x53, 0x65, 0x63, 0x6f, 0x6e, 0x64,
- 0x20, 0x68, 0x65, 0x61, 0x72, 0x69, 0x6e, 0x67, 0x52, 0x75, 0x73, 0x73, 0x69,
- 0x61, 0x6e, 0x6c, 0x6f, 0x6e, 0x67, 0x65, 0x73, 0x74, 0x41, 0x6c, 0x62, 0x65,
- 0x72, 0x74, 0x61, 0x6c, 0x61, 0x74, 0x65, 0x72, 0x61, 0x6c, 0x73, 0x65, 0x74,
- 0x20, 0x6f, 0x66, 0x20, 0x73, 0x6d, 0x61, 0x6c, 0x6c, 0x22, 0x3e, 0x2e, 0x61,
- 0x70, 0x70, 0x65, 0x6e, 0x64, 0x64, 0x6f, 0x20, 0x77, 0x69, 0x74, 0x68, 0x66,
- 0x65, 0x64, 0x65, 0x72, 0x61, 0x6c, 0x62, 0x61, 0x6e, 0x6b, 0x20, 0x6f, 0x66,
- 0x62, 0x65, 0x6e, 0x65, 0x61, 0x74, 0x68, 0x44, 0x65, 0x73, 0x70, 0x69, 0x74,
- 0x65, 0x43, 0x61, 0x70, 0x69, 0x74, 0x61, 0x6c, 0x67, 0x72, 0x6f, 0x75, 0x6e,
- 0x64, 0x73, 0x29, 0x2c, 0x20, 0x61, 0x6e, 0x64, 0x20, 0x70, 0x65, 0x72, 0x63,
- 0x65, 0x6e, 0x74, 0x69, 0x74, 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x63, 0x6c, 0x6f,
- 0x73, 0x69, 0x6e, 0x67, 0x63, 0x6f, 0x6e, 0x74, 0x61, 0x69, 0x6e, 0x49, 0x6e,
- 0x73, 0x74, 0x65, 0x61, 0x64, 0x66, 0x69, 0x66, 0x74, 0x65, 0x65, 0x6e, 0x61,
- 0x73, 0x20, 0x77, 0x65, 0x6c, 0x6c, 0x2e, 0x79, 0x61, 0x68, 0x6f, 0x6f, 0x2e,
- 0x72, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x64, 0x66, 0x69, 0x67, 0x68, 0x74, 0x65,
- 0x72, 0x6f, 0x62, 0x73, 0x63, 0x75, 0x72, 0x65, 0x72, 0x65, 0x66, 0x6c, 0x65,
- 0x63, 0x74, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x63, 0x3d, 0x20, 0x4d, 0x61,
- 0x74, 0x68, 0x2e, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6e, 0x67, 0x6f, 0x6e, 0x6c,
- 0x69, 0x6e, 0x65, 0x20, 0x70, 0x61, 0x64, 0x64, 0x69, 0x6e, 0x67, 0x61, 0x20,
- 0x77, 0x68, 0x6f, 0x6c, 0x65, 0x6f, 0x6e, 0x65, 0x72, 0x72, 0x6f, 0x72, 0x79,
- 0x65, 0x61, 0x72, 0x20, 0x6f, 0x66, 0x65, 0x6e, 0x64, 0x20, 0x6f, 0x66, 0x20,
- 0x62, 0x61, 0x72, 0x72, 0x69, 0x65, 0x72, 0x77, 0x68, 0x65, 0x6e, 0x20, 0x69,
- 0x74, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x20, 0x68, 0x6f, 0x6d, 0x65, 0x20,
- 0x6f, 0x66, 0x72, 0x65, 0x73, 0x75, 0x6d, 0x65, 0x64, 0x72, 0x65, 0x6e, 0x61,
- 0x6d, 0x65, 0x64, 0x73, 0x74, 0x72, 0x6f, 0x6e, 0x67, 0x3e, 0x68, 0x65, 0x61,
- 0x74, 0x69, 0x6e, 0x67, 0x72, 0x65, 0x74, 0x61, 0x69, 0x6e, 0x73, 0x63, 0x6c,
- 0x6f, 0x75, 0x64, 0x66, 0x72, 0x77, 0x61, 0x79, 0x20, 0x6f, 0x66, 0x20, 0x4d,
- 0x61, 0x72, 0x63, 0x68, 0x20, 0x31, 0x6b, 0x6e, 0x6f, 0x77, 0x69, 0x6e, 0x67,
- 0x69, 0x6e, 0x20, 0x70, 0x61, 0x72, 0x74, 0x42, 0x65, 0x74, 0x77, 0x65, 0x65,
- 0x6e, 0x6c, 0x65, 0x73, 0x73, 0x6f, 0x6e, 0x73, 0x63, 0x6c, 0x6f, 0x73, 0x65,
- 0x73, 0x74, 0x76, 0x69, 0x72, 0x74, 0x75, 0x61, 0x6c, 0x6c, 0x69, 0x6e, 0x6b,
- 0x73, 0x22, 0x3e, 0x63, 0x72, 0x6f, 0x73, 0x73, 0x65, 0x64, 0x45, 0x4e, 0x44,
- 0x20, 0x2d, 0x2d, 0x3e, 0x66, 0x61, 0x6d, 0x6f, 0x75, 0x73, 0x20, 0x61, 0x77,
- 0x61, 0x72, 0x64, 0x65, 0x64, 0x4c, 0x69, 0x63, 0x65, 0x6e, 0x73, 0x65, 0x48,
- 0x65, 0x61, 0x6c, 0x74, 0x68, 0x20, 0x66, 0x61, 0x69, 0x72, 0x6c, 0x79, 0x20,
- 0x77, 0x65, 0x61, 0x6c, 0x74, 0x68, 0x79, 0x6d, 0x69, 0x6e, 0x69, 0x6d, 0x61,
- 0x6c, 0x41, 0x66, 0x72, 0x69, 0x63, 0x61, 0x6e, 0x63, 0x6f, 0x6d, 0x70, 0x65,
- 0x74, 0x65, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x22, 0x3e, 0x73, 0x69, 0x6e, 0x67,
- 0x69, 0x6e, 0x67, 0x66, 0x61, 0x72, 0x6d, 0x65, 0x72, 0x73, 0x42, 0x72, 0x61,
- 0x73, 0x69, 0x6c, 0x29, 0x64, 0x69, 0x73, 0x63, 0x75, 0x73, 0x73, 0x72, 0x65,
- 0x70, 0x6c, 0x61, 0x63, 0x65, 0x47, 0x72, 0x65, 0x67, 0x6f, 0x72, 0x79, 0x66,
- 0x6f, 0x6e, 0x74, 0x20, 0x63, 0x6f, 0x70, 0x75, 0x72, 0x73, 0x75, 0x65, 0x64,
- 0x61, 0x70, 0x70, 0x65, 0x61, 0x72, 0x73, 0x6d, 0x61, 0x6b, 0x65, 0x20, 0x75,
- 0x70, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x65, 0x64, 0x62, 0x6f, 0x74, 0x68, 0x20,
- 0x6f, 0x66, 0x62, 0x6c, 0x6f, 0x63, 0x6b, 0x65, 0x64, 0x73, 0x61, 0x77, 0x20,
- 0x74, 0x68, 0x65, 0x6f, 0x66, 0x66, 0x69, 0x63, 0x65, 0x73, 0x63, 0x6f, 0x6c,
- 0x6f, 0x75, 0x72, 0x73, 0x69, 0x66, 0x28, 0x64, 0x6f, 0x63, 0x75, 0x77, 0x68,
- 0x65, 0x6e, 0x20, 0x68, 0x65, 0x65, 0x6e, 0x66, 0x6f, 0x72, 0x63, 0x65, 0x70,
- 0x75, 0x73, 0x68, 0x28, 0x66, 0x75, 0x41, 0x75, 0x67, 0x75, 0x73, 0x74, 0x20,
- 0x55, 0x54, 0x46, 0x2d, 0x38, 0x22, 0x3e, 0x46, 0x61, 0x6e, 0x74, 0x61, 0x73,
- 0x79, 0x69, 0x6e, 0x20, 0x6d, 0x6f, 0x73, 0x74, 0x69, 0x6e, 0x6a, 0x75, 0x72,
- 0x65, 0x64, 0x55, 0x73, 0x75, 0x61, 0x6c, 0x6c, 0x79, 0x66, 0x61, 0x72, 0x6d,
- 0x69, 0x6e, 0x67, 0x63, 0x6c, 0x6f, 0x73, 0x75, 0x72, 0x65, 0x6f, 0x62, 0x6a,
- 0x65, 0x63, 0x74, 0x20, 0x64, 0x65, 0x66, 0x65, 0x6e, 0x63, 0x65, 0x75, 0x73,
- 0x65, 0x20, 0x6f, 0x66, 0x20, 0x4d, 0x65, 0x64, 0x69, 0x63, 0x61, 0x6c, 0x3c,
- 0x62, 0x6f, 0x64, 0x79, 0x3e, 0x0a, 0x65, 0x76, 0x69, 0x64, 0x65, 0x6e, 0x74,
- 0x62, 0x65, 0x20, 0x75, 0x73, 0x65, 0x64, 0x6b, 0x65, 0x79, 0x43, 0x6f, 0x64,
- 0x65, 0x73, 0x69, 0x78, 0x74, 0x65, 0x65, 0x6e, 0x49, 0x73, 0x6c, 0x61, 0x6d,
- 0x69, 0x63, 0x23, 0x30, 0x30, 0x30, 0x30, 0x30, 0x30, 0x65, 0x6e, 0x74, 0x69,
- 0x72, 0x65, 0x20, 0x77, 0x69, 0x64, 0x65, 0x6c, 0x79, 0x20, 0x61, 0x63, 0x74,
- 0x69, 0x76, 0x65, 0x20, 0x28, 0x74, 0x79, 0x70, 0x65, 0x6f, 0x66, 0x6f, 0x6e,
- 0x65, 0x20, 0x63, 0x61, 0x6e, 0x63, 0x6f, 0x6c, 0x6f, 0x72, 0x20, 0x3d, 0x73,
- 0x70, 0x65, 0x61, 0x6b, 0x65, 0x72, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x64, 0x73,
- 0x50, 0x68, 0x79, 0x73, 0x69, 0x63, 0x73, 0x74, 0x65, 0x72, 0x72, 0x61, 0x69,
- 0x6e, 0x3c, 0x74, 0x62, 0x6f, 0x64, 0x79, 0x3e, 0x66, 0x75, 0x6e, 0x65, 0x72,
- 0x61, 0x6c, 0x76, 0x69, 0x65, 0x77, 0x69, 0x6e, 0x67, 0x6d, 0x69, 0x64, 0x64,
- 0x6c, 0x65, 0x20, 0x63, 0x72, 0x69, 0x63, 0x6b, 0x65, 0x74, 0x70, 0x72, 0x6f,
- 0x70, 0x68, 0x65, 0x74, 0x73, 0x68, 0x69, 0x66, 0x74, 0x65, 0x64, 0x64, 0x6f,
- 0x63, 0x74, 0x6f, 0x72, 0x73, 0x52, 0x75, 0x73, 0x73, 0x65, 0x6c, 0x6c, 0x20,
- 0x74, 0x61, 0x72, 0x67, 0x65, 0x74, 0x63, 0x6f, 0x6d, 0x70, 0x61, 0x63, 0x74,
- 0x61, 0x6c, 0x67, 0x65, 0x62, 0x72, 0x61, 0x73, 0x6f, 0x63, 0x69, 0x61, 0x6c,
- 0x2d, 0x62, 0x75, 0x6c, 0x6b, 0x20, 0x6f, 0x66, 0x6d, 0x61, 0x6e, 0x20, 0x61,
- 0x6e, 0x64, 0x3c, 0x2f, 0x74, 0x64, 0x3e, 0x0a, 0x20, 0x68, 0x65, 0x20, 0x6c,
- 0x65, 0x66, 0x74, 0x29, 0x2e, 0x76, 0x61, 0x6c, 0x28, 0x29, 0x66, 0x61, 0x6c,
- 0x73, 0x65, 0x29, 0x3b, 0x6c, 0x6f, 0x67, 0x69, 0x63, 0x61, 0x6c, 0x62, 0x61,
- 0x6e, 0x6b, 0x69, 0x6e, 0x67, 0x68, 0x6f, 0x6d, 0x65, 0x20, 0x74, 0x6f, 0x6e,
- 0x61, 0x6d, 0x69, 0x6e, 0x67, 0x20, 0x41, 0x72, 0x69, 0x7a, 0x6f, 0x6e, 0x61,
- 0x63, 0x72, 0x65, 0x64, 0x69, 0x74, 0x73, 0x29, 0x3b, 0x0a, 0x7d, 0x29, 0x3b,
- 0x0a, 0x66, 0x6f, 0x75, 0x6e, 0x64, 0x65, 0x72, 0x69, 0x6e, 0x20, 0x74, 0x75,
- 0x72, 0x6e, 0x43, 0x6f, 0x6c, 0x6c, 0x69, 0x6e, 0x73, 0x62, 0x65, 0x66, 0x6f,
- 0x72, 0x65, 0x20, 0x42, 0x75, 0x74, 0x20, 0x74, 0x68, 0x65, 0x63, 0x68, 0x61,
- 0x72, 0x67, 0x65, 0x64, 0x54, 0x69, 0x74, 0x6c, 0x65, 0x22, 0x3e, 0x43, 0x61,
- 0x70, 0x74, 0x61, 0x69, 0x6e, 0x73, 0x70, 0x65, 0x6c, 0x6c, 0x65, 0x64, 0x67,
- 0x6f, 0x64, 0x64, 0x65, 0x73, 0x73, 0x54, 0x61, 0x67, 0x20, 0x2d, 0x2d, 0x3e,
- 0x41, 0x64, 0x64, 0x69, 0x6e, 0x67, 0x3a, 0x62, 0x75, 0x74, 0x20, 0x77, 0x61,
- 0x73, 0x52, 0x65, 0x63, 0x65, 0x6e, 0x74, 0x20, 0x70, 0x61, 0x74, 0x69, 0x65,
- 0x6e, 0x74, 0x62, 0x61, 0x63, 0x6b, 0x20, 0x69, 0x6e, 0x3d, 0x66, 0x61, 0x6c,
- 0x73, 0x65, 0x26, 0x4c, 0x69, 0x6e, 0x63, 0x6f, 0x6c, 0x6e, 0x77, 0x65, 0x20,
- 0x6b, 0x6e, 0x6f, 0x77, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x65, 0x72, 0x4a, 0x75,
- 0x64, 0x61, 0x69, 0x73, 0x6d, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x20, 0x61,
- 0x6c, 0x74, 0x65, 0x72, 0x65, 0x64, 0x27, 0x5d, 0x29, 0x3b, 0x0a, 0x20, 0x20,
- 0x68, 0x61, 0x73, 0x20, 0x74, 0x68, 0x65, 0x75, 0x6e, 0x63, 0x6c, 0x65, 0x61,
- 0x72, 0x45, 0x76, 0x65, 0x6e, 0x74, 0x27, 0x2c, 0x62, 0x6f, 0x74, 0x68, 0x20,
- 0x69, 0x6e, 0x6e, 0x6f, 0x74, 0x20, 0x61, 0x6c, 0x6c, 0x0a, 0x0a, 0x3c, 0x21,
- 0x2d, 0x2d, 0x20, 0x70, 0x6c, 0x61, 0x63, 0x69, 0x6e, 0x67, 0x68, 0x61, 0x72,
- 0x64, 0x20, 0x74, 0x6f, 0x20, 0x63, 0x65, 0x6e, 0x74, 0x65, 0x72, 0x73, 0x6f,
- 0x72, 0x74, 0x20, 0x6f, 0x66, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x73, 0x73,
- 0x74, 0x72, 0x65, 0x65, 0x74, 0x73, 0x42, 0x65, 0x72, 0x6e, 0x61, 0x72, 0x64,
- 0x61, 0x73, 0x73, 0x65, 0x72, 0x74, 0x73, 0x74, 0x65, 0x6e, 0x64, 0x20, 0x74,
- 0x6f, 0x66, 0x61, 0x6e, 0x74, 0x61, 0x73, 0x79, 0x64, 0x6f, 0x77, 0x6e, 0x20,
- 0x69, 0x6e, 0x68, 0x61, 0x72, 0x62, 0x6f, 0x75, 0x72, 0x46, 0x72, 0x65, 0x65,
- 0x64, 0x6f, 0x6d, 0x6a, 0x65, 0x77, 0x65, 0x6c, 0x72, 0x79, 0x2f, 0x61, 0x62,
- 0x6f, 0x75, 0x74, 0x2e, 0x2e, 0x73, 0x65, 0x61, 0x72, 0x63, 0x68, 0x6c, 0x65,
- 0x67, 0x65, 0x6e, 0x64, 0x73, 0x69, 0x73, 0x20, 0x6d, 0x61, 0x64, 0x65, 0x6d,
- 0x6f, 0x64, 0x65, 0x72, 0x6e, 0x20, 0x6f, 0x6e, 0x6c, 0x79, 0x20, 0x6f, 0x6e,
- 0x6f, 0x6e, 0x6c, 0x79, 0x20, 0x74, 0x6f, 0x69, 0x6d, 0x61, 0x67, 0x65, 0x22,
- 0x20, 0x6c, 0x69, 0x6e, 0x65, 0x61, 0x72, 0x20, 0x70, 0x61, 0x69, 0x6e, 0x74,
- 0x65, 0x72, 0x61, 0x6e, 0x64, 0x20, 0x6e, 0x6f, 0x74, 0x72, 0x61, 0x72, 0x65,
- 0x6c, 0x79, 0x20, 0x61, 0x63, 0x72, 0x6f, 0x6e, 0x79, 0x6d, 0x64, 0x65, 0x6c,
- 0x69, 0x76, 0x65, 0x72, 0x73, 0x68, 0x6f, 0x72, 0x74, 0x65, 0x72, 0x30, 0x30,
- 0x26, 0x61, 0x6d, 0x70, 0x3b, 0x61, 0x73, 0x20, 0x6d, 0x61, 0x6e, 0x79, 0x77,
- 0x69, 0x64, 0x74, 0x68, 0x3d, 0x22, 0x2f, 0x2a, 0x20, 0x3c, 0x21, 0x5b, 0x43,
- 0x74, 0x69, 0x74, 0x6c, 0x65, 0x20, 0x3d, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65,
- 0x20, 0x6c, 0x6f, 0x77, 0x65, 0x73, 0x74, 0x20, 0x70, 0x69, 0x63, 0x6b, 0x65,
- 0x64, 0x20, 0x65, 0x73, 0x63, 0x61, 0x70, 0x65, 0x64, 0x75, 0x73, 0x65, 0x73,
- 0x20, 0x6f, 0x66, 0x70, 0x65, 0x6f, 0x70, 0x6c, 0x65, 0x73, 0x20, 0x50, 0x75,
- 0x62, 0x6c, 0x69, 0x63, 0x4d, 0x61, 0x74, 0x74, 0x68, 0x65, 0x77, 0x74, 0x61,
- 0x63, 0x74, 0x69, 0x63, 0x73, 0x64, 0x61, 0x6d, 0x61, 0x67, 0x65, 0x64, 0x77,
- 0x61, 0x79, 0x20, 0x66, 0x6f, 0x72, 0x6c, 0x61, 0x77, 0x73, 0x20, 0x6f, 0x66,
- 0x65, 0x61, 0x73, 0x79, 0x20, 0x74, 0x6f, 0x20, 0x77, 0x69, 0x6e, 0x64, 0x6f,
- 0x77, 0x73, 0x74, 0x72, 0x6f, 0x6e, 0x67, 0x20, 0x20, 0x73, 0x69, 0x6d, 0x70,
- 0x6c, 0x65, 0x7d, 0x63, 0x61, 0x74, 0x63, 0x68, 0x28, 0x73, 0x65, 0x76, 0x65,
- 0x6e, 0x74, 0x68, 0x69, 0x6e, 0x66, 0x6f, 0x62, 0x6f, 0x78, 0x77, 0x65, 0x6e,
- 0x74, 0x20, 0x74, 0x6f, 0x70, 0x61, 0x69, 0x6e, 0x74, 0x65, 0x64, 0x63, 0x69,
- 0x74, 0x69, 0x7a, 0x65, 0x6e, 0x49, 0x20, 0x64, 0x6f, 0x6e, 0x27, 0x74, 0x72,
- 0x65, 0x74, 0x72, 0x65, 0x61, 0x74, 0x2e, 0x20, 0x53, 0x6f, 0x6d, 0x65, 0x20,
- 0x77, 0x77, 0x2e, 0x22, 0x29, 0x3b, 0x0a, 0x62, 0x6f, 0x6d, 0x62, 0x69, 0x6e,
- 0x67, 0x6d, 0x61, 0x69, 0x6c, 0x74, 0x6f, 0x3a, 0x6d, 0x61, 0x64, 0x65, 0x20,
- 0x69, 0x6e, 0x2e, 0x20, 0x4d, 0x61, 0x6e, 0x79, 0x20, 0x63, 0x61, 0x72, 0x72,
- 0x69, 0x65, 0x73, 0x7c, 0x7c, 0x7b, 0x7d, 0x3b, 0x77, 0x69, 0x77, 0x6f, 0x72,
- 0x6b, 0x20, 0x6f, 0x66, 0x73, 0x79, 0x6e, 0x6f, 0x6e, 0x79, 0x6d, 0x64, 0x65,
- 0x66, 0x65, 0x61, 0x74, 0x73, 0x66, 0x61, 0x76, 0x6f, 0x72, 0x65, 0x64, 0x6f,
- 0x70, 0x74, 0x69, 0x63, 0x61, 0x6c, 0x70, 0x61, 0x67, 0x65, 0x54, 0x72, 0x61,
- 0x75, 0x6e, 0x6c, 0x65, 0x73, 0x73, 0x20, 0x73, 0x65, 0x6e, 0x64, 0x69, 0x6e,
- 0x67, 0x6c, 0x65, 0x66, 0x74, 0x22, 0x3e, 0x3c, 0x63, 0x6f, 0x6d, 0x53, 0x63,
- 0x6f, 0x72, 0x41, 0x6c, 0x6c, 0x20, 0x74, 0x68, 0x65, 0x6a, 0x51, 0x75, 0x65,
- 0x72, 0x79, 0x2e, 0x74, 0x6f, 0x75, 0x72, 0x69, 0x73, 0x74, 0x43, 0x6c, 0x61,
- 0x73, 0x73, 0x69, 0x63, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x22, 0x20, 0x57, 0x69,
- 0x6c, 0x68, 0x65, 0x6c, 0x6d, 0x73, 0x75, 0x62, 0x75, 0x72, 0x62, 0x73, 0x67,
- 0x65, 0x6e, 0x75, 0x69, 0x6e, 0x65, 0x62, 0x69, 0x73, 0x68, 0x6f, 0x70, 0x73,
- 0x2e, 0x73, 0x70, 0x6c, 0x69, 0x74, 0x28, 0x67, 0x6c, 0x6f, 0x62, 0x61, 0x6c,
- 0x20, 0x66, 0x6f, 0x6c, 0x6c, 0x6f, 0x77, 0x73, 0x62, 0x6f, 0x64, 0x79, 0x20,
- 0x6f, 0x66, 0x6e, 0x6f, 0x6d, 0x69, 0x6e, 0x61, 0x6c, 0x43, 0x6f, 0x6e, 0x74,
- 0x61, 0x63, 0x74, 0x73, 0x65, 0x63, 0x75, 0x6c, 0x61, 0x72, 0x6c, 0x65, 0x66,
- 0x74, 0x20, 0x74, 0x6f, 0x63, 0x68, 0x69, 0x65, 0x66, 0x6c, 0x79, 0x2d, 0x68,
- 0x69, 0x64, 0x64, 0x65, 0x6e, 0x2d, 0x62, 0x61, 0x6e, 0x6e, 0x65, 0x72, 0x3c,
- 0x2f, 0x6c, 0x69, 0x3e, 0x0a, 0x0a, 0x2e, 0x20, 0x57, 0x68, 0x65, 0x6e, 0x20,
- 0x69, 0x6e, 0x20, 0x62, 0x6f, 0x74, 0x68, 0x64, 0x69, 0x73, 0x6d, 0x69, 0x73,
- 0x73, 0x45, 0x78, 0x70, 0x6c, 0x6f, 0x72, 0x65, 0x61, 0x6c, 0x77, 0x61, 0x79,
- 0x73, 0x20, 0x76, 0x69, 0x61, 0x20, 0x74, 0x68, 0x65, 0x73, 0x70, 0x61, 0xc3,
- 0xb1, 0x6f, 0x6c, 0x77, 0x65, 0x6c, 0x66, 0x61, 0x72, 0x65, 0x72, 0x75, 0x6c,
- 0x69, 0x6e, 0x67, 0x20, 0x61, 0x72, 0x72, 0x61, 0x6e, 0x67, 0x65, 0x63, 0x61,
- 0x70, 0x74, 0x61, 0x69, 0x6e, 0x68, 0x69, 0x73, 0x20, 0x73, 0x6f, 0x6e, 0x72,
- 0x75, 0x6c, 0x65, 0x20, 0x6f, 0x66, 0x68, 0x65, 0x20, 0x74, 0x6f, 0x6f, 0x6b,
- 0x69, 0x74, 0x73, 0x65, 0x6c, 0x66, 0x2c, 0x3d, 0x30, 0x26, 0x61, 0x6d, 0x70,
- 0x3b, 0x28, 0x63, 0x61, 0x6c, 0x6c, 0x65, 0x64, 0x73, 0x61, 0x6d, 0x70, 0x6c,
- 0x65, 0x73, 0x74, 0x6f, 0x20, 0x6d, 0x61, 0x6b, 0x65, 0x63, 0x6f, 0x6d, 0x2f,
- 0x70, 0x61, 0x67, 0x4d, 0x61, 0x72, 0x74, 0x69, 0x6e, 0x20, 0x4b, 0x65, 0x6e,
- 0x6e, 0x65, 0x64, 0x79, 0x61, 0x63, 0x63, 0x65, 0x70, 0x74, 0x73, 0x66, 0x75,
- 0x6c, 0x6c, 0x20, 0x6f, 0x66, 0x68, 0x61, 0x6e, 0x64, 0x6c, 0x65, 0x64, 0x42,
- 0x65, 0x73, 0x69, 0x64, 0x65, 0x73, 0x2f, 0x2f, 0x2d, 0x2d, 0x3e, 0x3c, 0x2f,
- 0x61, 0x62, 0x6c, 0x65, 0x20, 0x74, 0x6f, 0x74, 0x61, 0x72, 0x67, 0x65, 0x74,
- 0x73, 0x65, 0x73, 0x73, 0x65, 0x6e, 0x63, 0x65, 0x68, 0x69, 0x6d, 0x20, 0x74,
- 0x6f, 0x20, 0x69, 0x74, 0x73, 0x20, 0x62, 0x79, 0x20, 0x63, 0x6f, 0x6d, 0x6d,
- 0x6f, 0x6e, 0x2e, 0x6d, 0x69, 0x6e, 0x65, 0x72, 0x61, 0x6c, 0x74, 0x6f, 0x20,
- 0x74, 0x61, 0x6b, 0x65, 0x77, 0x61, 0x79, 0x73, 0x20, 0x74, 0x6f, 0x73, 0x2e,
- 0x6f, 0x72, 0x67, 0x2f, 0x6c, 0x61, 0x64, 0x76, 0x69, 0x73, 0x65, 0x64, 0x70,
- 0x65, 0x6e, 0x61, 0x6c, 0x74, 0x79, 0x73, 0x69, 0x6d, 0x70, 0x6c, 0x65, 0x3a,
- 0x69, 0x66, 0x20, 0x74, 0x68, 0x65, 0x79, 0x4c, 0x65, 0x74, 0x74, 0x65, 0x72,
- 0x73, 0x61, 0x20, 0x73, 0x68, 0x6f, 0x72, 0x74, 0x48, 0x65, 0x72, 0x62, 0x65,
- 0x72, 0x74, 0x73, 0x74, 0x72, 0x69, 0x6b, 0x65, 0x73, 0x20, 0x67, 0x72, 0x6f,
- 0x75, 0x70, 0x73, 0x2e, 0x6c, 0x65, 0x6e, 0x67, 0x74, 0x68, 0x66, 0x6c, 0x69,
- 0x67, 0x68, 0x74, 0x73, 0x6f, 0x76, 0x65, 0x72, 0x6c, 0x61, 0x70, 0x73, 0x6c,
- 0x6f, 0x77, 0x6c, 0x79, 0x20, 0x6c, 0x65, 0x73, 0x73, 0x65, 0x72, 0x20, 0x73,
- 0x6f, 0x63, 0x69, 0x61, 0x6c, 0x20, 0x3c, 0x2f, 0x70, 0x3e, 0x0a, 0x09, 0x09,
- 0x69, 0x74, 0x20, 0x69, 0x6e, 0x74, 0x6f, 0x72, 0x61, 0x6e, 0x6b, 0x65, 0x64,
- 0x20, 0x72, 0x61, 0x74, 0x65, 0x20, 0x6f, 0x66, 0x75, 0x6c, 0x3e, 0x0d, 0x0a,
- 0x20, 0x20, 0x61, 0x74, 0x74, 0x65, 0x6d, 0x70, 0x74, 0x70, 0x61, 0x69, 0x72,
- 0x20, 0x6f, 0x66, 0x6d, 0x61, 0x6b, 0x65, 0x20, 0x69, 0x74, 0x4b, 0x6f, 0x6e,
- 0x74, 0x61, 0x6b, 0x74, 0x41, 0x6e, 0x74, 0x6f, 0x6e, 0x69, 0x6f, 0x68, 0x61,
- 0x76, 0x69, 0x6e, 0x67, 0x20, 0x72, 0x61, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x20,
- 0x61, 0x63, 0x74, 0x69, 0x76, 0x65, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x73,
- 0x74, 0x72, 0x61, 0x70, 0x70, 0x65, 0x64, 0x22, 0x29, 0x2e, 0x63, 0x73, 0x73,
- 0x28, 0x68, 0x6f, 0x73, 0x74, 0x69, 0x6c, 0x65, 0x6c, 0x65, 0x61, 0x64, 0x20,
- 0x74, 0x6f, 0x6c, 0x69, 0x74, 0x74, 0x6c, 0x65, 0x20, 0x67, 0x72, 0x6f, 0x75,
- 0x70, 0x73, 0x2c, 0x50, 0x69, 0x63, 0x74, 0x75, 0x72, 0x65, 0x2d, 0x2d, 0x3e,
- 0x0d, 0x0a, 0x0d, 0x0a, 0x20, 0x72, 0x6f, 0x77, 0x73, 0x3d, 0x22, 0x20, 0x6f,
- 0x62, 0x6a, 0x65, 0x63, 0x74, 0x69, 0x6e, 0x76, 0x65, 0x72, 0x73, 0x65, 0x3c,
- 0x66, 0x6f, 0x6f, 0x74, 0x65, 0x72, 0x43, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x56,
- 0x3e, 0x3c, 0x5c, 0x2f, 0x73, 0x63, 0x72, 0x73, 0x6f, 0x6c, 0x76, 0x69, 0x6e,
- 0x67, 0x43, 0x68, 0x61, 0x6d, 0x62, 0x65, 0x72, 0x73, 0x6c, 0x61, 0x76, 0x65,
- 0x72, 0x79, 0x77, 0x6f, 0x75, 0x6e, 0x64, 0x65, 0x64, 0x77, 0x68, 0x65, 0x72,
- 0x65, 0x61, 0x73, 0x21, 0x3d, 0x20, 0x27, 0x75, 0x6e, 0x64, 0x66, 0x6f, 0x72,
- 0x20, 0x61, 0x6c, 0x6c, 0x70, 0x61, 0x72, 0x74, 0x6c, 0x79, 0x20, 0x2d, 0x72,
- 0x69, 0x67, 0x68, 0x74, 0x3a, 0x41, 0x72, 0x61, 0x62, 0x69, 0x61, 0x6e, 0x62,
- 0x61, 0x63, 0x6b, 0x65, 0x64, 0x20, 0x63, 0x65, 0x6e, 0x74, 0x75, 0x72, 0x79,
- 0x75, 0x6e, 0x69, 0x74, 0x20, 0x6f, 0x66, 0x6d, 0x6f, 0x62, 0x69, 0x6c, 0x65,
- 0x2d, 0x45, 0x75, 0x72, 0x6f, 0x70, 0x65, 0x2c, 0x69, 0x73, 0x20, 0x68, 0x6f,
- 0x6d, 0x65, 0x72, 0x69, 0x73, 0x6b, 0x20, 0x6f, 0x66, 0x64, 0x65, 0x73, 0x69,
- 0x72, 0x65, 0x64, 0x43, 0x6c, 0x69, 0x6e, 0x74, 0x6f, 0x6e, 0x63, 0x6f, 0x73,
- 0x74, 0x20, 0x6f, 0x66, 0x61, 0x67, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x62, 0x65,
- 0x63, 0x6f, 0x6d, 0x65, 0x20, 0x6e, 0x6f, 0x6e, 0x65, 0x20, 0x6f, 0x66, 0x70,
- 0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b, 0x4d, 0x69, 0x64, 0x64, 0x6c, 0x65, 0x20,
- 0x65, 0x61, 0x64, 0x27, 0x29, 0x5b, 0x30, 0x43, 0x72, 0x69, 0x74, 0x69, 0x63,
- 0x73, 0x73, 0x74, 0x75, 0x64, 0x69, 0x6f, 0x73, 0x3e, 0x26, 0x63, 0x6f, 0x70,
- 0x79, 0x3b, 0x67, 0x72, 0x6f, 0x75, 0x70, 0x22, 0x3e, 0x61, 0x73, 0x73, 0x65,
- 0x6d, 0x62, 0x6c, 0x6d, 0x61, 0x6b, 0x69, 0x6e, 0x67, 0x20, 0x70, 0x72, 0x65,
- 0x73, 0x73, 0x65, 0x64, 0x77, 0x69, 0x64, 0x67, 0x65, 0x74, 0x2e, 0x70, 0x73,
- 0x3a, 0x22, 0x20, 0x3f, 0x20, 0x72, 0x65, 0x62, 0x75, 0x69, 0x6c, 0x74, 0x62,
- 0x79, 0x20, 0x73, 0x6f, 0x6d, 0x65, 0x46, 0x6f, 0x72, 0x6d, 0x65, 0x72, 0x20,
- 0x65, 0x64, 0x69, 0x74, 0x6f, 0x72, 0x73, 0x64, 0x65, 0x6c, 0x61, 0x79, 0x65,
- 0x64, 0x43, 0x61, 0x6e, 0x6f, 0x6e, 0x69, 0x63, 0x68, 0x61, 0x64, 0x20, 0x74,
- 0x68, 0x65, 0x70, 0x75, 0x73, 0x68, 0x69, 0x6e, 0x67, 0x63, 0x6c, 0x61, 0x73,
- 0x73, 0x3d, 0x22, 0x62, 0x75, 0x74, 0x20, 0x61, 0x72, 0x65, 0x70, 0x61, 0x72,
- 0x74, 0x69, 0x61, 0x6c, 0x42, 0x61, 0x62, 0x79, 0x6c, 0x6f, 0x6e, 0x62, 0x6f,
- 0x74, 0x74, 0x6f, 0x6d, 0x20, 0x63, 0x61, 0x72, 0x72, 0x69, 0x65, 0x72, 0x43,
- 0x6f, 0x6d, 0x6d, 0x61, 0x6e, 0x64, 0x69, 0x74, 0x73, 0x20, 0x75, 0x73, 0x65,
- 0x41, 0x73, 0x20, 0x77, 0x69, 0x74, 0x68, 0x63, 0x6f, 0x75, 0x72, 0x73, 0x65,
- 0x73, 0x61, 0x20, 0x74, 0x68, 0x69, 0x72, 0x64, 0x64, 0x65, 0x6e, 0x6f, 0x74,
- 0x65, 0x73, 0x61, 0x6c, 0x73, 0x6f, 0x20, 0x69, 0x6e, 0x48, 0x6f, 0x75, 0x73,
- 0x74, 0x6f, 0x6e, 0x32, 0x30, 0x70, 0x78, 0x3b, 0x22, 0x3e, 0x61, 0x63, 0x63,
- 0x75, 0x73, 0x65, 0x64, 0x64, 0x6f, 0x75, 0x62, 0x6c, 0x65, 0x20, 0x67, 0x6f,
- 0x61, 0x6c, 0x20, 0x6f, 0x66, 0x46, 0x61, 0x6d, 0x6f, 0x75, 0x73, 0x20, 0x29,
- 0x2e, 0x62, 0x69, 0x6e, 0x64, 0x28, 0x70, 0x72, 0x69, 0x65, 0x73, 0x74, 0x73,
- 0x20, 0x4f, 0x6e, 0x6c, 0x69, 0x6e, 0x65, 0x69, 0x6e, 0x20, 0x4a, 0x75, 0x6c,
- 0x79, 0x73, 0x74, 0x20, 0x2b, 0x20, 0x22, 0x67, 0x63, 0x6f, 0x6e, 0x73, 0x75,
- 0x6c, 0x74, 0x64, 0x65, 0x63, 0x69, 0x6d, 0x61, 0x6c, 0x68, 0x65, 0x6c, 0x70,
- 0x66, 0x75, 0x6c, 0x72, 0x65, 0x76, 0x69, 0x76, 0x65, 0x64, 0x69, 0x73, 0x20,
- 0x76, 0x65, 0x72, 0x79, 0x72, 0x27, 0x2b, 0x27, 0x69, 0x70, 0x74, 0x6c, 0x6f,
- 0x73, 0x69, 0x6e, 0x67, 0x20, 0x66, 0x65, 0x6d, 0x61, 0x6c, 0x65, 0x73, 0x69,
- 0x73, 0x20, 0x61, 0x6c, 0x73, 0x6f, 0x73, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x73,
- 0x64, 0x61, 0x79, 0x73, 0x20, 0x6f, 0x66, 0x61, 0x72, 0x72, 0x69, 0x76, 0x61,
- 0x6c, 0x66, 0x75, 0x74, 0x75, 0x72, 0x65, 0x20, 0x3c, 0x6f, 0x62, 0x6a, 0x65,
- 0x63, 0x74, 0x66, 0x6f, 0x72, 0x63, 0x69, 0x6e, 0x67, 0x53, 0x74, 0x72, 0x69,
- 0x6e, 0x67, 0x28, 0x22, 0x20, 0x2f, 0x3e, 0x0a, 0x09, 0x09, 0x68, 0x65, 0x72,
- 0x65, 0x20, 0x69, 0x73, 0x65, 0x6e, 0x63, 0x6f, 0x64, 0x65, 0x64, 0x2e, 0x20,
- 0x20, 0x54, 0x68, 0x65, 0x20, 0x62, 0x61, 0x6c, 0x6c, 0x6f, 0x6f, 0x6e, 0x64,
- 0x6f, 0x6e, 0x65, 0x20, 0x62, 0x79, 0x2f, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e,
- 0x62, 0x67, 0x63, 0x6f, 0x6c, 0x6f, 0x72, 0x6c, 0x61, 0x77, 0x20, 0x6f, 0x66,
- 0x20, 0x49, 0x6e, 0x64, 0x69, 0x61, 0x6e, 0x61, 0x61, 0x76, 0x6f, 0x69, 0x64,
- 0x65, 0x64, 0x62, 0x75, 0x74, 0x20, 0x74, 0x68, 0x65, 0x32, 0x70, 0x78, 0x20,
- 0x33, 0x70, 0x78, 0x6a, 0x71, 0x75, 0x65, 0x72, 0x79, 0x2e, 0x61, 0x66, 0x74,
- 0x65, 0x72, 0x20, 0x61, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x6d, 0x65,
- 0x6e, 0x20, 0x61, 0x6e, 0x64, 0x66, 0x6f, 0x6f, 0x74, 0x65, 0x72, 0x2d, 0x3d,
- 0x20, 0x74, 0x72, 0x75, 0x65, 0x3b, 0x66, 0x6f, 0x72, 0x20, 0x75, 0x73, 0x65,
- 0x73, 0x63, 0x72, 0x65, 0x65, 0x6e, 0x2e, 0x49, 0x6e, 0x64, 0x69, 0x61, 0x6e,
- 0x20, 0x69, 0x6d, 0x61, 0x67, 0x65, 0x20, 0x3d, 0x66, 0x61, 0x6d, 0x69, 0x6c,
- 0x79, 0x2c, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x20, 0x26, 0x6e, 0x62,
- 0x73, 0x70, 0x3b, 0x64, 0x72, 0x69, 0x76, 0x65, 0x72, 0x73, 0x65, 0x74, 0x65,
- 0x72, 0x6e, 0x61, 0x6c, 0x73, 0x61, 0x6d, 0x65, 0x20, 0x61, 0x73, 0x6e, 0x6f,
- 0x74, 0x69, 0x63, 0x65, 0x64, 0x76, 0x69, 0x65, 0x77, 0x65, 0x72, 0x73, 0x7d,
- 0x29, 0x28, 0x29, 0x3b, 0x0a, 0x20, 0x69, 0x73, 0x20, 0x6d, 0x6f, 0x72, 0x65,
- 0x73, 0x65, 0x61, 0x73, 0x6f, 0x6e, 0x73, 0x66, 0x6f, 0x72, 0x6d, 0x65, 0x72,
- 0x20, 0x74, 0x68, 0x65, 0x20, 0x6e, 0x65, 0x77, 0x69, 0x73, 0x20, 0x6a, 0x75,
- 0x73, 0x74, 0x63, 0x6f, 0x6e, 0x73, 0x65, 0x6e, 0x74, 0x20, 0x53, 0x65, 0x61,
- 0x72, 0x63, 0x68, 0x77, 0x61, 0x73, 0x20, 0x74, 0x68, 0x65, 0x77, 0x68, 0x79,
- 0x20, 0x74, 0x68, 0x65, 0x73, 0x68, 0x69, 0x70, 0x70, 0x65, 0x64, 0x62, 0x72,
- 0x3e, 0x3c, 0x62, 0x72, 0x3e, 0x77, 0x69, 0x64, 0x74, 0x68, 0x3a, 0x20, 0x68,
- 0x65, 0x69, 0x67, 0x68, 0x74, 0x3d, 0x6d, 0x61, 0x64, 0x65, 0x20, 0x6f, 0x66,
- 0x63, 0x75, 0x69, 0x73, 0x69, 0x6e, 0x65, 0x69, 0x73, 0x20, 0x74, 0x68, 0x61,
- 0x74, 0x61, 0x20, 0x76, 0x65, 0x72, 0x79, 0x20, 0x41, 0x64, 0x6d, 0x69, 0x72,
- 0x61, 0x6c, 0x20, 0x66, 0x69, 0x78, 0x65, 0x64, 0x3b, 0x6e, 0x6f, 0x72, 0x6d,
- 0x61, 0x6c, 0x20, 0x4d, 0x69, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x50, 0x72, 0x65,
- 0x73, 0x73, 0x2c, 0x20, 0x6f, 0x6e, 0x74, 0x61, 0x72, 0x69, 0x6f, 0x63, 0x68,
- 0x61, 0x72, 0x73, 0x65, 0x74, 0x74, 0x72, 0x79, 0x20, 0x74, 0x6f, 0x20, 0x69,
- 0x6e, 0x76, 0x61, 0x64, 0x65, 0x64, 0x3d, 0x22, 0x74, 0x72, 0x75, 0x65, 0x22,
- 0x73, 0x70, 0x61, 0x63, 0x69, 0x6e, 0x67, 0x69, 0x73, 0x20, 0x6d, 0x6f, 0x73,
- 0x74, 0x61, 0x20, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x74, 0x6f, 0x74, 0x61, 0x6c,
- 0x6c, 0x79, 0x66, 0x61, 0x6c, 0x6c, 0x20, 0x6f, 0x66, 0x7d, 0x29, 0x3b, 0x0d,
- 0x0a, 0x20, 0x20, 0x69, 0x6d, 0x6d, 0x65, 0x6e, 0x73, 0x65, 0x74, 0x69, 0x6d,
- 0x65, 0x20, 0x69, 0x6e, 0x73, 0x65, 0x74, 0x20, 0x6f, 0x75, 0x74, 0x73, 0x61,
- 0x74, 0x69, 0x73, 0x66, 0x79, 0x74, 0x6f, 0x20, 0x66, 0x69, 0x6e, 0x64, 0x64,
- 0x6f, 0x77, 0x6e, 0x20, 0x74, 0x6f, 0x6c, 0x6f, 0x74, 0x20, 0x6f, 0x66, 0x20,
- 0x50, 0x6c, 0x61, 0x79, 0x65, 0x72, 0x73, 0x69, 0x6e, 0x20, 0x4a, 0x75, 0x6e,
- 0x65, 0x71, 0x75, 0x61, 0x6e, 0x74, 0x75, 0x6d, 0x6e, 0x6f, 0x74, 0x20, 0x74,
- 0x68, 0x65, 0x74, 0x69, 0x6d, 0x65, 0x20, 0x74, 0x6f, 0x64, 0x69, 0x73, 0x74,
- 0x61, 0x6e, 0x74, 0x46, 0x69, 0x6e, 0x6e, 0x69, 0x73, 0x68, 0x73, 0x72, 0x63,
- 0x20, 0x3d, 0x20, 0x28, 0x73, 0x69, 0x6e, 0x67, 0x6c, 0x65, 0x20, 0x68, 0x65,
- 0x6c, 0x70, 0x20, 0x6f, 0x66, 0x47, 0x65, 0x72, 0x6d, 0x61, 0x6e, 0x20, 0x6c,
- 0x61, 0x77, 0x20, 0x61, 0x6e, 0x64, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x65, 0x64,
- 0x66, 0x6f, 0x72, 0x65, 0x73, 0x74, 0x73, 0x63, 0x6f, 0x6f, 0x6b, 0x69, 0x6e,
- 0x67, 0x73, 0x70, 0x61, 0x63, 0x65, 0x22, 0x3e, 0x68, 0x65, 0x61, 0x64, 0x65,
- 0x72, 0x2d, 0x77, 0x65, 0x6c, 0x6c, 0x20, 0x61, 0x73, 0x53, 0x74, 0x61, 0x6e,
- 0x6c, 0x65, 0x79, 0x62, 0x72, 0x69, 0x64, 0x67, 0x65, 0x73, 0x2f, 0x67, 0x6c,
- 0x6f, 0x62, 0x61, 0x6c, 0x43, 0x72, 0x6f, 0x61, 0x74, 0x69, 0x61, 0x20, 0x41,
- 0x62, 0x6f, 0x75, 0x74, 0x20, 0x5b, 0x30, 0x5d, 0x3b, 0x0a, 0x20, 0x20, 0x69,
- 0x74, 0x2c, 0x20, 0x61, 0x6e, 0x64, 0x67, 0x72, 0x6f, 0x75, 0x70, 0x65, 0x64,
- 0x62, 0x65, 0x69, 0x6e, 0x67, 0x20, 0x61, 0x29, 0x7b, 0x74, 0x68, 0x72, 0x6f,
- 0x77, 0x68, 0x65, 0x20, 0x6d, 0x61, 0x64, 0x65, 0x6c, 0x69, 0x67, 0x68, 0x74,
- 0x65, 0x72, 0x65, 0x74, 0x68, 0x69, 0x63, 0x61, 0x6c, 0x46, 0x46, 0x46, 0x46,
- 0x46, 0x46, 0x22, 0x62, 0x6f, 0x74, 0x74, 0x6f, 0x6d, 0x22, 0x6c, 0x69, 0x6b,
- 0x65, 0x20, 0x61, 0x20, 0x65, 0x6d, 0x70, 0x6c, 0x6f, 0x79, 0x73, 0x6c, 0x69,
- 0x76, 0x65, 0x20, 0x69, 0x6e, 0x61, 0x73, 0x20, 0x73, 0x65, 0x65, 0x6e, 0x70,
- 0x72, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x6d, 0x6f, 0x73, 0x74, 0x20, 0x6f, 0x66,
- 0x75, 0x62, 0x2d, 0x6c, 0x69, 0x6e, 0x6b, 0x72, 0x65, 0x6a, 0x65, 0x63, 0x74,
- 0x73, 0x61, 0x6e, 0x64, 0x20, 0x75, 0x73, 0x65, 0x69, 0x6d, 0x61, 0x67, 0x65,
- 0x22, 0x3e, 0x73, 0x75, 0x63, 0x63, 0x65, 0x65, 0x64, 0x66, 0x65, 0x65, 0x64,
- 0x69, 0x6e, 0x67, 0x4e, 0x75, 0x63, 0x6c, 0x65, 0x61, 0x72, 0x69, 0x6e, 0x66,
- 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x6f, 0x20, 0x68, 0x65, 0x6c, 0x70, 0x57, 0x6f,
- 0x6d, 0x65, 0x6e, 0x27, 0x73, 0x4e, 0x65, 0x69, 0x74, 0x68, 0x65, 0x72, 0x4d,
- 0x65, 0x78, 0x69, 0x63, 0x61, 0x6e, 0x70, 0x72, 0x6f, 0x74, 0x65, 0x69, 0x6e,
- 0x3c, 0x74, 0x61, 0x62, 0x6c, 0x65, 0x20, 0x62, 0x79, 0x20, 0x6d, 0x61, 0x6e,
- 0x79, 0x68, 0x65, 0x61, 0x6c, 0x74, 0x68, 0x79, 0x6c, 0x61, 0x77, 0x73, 0x75,
- 0x69, 0x74, 0x64, 0x65, 0x76, 0x69, 0x73, 0x65, 0x64, 0x2e, 0x70, 0x75, 0x73,
- 0x68, 0x28, 0x7b, 0x73, 0x65, 0x6c, 0x6c, 0x65, 0x72, 0x73, 0x73, 0x69, 0x6d,
- 0x70, 0x6c, 0x79, 0x20, 0x54, 0x68, 0x72, 0x6f, 0x75, 0x67, 0x68, 0x2e, 0x63,
- 0x6f, 0x6f, 0x6b, 0x69, 0x65, 0x20, 0x49, 0x6d, 0x61, 0x67, 0x65, 0x28, 0x6f,
- 0x6c, 0x64, 0x65, 0x72, 0x22, 0x3e, 0x75, 0x73, 0x2e, 0x6a, 0x73, 0x22, 0x3e,
- 0x20, 0x53, 0x69, 0x6e, 0x63, 0x65, 0x20, 0x75, 0x6e, 0x69, 0x76, 0x65, 0x72,
- 0x73, 0x6c, 0x61, 0x72, 0x67, 0x65, 0x72, 0x20, 0x6f, 0x70, 0x65, 0x6e, 0x20,
- 0x74, 0x6f, 0x21, 0x2d, 0x2d, 0x20, 0x65, 0x6e, 0x64, 0x6c, 0x69, 0x65, 0x73,
- 0x20, 0x69, 0x6e, 0x27, 0x5d, 0x29, 0x3b, 0x0d, 0x0a, 0x20, 0x20, 0x6d, 0x61,
- 0x72, 0x6b, 0x65, 0x74, 0x77, 0x68, 0x6f, 0x20, 0x69, 0x73, 0x20, 0x28, 0x22,
- 0x44, 0x4f, 0x4d, 0x43, 0x6f, 0x6d, 0x61, 0x6e, 0x61, 0x67, 0x65, 0x64, 0x6f,
- 0x6e, 0x65, 0x20, 0x66, 0x6f, 0x72, 0x74, 0x79, 0x70, 0x65, 0x6f, 0x66, 0x20,
- 0x4b, 0x69, 0x6e, 0x67, 0x64, 0x6f, 0x6d, 0x70, 0x72, 0x6f, 0x66, 0x69, 0x74,
- 0x73, 0x70, 0x72, 0x6f, 0x70, 0x6f, 0x73, 0x65, 0x74, 0x6f, 0x20, 0x73, 0x68,
- 0x6f, 0x77, 0x63, 0x65, 0x6e, 0x74, 0x65, 0x72, 0x3b, 0x6d, 0x61, 0x64, 0x65,
- 0x20, 0x69, 0x74, 0x64, 0x72, 0x65, 0x73, 0x73, 0x65, 0x64, 0x77, 0x65, 0x72,
- 0x65, 0x20, 0x69, 0x6e, 0x6d, 0x69, 0x78, 0x74, 0x75, 0x72, 0x65, 0x70, 0x72,
- 0x65, 0x63, 0x69, 0x73, 0x65, 0x61, 0x72, 0x69, 0x73, 0x69, 0x6e, 0x67, 0x73,
- 0x72, 0x63, 0x20, 0x3d, 0x20, 0x27, 0x6d, 0x61, 0x6b, 0x65, 0x20, 0x61, 0x20,
- 0x73, 0x65, 0x63, 0x75, 0x72, 0x65, 0x64, 0x42, 0x61, 0x70, 0x74, 0x69, 0x73,
- 0x74, 0x76, 0x6f, 0x74, 0x69, 0x6e, 0x67, 0x20, 0x0a, 0x09, 0x09, 0x76, 0x61,
- 0x72, 0x20, 0x4d, 0x61, 0x72, 0x63, 0x68, 0x20, 0x32, 0x67, 0x72, 0x65, 0x77,
- 0x20, 0x75, 0x70, 0x43, 0x6c, 0x69, 0x6d, 0x61, 0x74, 0x65, 0x2e, 0x72, 0x65,
- 0x6d, 0x6f, 0x76, 0x65, 0x73, 0x6b, 0x69, 0x6c, 0x6c, 0x65, 0x64, 0x77, 0x61,
- 0x79, 0x20, 0x74, 0x68, 0x65, 0x3c, 0x2f, 0x68, 0x65, 0x61, 0x64, 0x3e, 0x66,
- 0x61, 0x63, 0x65, 0x20, 0x6f, 0x66, 0x61, 0x63, 0x74, 0x69, 0x6e, 0x67, 0x20,
- 0x72, 0x69, 0x67, 0x68, 0x74, 0x22, 0x3e, 0x74, 0x6f, 0x20, 0x77, 0x6f, 0x72,
- 0x6b, 0x72, 0x65, 0x64, 0x75, 0x63, 0x65, 0x73, 0x68, 0x61, 0x73, 0x20, 0x68,
- 0x61, 0x64, 0x65, 0x72, 0x65, 0x63, 0x74, 0x65, 0x64, 0x73, 0x68, 0x6f, 0x77,
- 0x28, 0x29, 0x3b, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x3d, 0x62, 0x6f, 0x6f,
- 0x6b, 0x20, 0x6f, 0x66, 0x61, 0x6e, 0x20, 0x61, 0x72, 0x65, 0x61, 0x3d, 0x3d,
- 0x20, 0x22, 0x68, 0x74, 0x74, 0x3c, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x0a,
- 0x3c, 0x68, 0x74, 0x6d, 0x6c, 0x3e, 0x63, 0x6f, 0x6e, 0x66, 0x6f, 0x72, 0x6d,
- 0x66, 0x61, 0x63, 0x69, 0x6e, 0x67, 0x20, 0x63, 0x6f, 0x6f, 0x6b, 0x69, 0x65,
- 0x2e, 0x72, 0x65, 0x6c, 0x79, 0x20, 0x6f, 0x6e, 0x68, 0x6f, 0x73, 0x74, 0x65,
- 0x64, 0x20, 0x2e, 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x68, 0x65, 0x20, 0x77,
- 0x65, 0x6e, 0x74, 0x62, 0x75, 0x74, 0x20, 0x66, 0x6f, 0x72, 0x73, 0x70, 0x72,
- 0x65, 0x61, 0x64, 0x20, 0x46, 0x61, 0x6d, 0x69, 0x6c, 0x79, 0x20, 0x61, 0x20,
- 0x6d, 0x65, 0x61, 0x6e, 0x73, 0x6f, 0x75, 0x74, 0x20, 0x74, 0x68, 0x65, 0x66,
- 0x6f, 0x72, 0x75, 0x6d, 0x73, 0x2e, 0x66, 0x6f, 0x6f, 0x74, 0x61, 0x67, 0x65,
- 0x22, 0x3e, 0x4d, 0x6f, 0x62, 0x69, 0x6c, 0x43, 0x6c, 0x65, 0x6d, 0x65, 0x6e,
- 0x74, 0x73, 0x22, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x61, 0x73, 0x20, 0x68, 0x69,
- 0x67, 0x68, 0x69, 0x6e, 0x74, 0x65, 0x6e, 0x73, 0x65, 0x2d, 0x2d, 0x3e, 0x3c,
- 0x21, 0x2d, 0x2d, 0x66, 0x65, 0x6d, 0x61, 0x6c, 0x65, 0x20, 0x69, 0x73, 0x20,
- 0x73, 0x65, 0x65, 0x6e, 0x69, 0x6d, 0x70, 0x6c, 0x69, 0x65, 0x64, 0x73, 0x65,
- 0x74, 0x20, 0x74, 0x68, 0x65, 0x61, 0x20, 0x73, 0x74, 0x61, 0x74, 0x65, 0x61,
- 0x6e, 0x64, 0x20, 0x68, 0x69, 0x73, 0x66, 0x61, 0x73, 0x74, 0x65, 0x73, 0x74,
- 0x62, 0x65, 0x73, 0x69, 0x64, 0x65, 0x73, 0x62, 0x75, 0x74, 0x74, 0x6f, 0x6e,
- 0x5f, 0x62, 0x6f, 0x75, 0x6e, 0x64, 0x65, 0x64, 0x22, 0x3e, 0x3c, 0x69, 0x6d,
- 0x67, 0x20, 0x49, 0x6e, 0x66, 0x6f, 0x62, 0x6f, 0x78, 0x65, 0x76, 0x65, 0x6e,
- 0x74, 0x73, 0x2c, 0x61, 0x20, 0x79, 0x6f, 0x75, 0x6e, 0x67, 0x61, 0x6e, 0x64,
- 0x20, 0x61, 0x72, 0x65, 0x4e, 0x61, 0x74, 0x69, 0x76, 0x65, 0x20, 0x63, 0x68,
- 0x65, 0x61, 0x70, 0x65, 0x72, 0x54, 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x61,
- 0x6e, 0x64, 0x20, 0x68, 0x61, 0x73, 0x65, 0x6e, 0x67, 0x69, 0x6e, 0x65, 0x73,
- 0x77, 0x6f, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x28, 0x6d, 0x6f, 0x73, 0x74, 0x6c,
- 0x79, 0x72, 0x69, 0x67, 0x68, 0x74, 0x3a, 0x20, 0x66, 0x69, 0x6e, 0x64, 0x20,
- 0x61, 0x20, 0x2d, 0x62, 0x6f, 0x74, 0x74, 0x6f, 0x6d, 0x50, 0x72, 0x69, 0x6e,
- 0x63, 0x65, 0x20, 0x61, 0x72, 0x65, 0x61, 0x20, 0x6f, 0x66, 0x6d, 0x6f, 0x72,
- 0x65, 0x20, 0x6f, 0x66, 0x73, 0x65, 0x61, 0x72, 0x63, 0x68, 0x5f, 0x6e, 0x61,
- 0x74, 0x75, 0x72, 0x65, 0x2c, 0x6c, 0x65, 0x67, 0x61, 0x6c, 0x6c, 0x79, 0x70,
- 0x65, 0x72, 0x69, 0x6f, 0x64, 0x2c, 0x6c, 0x61, 0x6e, 0x64, 0x20, 0x6f, 0x66,
- 0x6f, 0x72, 0x20, 0x77, 0x69, 0x74, 0x68, 0x69, 0x6e, 0x64, 0x75, 0x63, 0x65,
- 0x64, 0x70, 0x72, 0x6f, 0x76, 0x69, 0x6e, 0x67, 0x6d, 0x69, 0x73, 0x73, 0x69,
- 0x6c, 0x65, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x6c, 0x79, 0x41, 0x67, 0x61, 0x69,
- 0x6e, 0x73, 0x74, 0x74, 0x68, 0x65, 0x20, 0x77, 0x61, 0x79, 0x6b, 0x26, 0x71,
- 0x75, 0x6f, 0x74, 0x3b, 0x70, 0x78, 0x3b, 0x22, 0x3e, 0x0d, 0x0a, 0x70, 0x75,
- 0x73, 0x68, 0x65, 0x64, 0x20, 0x61, 0x62, 0x61, 0x6e, 0x64, 0x6f, 0x6e, 0x6e,
- 0x75, 0x6d, 0x65, 0x72, 0x61, 0x6c, 0x43, 0x65, 0x72, 0x74, 0x61, 0x69, 0x6e,
- 0x49, 0x6e, 0x20, 0x74, 0x68, 0x69, 0x73, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x69,
- 0x6e, 0x6f, 0x72, 0x20, 0x73, 0x6f, 0x6d, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x20,
- 0x69, 0x73, 0x61, 0x6e, 0x64, 0x2c, 0x20, 0x69, 0x6e, 0x63, 0x72, 0x6f, 0x77,
- 0x6e, 0x65, 0x64, 0x49, 0x53, 0x42, 0x4e, 0x20, 0x30, 0x2d, 0x63, 0x72, 0x65,
- 0x61, 0x74, 0x65, 0x73, 0x4f, 0x63, 0x74, 0x6f, 0x62, 0x65, 0x72, 0x6d, 0x61,
- 0x79, 0x20, 0x6e, 0x6f, 0x74, 0x63, 0x65, 0x6e, 0x74, 0x65, 0x72, 0x20, 0x6c,
- 0x61, 0x74, 0x65, 0x20, 0x69, 0x6e, 0x44, 0x65, 0x66, 0x65, 0x6e, 0x63, 0x65,
- 0x65, 0x6e, 0x61, 0x63, 0x74, 0x65, 0x64, 0x77, 0x69, 0x73, 0x68, 0x20, 0x74,
- 0x6f, 0x62, 0x72, 0x6f, 0x61, 0x64, 0x6c, 0x79, 0x63, 0x6f, 0x6f, 0x6c, 0x69,
- 0x6e, 0x67, 0x6f, 0x6e, 0x6c, 0x6f, 0x61, 0x64, 0x3d, 0x69, 0x74, 0x2e, 0x20,
- 0x54, 0x68, 0x65, 0x72, 0x65, 0x63, 0x6f, 0x76, 0x65, 0x72, 0x4d, 0x65, 0x6d,
- 0x62, 0x65, 0x72, 0x73, 0x68, 0x65, 0x69, 0x67, 0x68, 0x74, 0x20, 0x61, 0x73,
- 0x73, 0x75, 0x6d, 0x65, 0x73, 0x3c, 0x68, 0x74, 0x6d, 0x6c, 0x3e, 0x0a, 0x70,
- 0x65, 0x6f, 0x70, 0x6c, 0x65, 0x2e, 0x69, 0x6e, 0x20, 0x6f, 0x6e, 0x65, 0x20,
- 0x3d, 0x77, 0x69, 0x6e, 0x64, 0x6f, 0x77, 0x66, 0x6f, 0x6f, 0x74, 0x65, 0x72,
- 0x5f, 0x61, 0x20, 0x67, 0x6f, 0x6f, 0x64, 0x20, 0x72, 0x65, 0x6b, 0x6c, 0x61,
- 0x6d, 0x61, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x73, 0x2c, 0x74, 0x6f, 0x20, 0x74,
- 0x68, 0x69, 0x73, 0x5f, 0x63, 0x6f, 0x6f, 0x6b, 0x69, 0x65, 0x70, 0x61, 0x6e,
- 0x65, 0x6c, 0x22, 0x3e, 0x4c, 0x6f, 0x6e, 0x64, 0x6f, 0x6e, 0x2c, 0x64, 0x65,
- 0x66, 0x69, 0x6e, 0x65, 0x73, 0x63, 0x72, 0x75, 0x73, 0x68, 0x65, 0x64, 0x62,
- 0x61, 0x70, 0x74, 0x69, 0x73, 0x6d, 0x63, 0x6f, 0x61, 0x73, 0x74, 0x61, 0x6c,
- 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x20, 0x74, 0x69, 0x74, 0x6c, 0x65, 0x22,
- 0x20, 0x6d, 0x6f, 0x76, 0x65, 0x20, 0x74, 0x6f, 0x6c, 0x6f, 0x73, 0x74, 0x20,
- 0x69, 0x6e, 0x62, 0x65, 0x74, 0x74, 0x65, 0x72, 0x20, 0x69, 0x6d, 0x70, 0x6c,
- 0x69, 0x65, 0x73, 0x72, 0x69, 0x76, 0x61, 0x6c, 0x72, 0x79, 0x73, 0x65, 0x72,
- 0x76, 0x65, 0x72, 0x73, 0x20, 0x53, 0x79, 0x73, 0x74, 0x65, 0x6d, 0x50, 0x65,
- 0x72, 0x68, 0x61, 0x70, 0x73, 0x65, 0x73, 0x20, 0x61, 0x6e, 0x64, 0x20, 0x63,
- 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x64, 0x66, 0x6c, 0x6f, 0x77, 0x69, 0x6e, 0x67,
- 0x6c, 0x61, 0x73, 0x74, 0x65, 0x64, 0x20, 0x72, 0x69, 0x73, 0x65, 0x20, 0x69,
- 0x6e, 0x47, 0x65, 0x6e, 0x65, 0x73, 0x69, 0x73, 0x76, 0x69, 0x65, 0x77, 0x20,
- 0x6f, 0x66, 0x72, 0x69, 0x73, 0x69, 0x6e, 0x67, 0x20, 0x73, 0x65, 0x65, 0x6d,
- 0x20, 0x74, 0x6f, 0x62, 0x75, 0x74, 0x20, 0x69, 0x6e, 0x20, 0x62, 0x61, 0x63,
- 0x6b, 0x69, 0x6e, 0x67, 0x68, 0x65, 0x20, 0x77, 0x69, 0x6c, 0x6c, 0x67, 0x69,
- 0x76, 0x65, 0x6e, 0x20, 0x61, 0x67, 0x69, 0x76, 0x69, 0x6e, 0x67, 0x20, 0x63,
- 0x69, 0x74, 0x69, 0x65, 0x73, 0x2e, 0x66, 0x6c, 0x6f, 0x77, 0x20, 0x6f, 0x66,
- 0x20, 0x4c, 0x61, 0x74, 0x65, 0x72, 0x20, 0x61, 0x6c, 0x6c, 0x20, 0x62, 0x75,
- 0x74, 0x48, 0x69, 0x67, 0x68, 0x77, 0x61, 0x79, 0x6f, 0x6e, 0x6c, 0x79, 0x20,
- 0x62, 0x79, 0x73, 0x69, 0x67, 0x6e, 0x20, 0x6f, 0x66, 0x68, 0x65, 0x20, 0x64,
- 0x6f, 0x65, 0x73, 0x64, 0x69, 0x66, 0x66, 0x65, 0x72, 0x73, 0x62, 0x61, 0x74,
- 0x74, 0x65, 0x72, 0x79, 0x26, 0x61, 0x6d, 0x70, 0x3b, 0x6c, 0x61, 0x73, 0x69,
- 0x6e, 0x67, 0x6c, 0x65, 0x73, 0x74, 0x68, 0x72, 0x65, 0x61, 0x74, 0x73, 0x69,
- 0x6e, 0x74, 0x65, 0x67, 0x65, 0x72, 0x74, 0x61, 0x6b, 0x65, 0x20, 0x6f, 0x6e,
- 0x72, 0x65, 0x66, 0x75, 0x73, 0x65, 0x64, 0x63, 0x61, 0x6c, 0x6c, 0x65, 0x64,
- 0x20, 0x3d, 0x55, 0x53, 0x26, 0x61, 0x6d, 0x70, 0x53, 0x65, 0x65, 0x20, 0x74,
- 0x68, 0x65, 0x6e, 0x61, 0x74, 0x69, 0x76, 0x65, 0x73, 0x62, 0x79, 0x20, 0x74,
- 0x68, 0x69, 0x73, 0x73, 0x79, 0x73, 0x74, 0x65, 0x6d, 0x2e, 0x68, 0x65, 0x61,
- 0x64, 0x20, 0x6f, 0x66, 0x3a, 0x68, 0x6f, 0x76, 0x65, 0x72, 0x2c, 0x6c, 0x65,
- 0x73, 0x62, 0x69, 0x61, 0x6e, 0x73, 0x75, 0x72, 0x6e, 0x61, 0x6d, 0x65, 0x61,
- 0x6e, 0x64, 0x20, 0x61, 0x6c, 0x6c, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x2f,
- 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x5f, 0x5f, 0x70, 0x61, 0x72, 0x61, 0x6d,
- 0x73, 0x48, 0x61, 0x72, 0x76, 0x61, 0x72, 0x64, 0x2f, 0x70, 0x69, 0x78, 0x65,
- 0x6c, 0x2e, 0x72, 0x65, 0x6d, 0x6f, 0x76, 0x61, 0x6c, 0x73, 0x6f, 0x20, 0x6c,
- 0x6f, 0x6e, 0x67, 0x72, 0x6f, 0x6c, 0x65, 0x20, 0x6f, 0x66, 0x6a, 0x6f, 0x69,
- 0x6e, 0x74, 0x6c, 0x79, 0x73, 0x6b, 0x79, 0x73, 0x63, 0x72, 0x61, 0x55, 0x6e,
- 0x69, 0x63, 0x6f, 0x64, 0x65, 0x62, 0x72, 0x20, 0x2f, 0x3e, 0x0d, 0x0a, 0x41,
- 0x74, 0x6c, 0x61, 0x6e, 0x74, 0x61, 0x6e, 0x75, 0x63, 0x6c, 0x65, 0x75, 0x73,
- 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x79, 0x2c, 0x70, 0x75, 0x72, 0x65, 0x6c, 0x79,
- 0x20, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x22, 0x3e, 0x65, 0x61, 0x73, 0x69, 0x6c,
- 0x79, 0x20, 0x62, 0x75, 0x69, 0x6c, 0x64, 0x20, 0x61, 0x6f, 0x6e, 0x63, 0x6c,
- 0x69, 0x63, 0x6b, 0x61, 0x20, 0x67, 0x69, 0x76, 0x65, 0x6e, 0x70, 0x6f, 0x69,
- 0x6e, 0x74, 0x65, 0x72, 0x68, 0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b, 0x65, 0x76,
- 0x65, 0x6e, 0x74, 0x73, 0x20, 0x65, 0x6c, 0x73, 0x65, 0x20, 0x7b, 0x0a, 0x64,
- 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x6e, 0x6f, 0x77, 0x20, 0x74, 0x68, 0x65,
- 0x2c, 0x20, 0x77, 0x69, 0x74, 0x68, 0x20, 0x6d, 0x61, 0x6e, 0x20, 0x77, 0x68,
- 0x6f, 0x6f, 0x72, 0x67, 0x2f, 0x57, 0x65, 0x62, 0x6f, 0x6e, 0x65, 0x20, 0x61,
- 0x6e, 0x64, 0x63, 0x61, 0x76, 0x61, 0x6c, 0x72, 0x79, 0x48, 0x65, 0x20, 0x64,
- 0x69, 0x65, 0x64, 0x73, 0x65, 0x61, 0x74, 0x74, 0x6c, 0x65, 0x30, 0x30, 0x2c,
- 0x30, 0x30, 0x30, 0x20, 0x7b, 0x77, 0x69, 0x6e, 0x64, 0x6f, 0x77, 0x68, 0x61,
- 0x76, 0x65, 0x20, 0x74, 0x6f, 0x69, 0x66, 0x28, 0x77, 0x69, 0x6e, 0x64, 0x61,
- 0x6e, 0x64, 0x20, 0x69, 0x74, 0x73, 0x73, 0x6f, 0x6c, 0x65, 0x6c, 0x79, 0x20,
- 0x6d, 0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b, 0x72, 0x65, 0x6e, 0x65, 0x77, 0x65,
- 0x64, 0x44, 0x65, 0x74, 0x72, 0x6f, 0x69, 0x74, 0x61, 0x6d, 0x6f, 0x6e, 0x67,
- 0x73, 0x74, 0x65, 0x69, 0x74, 0x68, 0x65, 0x72, 0x20, 0x74, 0x68, 0x65, 0x6d,
- 0x20, 0x69, 0x6e, 0x53, 0x65, 0x6e, 0x61, 0x74, 0x6f, 0x72, 0x55, 0x73, 0x3c,
- 0x2f, 0x61, 0x3e, 0x3c, 0x4b, 0x69, 0x6e, 0x67, 0x20, 0x6f, 0x66, 0x46, 0x72,
- 0x61, 0x6e, 0x63, 0x69, 0x73, 0x2d, 0x70, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x68,
- 0x65, 0x20, 0x75, 0x73, 0x65, 0x64, 0x61, 0x72, 0x74, 0x20, 0x61, 0x6e, 0x64,
- 0x68, 0x69, 0x6d, 0x20, 0x61, 0x6e, 0x64, 0x75, 0x73, 0x65, 0x64, 0x20, 0x62,
- 0x79, 0x73, 0x63, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x61, 0x74, 0x20, 0x68, 0x6f,
- 0x6d, 0x65, 0x74, 0x6f, 0x20, 0x68, 0x61, 0x76, 0x65, 0x72, 0x65, 0x6c, 0x61,
- 0x74, 0x65, 0x73, 0x69, 0x62, 0x69, 0x6c, 0x69, 0x74, 0x79, 0x66, 0x61, 0x63,
- 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x75, 0x66, 0x66, 0x61, 0x6c, 0x6f, 0x6c, 0x69,
- 0x6e, 0x6b, 0x22, 0x3e, 0x3c, 0x77, 0x68, 0x61, 0x74, 0x20, 0x68, 0x65, 0x66,
- 0x72, 0x65, 0x65, 0x20, 0x74, 0x6f, 0x43, 0x69, 0x74, 0x79, 0x20, 0x6f, 0x66,
- 0x63, 0x6f, 0x6d, 0x65, 0x20, 0x69, 0x6e, 0x73, 0x65, 0x63, 0x74, 0x6f, 0x72,
- 0x73, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x65, 0x64, 0x6f, 0x6e, 0x65, 0x20, 0x64,
- 0x61, 0x79, 0x6e, 0x65, 0x72, 0x76, 0x6f, 0x75, 0x73, 0x73, 0x71, 0x75, 0x61,
- 0x72, 0x65, 0x20, 0x7d, 0x3b, 0x69, 0x66, 0x28, 0x67, 0x6f, 0x69, 0x6e, 0x20,
- 0x77, 0x68, 0x61, 0x74, 0x69, 0x6d, 0x67, 0x22, 0x20, 0x61, 0x6c, 0x69, 0x73,
- 0x20, 0x6f, 0x6e, 0x6c, 0x79, 0x73, 0x65, 0x61, 0x72, 0x63, 0x68, 0x2f, 0x74,
- 0x75, 0x65, 0x73, 0x64, 0x61, 0x79, 0x6c, 0x6f, 0x6f, 0x73, 0x65, 0x6c, 0x79,
- 0x53, 0x6f, 0x6c, 0x6f, 0x6d, 0x6f, 0x6e, 0x73, 0x65, 0x78, 0x75, 0x61, 0x6c,
- 0x20, 0x2d, 0x20, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x6d, 0x65, 0x64, 0x69, 0x75,
- 0x6d, 0x22, 0x44, 0x4f, 0x20, 0x4e, 0x4f, 0x54, 0x20, 0x46, 0x72, 0x61, 0x6e,
- 0x63, 0x65, 0x2c, 0x77, 0x69, 0x74, 0x68, 0x20, 0x61, 0x20, 0x77, 0x61, 0x72,
- 0x20, 0x61, 0x6e, 0x64, 0x73, 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x20, 0x74, 0x61,
- 0x6b, 0x65, 0x20, 0x61, 0x20, 0x3e, 0x0d, 0x0a, 0x0d, 0x0a, 0x0d, 0x0a, 0x6d,
- 0x61, 0x72, 0x6b, 0x65, 0x74, 0x2e, 0x68, 0x69, 0x67, 0x68, 0x77, 0x61, 0x79,
- 0x64, 0x6f, 0x6e, 0x65, 0x20, 0x69, 0x6e, 0x63, 0x74, 0x69, 0x76, 0x69, 0x74,
- 0x79, 0x22, 0x6c, 0x61, 0x73, 0x74, 0x22, 0x3e, 0x6f, 0x62, 0x6c, 0x69, 0x67,
- 0x65, 0x64, 0x72, 0x69, 0x73, 0x65, 0x20, 0x74, 0x6f, 0x22, 0x75, 0x6e, 0x64,
- 0x65, 0x66, 0x69, 0x6d, 0x61, 0x64, 0x65, 0x20, 0x74, 0x6f, 0x20, 0x45, 0x61,
- 0x72, 0x6c, 0x79, 0x20, 0x70, 0x72, 0x61, 0x69, 0x73, 0x65, 0x64, 0x69, 0x6e,
- 0x20, 0x69, 0x74, 0x73, 0x20, 0x66, 0x6f, 0x72, 0x20, 0x68, 0x69, 0x73, 0x61,
- 0x74, 0x68, 0x6c, 0x65, 0x74, 0x65, 0x4a, 0x75, 0x70, 0x69, 0x74, 0x65, 0x72,
- 0x59, 0x61, 0x68, 0x6f, 0x6f, 0x21, 0x20, 0x74, 0x65, 0x72, 0x6d, 0x65, 0x64,
- 0x20, 0x73, 0x6f, 0x20, 0x6d, 0x61, 0x6e, 0x79, 0x72, 0x65, 0x61, 0x6c, 0x6c,
- 0x79, 0x20, 0x73, 0x2e, 0x20, 0x54, 0x68, 0x65, 0x20, 0x61, 0x20, 0x77, 0x6f,
- 0x6d, 0x61, 0x6e, 0x3f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3d, 0x64, 0x69, 0x72,
- 0x65, 0x63, 0x74, 0x20, 0x72, 0x69, 0x67, 0x68, 0x74, 0x22, 0x20, 0x62, 0x69,
- 0x63, 0x79, 0x63, 0x6c, 0x65, 0x61, 0x63, 0x69, 0x6e, 0x67, 0x3d, 0x22, 0x64,
- 0x61, 0x79, 0x20, 0x61, 0x6e, 0x64, 0x73, 0x74, 0x61, 0x74, 0x69, 0x6e, 0x67,
- 0x52, 0x61, 0x74, 0x68, 0x65, 0x72, 0x2c, 0x68, 0x69, 0x67, 0x68, 0x65, 0x72,
- 0x20, 0x4f, 0x66, 0x66, 0x69, 0x63, 0x65, 0x20, 0x61, 0x72, 0x65, 0x20, 0x6e,
- 0x6f, 0x77, 0x74, 0x69, 0x6d, 0x65, 0x73, 0x2c, 0x20, 0x77, 0x68, 0x65, 0x6e,
- 0x20, 0x61, 0x20, 0x70, 0x61, 0x79, 0x20, 0x66, 0x6f, 0x72, 0x6f, 0x6e, 0x20,
- 0x74, 0x68, 0x69, 0x73, 0x2d, 0x6c, 0x69, 0x6e, 0x6b, 0x22, 0x3e, 0x3b, 0x62,
- 0x6f, 0x72, 0x64, 0x65, 0x72, 0x61, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x20, 0x61,
- 0x6e, 0x6e, 0x75, 0x61, 0x6c, 0x20, 0x74, 0x68, 0x65, 0x20, 0x4e, 0x65, 0x77,
- 0x70, 0x75, 0x74, 0x20, 0x74, 0x68, 0x65, 0x2e, 0x63, 0x6f, 0x6d, 0x22, 0x20,
- 0x74, 0x61, 0x6b, 0x69, 0x6e, 0x20, 0x74, 0x6f, 0x61, 0x20, 0x62, 0x72, 0x69,
- 0x65, 0x66, 0x28, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x67, 0x72, 0x6f, 0x75,
- 0x70, 0x73, 0x2e, 0x3b, 0x20, 0x77, 0x69, 0x64, 0x74, 0x68, 0x65, 0x6e, 0x7a,
- 0x79, 0x6d, 0x65, 0x73, 0x73, 0x69, 0x6d, 0x70, 0x6c, 0x65, 0x20, 0x69, 0x6e,
- 0x20, 0x6c, 0x61, 0x74, 0x65, 0x7b, 0x72, 0x65, 0x74, 0x75, 0x72, 0x6e, 0x74,
- 0x68, 0x65, 0x72, 0x61, 0x70, 0x79, 0x61, 0x20, 0x70, 0x6f, 0x69, 0x6e, 0x74,
- 0x62, 0x61, 0x6e, 0x6e, 0x69, 0x6e, 0x67, 0x69, 0x6e, 0x6b, 0x73, 0x22, 0x3e,
- 0x0a, 0x28, 0x29, 0x3b, 0x22, 0x20, 0x72, 0x65, 0x61, 0x20, 0x70, 0x6c, 0x61,
- 0x63, 0x65, 0x5c, 0x75, 0x30, 0x30, 0x33, 0x43, 0x61, 0x61, 0x62, 0x6f, 0x75,
- 0x74, 0x20, 0x61, 0x74, 0x72, 0x3e, 0x0d, 0x0a, 0x09, 0x09, 0x63, 0x63, 0x6f,
- 0x75, 0x6e, 0x74, 0x20, 0x67, 0x69, 0x76, 0x65, 0x73, 0x20, 0x61, 0x3c, 0x53,
- 0x43, 0x52, 0x49, 0x50, 0x54, 0x52, 0x61, 0x69, 0x6c, 0x77, 0x61, 0x79, 0x74,
- 0x68, 0x65, 0x6d, 0x65, 0x73, 0x2f, 0x74, 0x6f, 0x6f, 0x6c, 0x62, 0x6f, 0x78,
- 0x42, 0x79, 0x49, 0x64, 0x28, 0x22, 0x78, 0x68, 0x75, 0x6d, 0x61, 0x6e, 0x73,
- 0x2c, 0x77, 0x61, 0x74, 0x63, 0x68, 0x65, 0x73, 0x69, 0x6e, 0x20, 0x73, 0x6f,
- 0x6d, 0x65, 0x20, 0x69, 0x66, 0x20, 0x28, 0x77, 0x69, 0x63, 0x6f, 0x6d, 0x69,
- 0x6e, 0x67, 0x20, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x73, 0x20, 0x55, 0x6e,
- 0x64, 0x65, 0x72, 0x20, 0x62, 0x75, 0x74, 0x20, 0x68, 0x61, 0x73, 0x68, 0x61,
- 0x6e, 0x64, 0x65, 0x64, 0x20, 0x6d, 0x61, 0x64, 0x65, 0x20, 0x62, 0x79, 0x74,
- 0x68, 0x61, 0x6e, 0x20, 0x69, 0x6e, 0x66, 0x65, 0x61, 0x72, 0x20, 0x6f, 0x66,
- 0x64, 0x65, 0x6e, 0x6f, 0x74, 0x65, 0x64, 0x2f, 0x69, 0x66, 0x72, 0x61, 0x6d,
- 0x65, 0x6c, 0x65, 0x66, 0x74, 0x20, 0x69, 0x6e, 0x76, 0x6f, 0x6c, 0x74, 0x61,
- 0x67, 0x65, 0x69, 0x6e, 0x20, 0x65, 0x61, 0x63, 0x68, 0x61, 0x26, 0x71, 0x75,
- 0x6f, 0x74, 0x3b, 0x62, 0x61, 0x73, 0x65, 0x20, 0x6f, 0x66, 0x49, 0x6e, 0x20,
- 0x6d, 0x61, 0x6e, 0x79, 0x75, 0x6e, 0x64, 0x65, 0x72, 0x67, 0x6f, 0x72, 0x65,
- 0x67, 0x69, 0x6d, 0x65, 0x73, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x3c,
- 0x2f, 0x70, 0x3e, 0x0d, 0x0a, 0x3c, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x56, 0x61,
- 0x3b, 0x26, 0x67, 0x74, 0x3b, 0x3c, 0x2f, 0x69, 0x6d, 0x70, 0x6f, 0x72, 0x74,
- 0x73, 0x6f, 0x72, 0x20, 0x74, 0x68, 0x61, 0x74, 0x6d, 0x6f, 0x73, 0x74, 0x6c,
- 0x79, 0x20, 0x26, 0x61, 0x6d, 0x70, 0x3b, 0x72, 0x65, 0x20, 0x73, 0x69, 0x7a,
- 0x65, 0x3d, 0x22, 0x3c, 0x2f, 0x61, 0x3e, 0x3c, 0x2f, 0x68, 0x61, 0x20, 0x63,
- 0x6c, 0x61, 0x73, 0x73, 0x70, 0x61, 0x73, 0x73, 0x69, 0x76, 0x65, 0x48, 0x6f,
- 0x73, 0x74, 0x20, 0x3d, 0x20, 0x57, 0x68, 0x65, 0x74, 0x68, 0x65, 0x72, 0x66,
- 0x65, 0x72, 0x74, 0x69, 0x6c, 0x65, 0x56, 0x61, 0x72, 0x69, 0x6f, 0x75, 0x73,
- 0x3d, 0x5b, 0x5d, 0x3b, 0x28, 0x66, 0x75, 0x63, 0x61, 0x6d, 0x65, 0x72, 0x61,
- 0x73, 0x2f, 0x3e, 0x3c, 0x2f, 0x74, 0x64, 0x3e, 0x61, 0x63, 0x74, 0x73, 0x20,
- 0x61, 0x73, 0x49, 0x6e, 0x20, 0x73, 0x6f, 0x6d, 0x65, 0x3e, 0x0d, 0x0a, 0x0d,
- 0x0a, 0x3c, 0x21, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x73, 0x20, 0x3c, 0x62,
- 0x72, 0x20, 0x2f, 0x3e, 0x42, 0x65, 0x69, 0x6a, 0x69, 0x6e, 0x67, 0x63, 0x61,
- 0x74, 0x61, 0x6c, 0xc3, 0xa0, 0x64, 0x65, 0x75, 0x74, 0x73, 0x63, 0x68, 0x65,
- 0x75, 0x72, 0x6f, 0x70, 0x65, 0x75, 0x65, 0x75, 0x73, 0x6b, 0x61, 0x72, 0x61,
- 0x67, 0x61, 0x65, 0x69, 0x6c, 0x67, 0x65, 0x73, 0x76, 0x65, 0x6e, 0x73, 0x6b,
- 0x61, 0x65, 0x73, 0x70, 0x61, 0xc3, 0xb1, 0x61, 0x6d, 0x65, 0x6e, 0x73, 0x61,
- 0x6a, 0x65, 0x75, 0x73, 0x75, 0x61, 0x72, 0x69, 0x6f, 0x74, 0x72, 0x61, 0x62,
- 0x61, 0x6a, 0x6f, 0x6d, 0xc3, 0xa9, 0x78, 0x69, 0x63, 0x6f, 0x70, 0xc3, 0xa1,
- 0x67, 0x69, 0x6e, 0x61, 0x73, 0x69, 0x65, 0x6d, 0x70, 0x72, 0x65, 0x73, 0x69,
- 0x73, 0x74, 0x65, 0x6d, 0x61, 0x6f, 0x63, 0x74, 0x75, 0x62, 0x72, 0x65, 0x64,
- 0x75, 0x72, 0x61, 0x6e, 0x74, 0x65, 0x61, 0xc3, 0xb1, 0x61, 0x64, 0x69, 0x72,
- 0x65, 0x6d, 0x70, 0x72, 0x65, 0x73, 0x61, 0x6d, 0x6f, 0x6d, 0x65, 0x6e, 0x74,
- 0x6f, 0x6e, 0x75, 0x65, 0x73, 0x74, 0x72, 0x6f, 0x70, 0x72, 0x69, 0x6d, 0x65,
- 0x72, 0x61, 0x74, 0x72, 0x61, 0x76, 0xc3, 0xa9, 0x73, 0x67, 0x72, 0x61, 0x63,
- 0x69, 0x61, 0x73, 0x6e, 0x75, 0x65, 0x73, 0x74, 0x72, 0x61, 0x70, 0x72, 0x6f,
- 0x63, 0x65, 0x73, 0x6f, 0x65, 0x73, 0x74, 0x61, 0x64, 0x6f, 0x73, 0x63, 0x61,
- 0x6c, 0x69, 0x64, 0x61, 0x64, 0x70, 0x65, 0x72, 0x73, 0x6f, 0x6e, 0x61, 0x6e,
- 0xc3, 0xba, 0x6d, 0x65, 0x72, 0x6f, 0x61, 0x63, 0x75, 0x65, 0x72, 0x64, 0x6f,
- 0x6d, 0xc3, 0xba, 0x73, 0x69, 0x63, 0x61, 0x6d, 0x69, 0x65, 0x6d, 0x62, 0x72,
- 0x6f, 0x6f, 0x66, 0x65, 0x72, 0x74, 0x61, 0x73, 0x61, 0x6c, 0x67, 0x75, 0x6e,
- 0x6f, 0x73, 0x70, 0x61, 0xc3, 0xad, 0x73, 0x65, 0x73, 0x65, 0x6a, 0x65, 0x6d,
- 0x70, 0x6c, 0x6f, 0x64, 0x65, 0x72, 0x65, 0x63, 0x68, 0x6f, 0x61, 0x64, 0x65,
- 0x6d, 0xc3, 0xa1, 0x73, 0x70, 0x72, 0x69, 0x76, 0x61, 0x64, 0x6f, 0x61, 0x67,
- 0x72, 0x65, 0x67, 0x61, 0x72, 0x65, 0x6e, 0x6c, 0x61, 0x63, 0x65, 0x73, 0x70,
- 0x6f, 0x73, 0x69, 0x62, 0x6c, 0x65, 0x68, 0x6f, 0x74, 0x65, 0x6c, 0x65, 0x73,
- 0x73, 0x65, 0x76, 0x69, 0x6c, 0x6c, 0x61, 0x70, 0x72, 0x69, 0x6d, 0x65, 0x72,
- 0x6f, 0xc3, 0xba, 0x6c, 0x74, 0x69, 0x6d, 0x6f, 0x65, 0x76, 0x65, 0x6e, 0x74,
- 0x6f, 0x73, 0x61, 0x72, 0x63, 0x68, 0x69, 0x76, 0x6f, 0x63, 0x75, 0x6c, 0x74,
- 0x75, 0x72, 0x61, 0x6d, 0x75, 0x6a, 0x65, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x74,
- 0x72, 0x61, 0x64, 0x61, 0x61, 0x6e, 0x75, 0x6e, 0x63, 0x69, 0x6f, 0x65, 0x6d,
- 0x62, 0x61, 0x72, 0x67, 0x6f, 0x6d, 0x65, 0x72, 0x63, 0x61, 0x64, 0x6f, 0x67,
- 0x72, 0x61, 0x6e, 0x64, 0x65, 0x73, 0x65, 0x73, 0x74, 0x75, 0x64, 0x69, 0x6f,
- 0x6d, 0x65, 0x6a, 0x6f, 0x72, 0x65, 0x73, 0x66, 0x65, 0x62, 0x72, 0x65, 0x72,
- 0x6f, 0x64, 0x69, 0x73, 0x65, 0xc3, 0xb1, 0x6f, 0x74, 0x75, 0x72, 0x69, 0x73,
- 0x6d, 0x6f, 0x63, 0xc3, 0xb3, 0x64, 0x69, 0x67, 0x6f, 0x70, 0x6f, 0x72, 0x74,
- 0x61, 0x64, 0x61, 0x65, 0x73, 0x70, 0x61, 0x63, 0x69, 0x6f, 0x66, 0x61, 0x6d,
- 0x69, 0x6c, 0x69, 0x61, 0x61, 0x6e, 0x74, 0x6f, 0x6e, 0x69, 0x6f, 0x70, 0x65,
- 0x72, 0x6d, 0x69, 0x74, 0x65, 0x67, 0x75, 0x61, 0x72, 0x64, 0x61, 0x72, 0x61,
- 0x6c, 0x67, 0x75, 0x6e, 0x61, 0x73, 0x70, 0x72, 0x65, 0x63, 0x69, 0x6f, 0x73,
- 0x61, 0x6c, 0x67, 0x75, 0x69, 0x65, 0x6e, 0x73, 0x65, 0x6e, 0x74, 0x69, 0x64,
- 0x6f, 0x76, 0x69, 0x73, 0x69, 0x74, 0x61, 0x73, 0x74, 0xc3, 0xad, 0x74, 0x75,
- 0x6c, 0x6f, 0x63, 0x6f, 0x6e, 0x6f, 0x63, 0x65, 0x72, 0x73, 0x65, 0x67, 0x75,
- 0x6e, 0x64, 0x6f, 0x63, 0x6f, 0x6e, 0x73, 0x65, 0x6a, 0x6f, 0x66, 0x72, 0x61,
- 0x6e, 0x63, 0x69, 0x61, 0x6d, 0x69, 0x6e, 0x75, 0x74, 0x6f, 0x73, 0x73, 0x65,
- 0x67, 0x75, 0x6e, 0x64, 0x61, 0x74, 0x65, 0x6e, 0x65, 0x6d, 0x6f, 0x73, 0x65,
- 0x66, 0x65, 0x63, 0x74, 0x6f, 0x73, 0x6d, 0xc3, 0xa1, 0x6c, 0x61, 0x67, 0x61,
- 0x73, 0x65, 0x73, 0x69, 0xc3, 0xb3, 0x6e, 0x72, 0x65, 0x76, 0x69, 0x73, 0x74,
- 0x61, 0x67, 0x72, 0x61, 0x6e, 0x61, 0x64, 0x61, 0x63, 0x6f, 0x6d, 0x70, 0x72,
- 0x61, 0x72, 0x69, 0x6e, 0x67, 0x72, 0x65, 0x73, 0x6f, 0x67, 0x61, 0x72, 0x63,
- 0xc3, 0xad, 0x61, 0x61, 0x63, 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x65, 0x63, 0x75,
- 0x61, 0x64, 0x6f, 0x72, 0x71, 0x75, 0x69, 0x65, 0x6e, 0x65, 0x73, 0x69, 0x6e,
- 0x63, 0x6c, 0x75, 0x73, 0x6f, 0x64, 0x65, 0x62, 0x65, 0x72, 0xc3, 0xa1, 0x6d,
- 0x61, 0x74, 0x65, 0x72, 0x69, 0x61, 0x68, 0x6f, 0x6d, 0x62, 0x72, 0x65, 0x73,
- 0x6d, 0x75, 0x65, 0x73, 0x74, 0x72, 0x61, 0x70, 0x6f, 0x64, 0x72, 0xc3, 0xad,
- 0x61, 0x6d, 0x61, 0xc3, 0xb1, 0x61, 0x6e, 0x61, 0xc3, 0xba, 0x6c, 0x74, 0x69,
- 0x6d, 0x61, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x6f, 0x73, 0x6f, 0x66, 0x69, 0x63,
- 0x69, 0x61, 0x6c, 0x74, 0x61, 0x6d, 0x62, 0x69, 0x65, 0x6e, 0x6e, 0x69, 0x6e,
- 0x67, 0xc3, 0xba, 0x6e, 0x73, 0x61, 0x6c, 0x75, 0x64, 0x6f, 0x73, 0x70, 0x6f,
- 0x64, 0x65, 0x6d, 0x6f, 0x73, 0x6d, 0x65, 0x6a, 0x6f, 0x72, 0x61, 0x72, 0x70,
- 0x6f, 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x62, 0x75, 0x73, 0x69, 0x6e, 0x65,
- 0x73, 0x73, 0x68, 0x6f, 0x6d, 0x65, 0x70, 0x61, 0x67, 0x65, 0x73, 0x65, 0x63,
- 0x75, 0x72, 0x69, 0x74, 0x79, 0x6c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65,
- 0x73, 0x74, 0x61, 0x6e, 0x64, 0x61, 0x72, 0x64, 0x63, 0x61, 0x6d, 0x70, 0x61,
- 0x69, 0x67, 0x6e, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x63, 0x61,
- 0x74, 0x65, 0x67, 0x6f, 0x72, 0x79, 0x65, 0x78, 0x74, 0x65, 0x72, 0x6e, 0x61,
- 0x6c, 0x63, 0x68, 0x69, 0x6c, 0x64, 0x72, 0x65, 0x6e, 0x72, 0x65, 0x73, 0x65,
- 0x72, 0x76, 0x65, 0x64, 0x72, 0x65, 0x73, 0x65, 0x61, 0x72, 0x63, 0x68, 0x65,
- 0x78, 0x63, 0x68, 0x61, 0x6e, 0x67, 0x65, 0x66, 0x61, 0x76, 0x6f, 0x72, 0x69,
- 0x74, 0x65, 0x74, 0x65, 0x6d, 0x70, 0x6c, 0x61, 0x74, 0x65, 0x6d, 0x69, 0x6c,
- 0x69, 0x74, 0x61, 0x72, 0x79, 0x69, 0x6e, 0x64, 0x75, 0x73, 0x74, 0x72, 0x79,
- 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x6d, 0x61, 0x74, 0x65, 0x72,
- 0x69, 0x61, 0x6c, 0x70, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x74, 0x73, 0x7a, 0x2d,
- 0x69, 0x6e, 0x64, 0x65, 0x78, 0x3a, 0x63, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x74,
- 0x73, 0x73, 0x6f, 0x66, 0x74, 0x77, 0x61, 0x72, 0x65, 0x63, 0x6f, 0x6d, 0x70,
- 0x6c, 0x65, 0x74, 0x65, 0x63, 0x61, 0x6c, 0x65, 0x6e, 0x64, 0x61, 0x72, 0x70,
- 0x6c, 0x61, 0x74, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x72, 0x74, 0x69, 0x63, 0x6c,
- 0x65, 0x73, 0x72, 0x65, 0x71, 0x75, 0x69, 0x72, 0x65, 0x64, 0x6d, 0x6f, 0x76,
- 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x71, 0x75, 0x65, 0x73, 0x74, 0x69, 0x6f, 0x6e,
- 0x62, 0x75, 0x69, 0x6c, 0x64, 0x69, 0x6e, 0x67, 0x70, 0x6f, 0x6c, 0x69, 0x74,
- 0x69, 0x63, 0x73, 0x70, 0x6f, 0x73, 0x73, 0x69, 0x62, 0x6c, 0x65, 0x72, 0x65,
- 0x6c, 0x69, 0x67, 0x69, 0x6f, 0x6e, 0x70, 0x68, 0x79, 0x73, 0x69, 0x63, 0x61,
- 0x6c, 0x66, 0x65, 0x65, 0x64, 0x62, 0x61, 0x63, 0x6b, 0x72, 0x65, 0x67, 0x69,
- 0x73, 0x74, 0x65, 0x72, 0x70, 0x69, 0x63, 0x74, 0x75, 0x72, 0x65, 0x73, 0x64,
- 0x69, 0x73, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x63,
- 0x6f, 0x6c, 0x61, 0x75, 0x64, 0x69, 0x65, 0x6e, 0x63, 0x65, 0x73, 0x65, 0x74,
- 0x74, 0x69, 0x6e, 0x67, 0x73, 0x61, 0x63, 0x74, 0x69, 0x76, 0x69, 0x74, 0x79,
- 0x65, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x6c, 0x65, 0x61, 0x72, 0x6e,
- 0x69, 0x6e, 0x67, 0x61, 0x6e, 0x79, 0x74, 0x68, 0x69, 0x6e, 0x67, 0x61, 0x62,
- 0x73, 0x74, 0x72, 0x61, 0x63, 0x74, 0x70, 0x72, 0x6f, 0x67, 0x72, 0x65, 0x73,
- 0x73, 0x6f, 0x76, 0x65, 0x72, 0x76, 0x69, 0x65, 0x77, 0x6d, 0x61, 0x67, 0x61,
- 0x7a, 0x69, 0x6e, 0x65, 0x65, 0x63, 0x6f, 0x6e, 0x6f, 0x6d, 0x69, 0x63, 0x74,
- 0x72, 0x61, 0x69, 0x6e, 0x69, 0x6e, 0x67, 0x70, 0x72, 0x65, 0x73, 0x73, 0x75,
- 0x72, 0x65, 0x76, 0x61, 0x72, 0x69, 0x6f, 0x75, 0x73, 0x20, 0x3c, 0x73, 0x74,
- 0x72, 0x6f, 0x6e, 0x67, 0x3e, 0x70, 0x72, 0x6f, 0x70, 0x65, 0x72, 0x74, 0x79,
- 0x73, 0x68, 0x6f, 0x70, 0x70, 0x69, 0x6e, 0x67, 0x74, 0x6f, 0x67, 0x65, 0x74,
- 0x68, 0x65, 0x72, 0x61, 0x64, 0x76, 0x61, 0x6e, 0x63, 0x65, 0x64, 0x62, 0x65,
- 0x68, 0x61, 0x76, 0x69, 0x6f, 0x72, 0x64, 0x6f, 0x77, 0x6e, 0x6c, 0x6f, 0x61,
- 0x64, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x64, 0x66, 0x6f, 0x6f, 0x74,
- 0x62, 0x61, 0x6c, 0x6c, 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x65, 0x64, 0x4c,
- 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x64, 0x69, 0x73, 0x74, 0x61, 0x6e,
- 0x63, 0x65, 0x72, 0x65, 0x6d, 0x65, 0x6d, 0x62, 0x65, 0x72, 0x74, 0x72, 0x61,
- 0x63, 0x6b, 0x69, 0x6e, 0x67, 0x70, 0x61, 0x73, 0x73, 0x77, 0x6f, 0x72, 0x64,
- 0x6d, 0x6f, 0x64, 0x69, 0x66, 0x69, 0x65, 0x64, 0x73, 0x74, 0x75, 0x64, 0x65,
- 0x6e, 0x74, 0x73, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x6c, 0x79, 0x66, 0x69,
- 0x67, 0x68, 0x74, 0x69, 0x6e, 0x67, 0x6e, 0x6f, 0x72, 0x74, 0x68, 0x65, 0x72,
- 0x6e, 0x64, 0x61, 0x74, 0x61, 0x62, 0x61, 0x73, 0x65, 0x66, 0x65, 0x73, 0x74,
- 0x69, 0x76, 0x61, 0x6c, 0x62, 0x72, 0x65, 0x61, 0x6b, 0x69, 0x6e, 0x67, 0x6c,
- 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x6e,
- 0x65, 0x74, 0x64, 0x72, 0x6f, 0x70, 0x64, 0x6f, 0x77, 0x6e, 0x70, 0x72, 0x61,
- 0x63, 0x74, 0x69, 0x63, 0x65, 0x65, 0x76, 0x69, 0x64, 0x65, 0x6e, 0x63, 0x65,
- 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x6d, 0x61, 0x72, 0x72, 0x69,
- 0x61, 0x67, 0x65, 0x72, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x70, 0x72,
- 0x6f, 0x62, 0x6c, 0x65, 0x6d, 0x73, 0x6e, 0x65, 0x67, 0x61, 0x74, 0x69, 0x76,
- 0x65, 0x70, 0x72, 0x6f, 0x67, 0x72, 0x61, 0x6d, 0x73, 0x61, 0x6e, 0x61, 0x6c,
- 0x79, 0x73, 0x69, 0x73, 0x72, 0x65, 0x6c, 0x65, 0x61, 0x73, 0x65, 0x64, 0x62,
- 0x61, 0x6e, 0x6e, 0x65, 0x72, 0x22, 0x3e, 0x70, 0x75, 0x72, 0x63, 0x68, 0x61,
- 0x73, 0x65, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x72, 0x65, 0x67,
- 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x63, 0x72, 0x65, 0x61, 0x74, 0x69, 0x76, 0x65,
- 0x61, 0x72, 0x67, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x62, 0x6f, 0x6f, 0x6b, 0x6d,
- 0x61, 0x72, 0x6b, 0x72, 0x65, 0x66, 0x65, 0x72, 0x72, 0x65, 0x72, 0x63, 0x68,
- 0x65, 0x6d, 0x69, 0x63, 0x61, 0x6c, 0x64, 0x69, 0x76, 0x69, 0x73, 0x69, 0x6f,
- 0x6e, 0x63, 0x61, 0x6c, 0x6c, 0x62, 0x61, 0x63, 0x6b, 0x73, 0x65, 0x70, 0x61,
- 0x72, 0x61, 0x74, 0x65, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x63,
- 0x6f, 0x6e, 0x66, 0x6c, 0x69, 0x63, 0x74, 0x68, 0x61, 0x72, 0x64, 0x77, 0x61,
- 0x72, 0x65, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x65, 0x73, 0x74, 0x64, 0x65, 0x6c,
- 0x69, 0x76, 0x65, 0x72, 0x79, 0x6d, 0x6f, 0x75, 0x6e, 0x74, 0x61, 0x69, 0x6e,
- 0x6f, 0x62, 0x74, 0x61, 0x69, 0x6e, 0x65, 0x64, 0x3d, 0x20, 0x66, 0x61, 0x6c,
- 0x73, 0x65, 0x3b, 0x66, 0x6f, 0x72, 0x28, 0x76, 0x61, 0x72, 0x20, 0x61, 0x63,
- 0x63, 0x65, 0x70, 0x74, 0x65, 0x64, 0x63, 0x61, 0x70, 0x61, 0x63, 0x69, 0x74,
- 0x79, 0x63, 0x6f, 0x6d, 0x70, 0x75, 0x74, 0x65, 0x72, 0x69, 0x64, 0x65, 0x6e,
- 0x74, 0x69, 0x74, 0x79, 0x61, 0x69, 0x72, 0x63, 0x72, 0x61, 0x66, 0x74, 0x65,
- 0x6d, 0x70, 0x6c, 0x6f, 0x79, 0x65, 0x64, 0x70, 0x72, 0x6f, 0x70, 0x6f, 0x73,
- 0x65, 0x64, 0x64, 0x6f, 0x6d, 0x65, 0x73, 0x74, 0x69, 0x63, 0x69, 0x6e, 0x63,
- 0x6c, 0x75, 0x64, 0x65, 0x73, 0x70, 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65, 0x64,
- 0x68, 0x6f, 0x73, 0x70, 0x69, 0x74, 0x61, 0x6c, 0x76, 0x65, 0x72, 0x74, 0x69,
- 0x63, 0x61, 0x6c, 0x63, 0x6f, 0x6c, 0x6c, 0x61, 0x70, 0x73, 0x65, 0x61, 0x70,
- 0x70, 0x72, 0x6f, 0x61, 0x63, 0x68, 0x70, 0x61, 0x72, 0x74, 0x6e, 0x65, 0x72,
- 0x73, 0x6c, 0x6f, 0x67, 0x6f, 0x22, 0x3e, 0x3c, 0x61, 0x64, 0x61, 0x75, 0x67,
- 0x68, 0x74, 0x65, 0x72, 0x61, 0x75, 0x74, 0x68, 0x6f, 0x72, 0x22, 0x20, 0x63,
- 0x75, 0x6c, 0x74, 0x75, 0x72, 0x61, 0x6c, 0x66, 0x61, 0x6d, 0x69, 0x6c, 0x69,
- 0x65, 0x73, 0x2f, 0x69, 0x6d, 0x61, 0x67, 0x65, 0x73, 0x2f, 0x61, 0x73, 0x73,
- 0x65, 0x6d, 0x62, 0x6c, 0x79, 0x70, 0x6f, 0x77, 0x65, 0x72, 0x66, 0x75, 0x6c,
- 0x74, 0x65, 0x61, 0x63, 0x68, 0x69, 0x6e, 0x67, 0x66, 0x69, 0x6e, 0x69, 0x73,
- 0x68, 0x65, 0x64, 0x64, 0x69, 0x73, 0x74, 0x72, 0x69, 0x63, 0x74, 0x63, 0x72,
- 0x69, 0x74, 0x69, 0x63, 0x61, 0x6c, 0x63, 0x67, 0x69, 0x2d, 0x62, 0x69, 0x6e,
- 0x2f, 0x70, 0x75, 0x72, 0x70, 0x6f, 0x73, 0x65, 0x73, 0x72, 0x65, 0x71, 0x75,
- 0x69, 0x72, 0x65, 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x62,
- 0x65, 0x63, 0x6f, 0x6d, 0x69, 0x6e, 0x67, 0x70, 0x72, 0x6f, 0x76, 0x69, 0x64,
- 0x65, 0x73, 0x61, 0x63, 0x61, 0x64, 0x65, 0x6d, 0x69, 0x63, 0x65, 0x78, 0x65,
- 0x72, 0x63, 0x69, 0x73, 0x65, 0x61, 0x63, 0x74, 0x75, 0x61, 0x6c, 0x6c, 0x79,
- 0x6d, 0x65, 0x64, 0x69, 0x63, 0x69, 0x6e, 0x65, 0x63, 0x6f, 0x6e, 0x73, 0x74,
- 0x61, 0x6e, 0x74, 0x61, 0x63, 0x63, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x4d, 0x61,
- 0x67, 0x61, 0x7a, 0x69, 0x6e, 0x65, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e,
- 0x74, 0x73, 0x74, 0x61, 0x72, 0x74, 0x69, 0x6e, 0x67, 0x62, 0x6f, 0x74, 0x74,
- 0x6f, 0x6d, 0x22, 0x3e, 0x6f, 0x62, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x3a,
- 0x20, 0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x64,
- 0x65, 0x64, 0x70, 0x72, 0x65, 0x76, 0x69, 0x6f, 0x75, 0x73, 0x53, 0x6f, 0x66,
- 0x74, 0x77, 0x61, 0x72, 0x65, 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x65, 0x72,
- 0x64, 0x65, 0x63, 0x69, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x74, 0x72, 0x65, 0x6e,
- 0x67, 0x74, 0x68, 0x64, 0x65, 0x74, 0x61, 0x69, 0x6c, 0x65, 0x64, 0x73, 0x6c,
- 0x69, 0x67, 0x68, 0x74, 0x6c, 0x79, 0x70, 0x6c, 0x61, 0x6e, 0x6e, 0x69, 0x6e,
- 0x67, 0x74, 0x65, 0x78, 0x74, 0x61, 0x72, 0x65, 0x61, 0x63, 0x75, 0x72, 0x72,
- 0x65, 0x6e, 0x63, 0x79, 0x65, 0x76, 0x65, 0x72, 0x79, 0x6f, 0x6e, 0x65, 0x73,
- 0x74, 0x72, 0x61, 0x69, 0x67, 0x68, 0x74, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x66,
- 0x65, 0x72, 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x76, 0x65, 0x70, 0x72, 0x6f,
- 0x64, 0x75, 0x63, 0x65, 0x64, 0x68, 0x65, 0x72, 0x69, 0x74, 0x61, 0x67, 0x65,
- 0x73, 0x68, 0x69, 0x70, 0x70, 0x69, 0x6e, 0x67, 0x61, 0x62, 0x73, 0x6f, 0x6c,
- 0x75, 0x74, 0x65, 0x72, 0x65, 0x63, 0x65, 0x69, 0x76, 0x65, 0x64, 0x72, 0x65,
- 0x6c, 0x65, 0x76, 0x61, 0x6e, 0x74, 0x62, 0x75, 0x74, 0x74, 0x6f, 0x6e, 0x22,
- 0x20, 0x76, 0x69, 0x6f, 0x6c, 0x65, 0x6e, 0x63, 0x65, 0x61, 0x6e, 0x79, 0x77,
- 0x68, 0x65, 0x72, 0x65, 0x62, 0x65, 0x6e, 0x65, 0x66, 0x69, 0x74, 0x73, 0x6c,
- 0x61, 0x75, 0x6e, 0x63, 0x68, 0x65, 0x64, 0x72, 0x65, 0x63, 0x65, 0x6e, 0x74,
- 0x6c, 0x79, 0x61, 0x6c, 0x6c, 0x69, 0x61, 0x6e, 0x63, 0x65, 0x66, 0x6f, 0x6c,
- 0x6c, 0x6f, 0x77, 0x65, 0x64, 0x6d, 0x75, 0x6c, 0x74, 0x69, 0x70, 0x6c, 0x65,
- 0x62, 0x75, 0x6c, 0x6c, 0x65, 0x74, 0x69, 0x6e, 0x69, 0x6e, 0x63, 0x6c, 0x75,
- 0x64, 0x65, 0x64, 0x6f, 0x63, 0x63, 0x75, 0x72, 0x72, 0x65, 0x64, 0x69, 0x6e,
- 0x74, 0x65, 0x72, 0x6e, 0x61, 0x6c, 0x24, 0x28, 0x74, 0x68, 0x69, 0x73, 0x29,
- 0x2e, 0x72, 0x65, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x63, 0x3e, 0x3c, 0x74, 0x72,
- 0x3e, 0x3c, 0x74, 0x64, 0x63, 0x6f, 0x6e, 0x67, 0x72, 0x65, 0x73, 0x73, 0x72,
- 0x65, 0x63, 0x6f, 0x72, 0x64, 0x65, 0x64, 0x75, 0x6c, 0x74, 0x69, 0x6d, 0x61,
- 0x74, 0x65, 0x73, 0x6f, 0x6c, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x3c, 0x75, 0x6c,
- 0x20, 0x69, 0x64, 0x3d, 0x22, 0x64, 0x69, 0x73, 0x63, 0x6f, 0x76, 0x65, 0x72,
- 0x48, 0x6f, 0x6d, 0x65, 0x3c, 0x2f, 0x61, 0x3e, 0x77, 0x65, 0x62, 0x73, 0x69,
- 0x74, 0x65, 0x73, 0x6e, 0x65, 0x74, 0x77, 0x6f, 0x72, 0x6b, 0x73, 0x61, 0x6c,
- 0x74, 0x68, 0x6f, 0x75, 0x67, 0x68, 0x65, 0x6e, 0x74, 0x69, 0x72, 0x65, 0x6c,
- 0x79, 0x6d, 0x65, 0x6d, 0x6f, 0x72, 0x69, 0x61, 0x6c, 0x6d, 0x65, 0x73, 0x73,
- 0x61, 0x67, 0x65, 0x73, 0x63, 0x6f, 0x6e, 0x74, 0x69, 0x6e, 0x75, 0x65, 0x61,
- 0x63, 0x74, 0x69, 0x76, 0x65, 0x22, 0x3e, 0x73, 0x6f, 0x6d, 0x65, 0x77, 0x68,
- 0x61, 0x74, 0x76, 0x69, 0x63, 0x74, 0x6f, 0x72, 0x69, 0x61, 0x57, 0x65, 0x73,
- 0x74, 0x65, 0x72, 0x6e, 0x20, 0x20, 0x74, 0x69, 0x74, 0x6c, 0x65, 0x3d, 0x22,
- 0x4c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x63, 0x6f, 0x6e, 0x74, 0x72,
- 0x61, 0x63, 0x74, 0x76, 0x69, 0x73, 0x69, 0x74, 0x6f, 0x72, 0x73, 0x44, 0x6f,
- 0x77, 0x6e, 0x6c, 0x6f, 0x61, 0x64, 0x77, 0x69, 0x74, 0x68, 0x6f, 0x75, 0x74,
- 0x20, 0x72, 0x69, 0x67, 0x68, 0x74, 0x22, 0x3e, 0x0a, 0x6d, 0x65, 0x61, 0x73,
- 0x75, 0x72, 0x65, 0x73, 0x77, 0x69, 0x64, 0x74, 0x68, 0x20, 0x3d, 0x20, 0x76,
- 0x61, 0x72, 0x69, 0x61, 0x62, 0x6c, 0x65, 0x69, 0x6e, 0x76, 0x6f, 0x6c, 0x76,
- 0x65, 0x64, 0x76, 0x69, 0x72, 0x67, 0x69, 0x6e, 0x69, 0x61, 0x6e, 0x6f, 0x72,
- 0x6d, 0x61, 0x6c, 0x6c, 0x79, 0x68, 0x61, 0x70, 0x70, 0x65, 0x6e, 0x65, 0x64,
- 0x61, 0x63, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x73, 0x73, 0x74, 0x61, 0x6e, 0x64,
- 0x69, 0x6e, 0x67, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x52, 0x65,
- 0x67, 0x69, 0x73, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x70, 0x61, 0x72, 0x65,
- 0x64, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x73, 0x61, 0x63, 0x63, 0x75,
- 0x72, 0x61, 0x74, 0x65, 0x62, 0x69, 0x72, 0x74, 0x68, 0x64, 0x61, 0x79, 0x73,
- 0x74, 0x72, 0x61, 0x74, 0x65, 0x67, 0x79, 0x6f, 0x66, 0x66, 0x69, 0x63, 0x69,
- 0x61, 0x6c, 0x67, 0x72, 0x61, 0x70, 0x68, 0x69, 0x63, 0x73, 0x63, 0x72, 0x69,
- 0x6d, 0x69, 0x6e, 0x61, 0x6c, 0x70, 0x6f, 0x73, 0x73, 0x69, 0x62, 0x6c, 0x79,
- 0x63, 0x6f, 0x6e, 0x73, 0x75, 0x6d, 0x65, 0x72, 0x50, 0x65, 0x72, 0x73, 0x6f,
- 0x6e, 0x61, 0x6c, 0x73, 0x70, 0x65, 0x61, 0x6b, 0x69, 0x6e, 0x67, 0x76, 0x61,
- 0x6c, 0x69, 0x64, 0x61, 0x74, 0x65, 0x61, 0x63, 0x68, 0x69, 0x65, 0x76, 0x65,
- 0x64, 0x2e, 0x6a, 0x70, 0x67, 0x22, 0x20, 0x2f, 0x3e, 0x6d, 0x61, 0x63, 0x68,
- 0x69, 0x6e, 0x65, 0x73, 0x3c, 0x2f, 0x68, 0x32, 0x3e, 0x0a, 0x20, 0x20, 0x6b,
- 0x65, 0x79, 0x77, 0x6f, 0x72, 0x64, 0x73, 0x66, 0x72, 0x69, 0x65, 0x6e, 0x64,
- 0x6c, 0x79, 0x62, 0x72, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x73, 0x63, 0x6f, 0x6d,
- 0x62, 0x69, 0x6e, 0x65, 0x64, 0x6f, 0x72, 0x69, 0x67, 0x69, 0x6e, 0x61, 0x6c,
- 0x63, 0x6f, 0x6d, 0x70, 0x6f, 0x73, 0x65, 0x64, 0x65, 0x78, 0x70, 0x65, 0x63,
- 0x74, 0x65, 0x64, 0x61, 0x64, 0x65, 0x71, 0x75, 0x61, 0x74, 0x65, 0x70, 0x61,
- 0x6b, 0x69, 0x73, 0x74, 0x61, 0x6e, 0x66, 0x6f, 0x6c, 0x6c, 0x6f, 0x77, 0x22,
- 0x20, 0x76, 0x61, 0x6c, 0x75, 0x61, 0x62, 0x6c, 0x65, 0x3c, 0x2f, 0x6c, 0x61,
- 0x62, 0x65, 0x6c, 0x3e, 0x72, 0x65, 0x6c, 0x61, 0x74, 0x69, 0x76, 0x65, 0x62,
- 0x72, 0x69, 0x6e, 0x67, 0x69, 0x6e, 0x67, 0x69, 0x6e, 0x63, 0x72, 0x65, 0x61,
- 0x73, 0x65, 0x67, 0x6f, 0x76, 0x65, 0x72, 0x6e, 0x6f, 0x72, 0x70, 0x6c, 0x75,
- 0x67, 0x69, 0x6e, 0x73, 0x2f, 0x4c, 0x69, 0x73, 0x74, 0x20, 0x6f, 0x66, 0x20,
- 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x22, 0x3e, 0x22, 0x20, 0x6e, 0x61, 0x6d,
- 0x65, 0x3d, 0x22, 0x20, 0x28, 0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b, 0x67, 0x72,
- 0x61, 0x64, 0x75, 0x61, 0x74, 0x65, 0x3c, 0x2f, 0x68, 0x65, 0x61, 0x64, 0x3e,
- 0x0a, 0x63, 0x6f, 0x6d, 0x6d, 0x65, 0x72, 0x63, 0x65, 0x6d, 0x61, 0x6c, 0x61,
- 0x79, 0x73, 0x69, 0x61, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x6d,
- 0x61, 0x69, 0x6e, 0x74, 0x61, 0x69, 0x6e, 0x3b, 0x68, 0x65, 0x69, 0x67, 0x68,
- 0x74, 0x3a, 0x73, 0x63, 0x68, 0x65, 0x64, 0x75, 0x6c, 0x65, 0x63, 0x68, 0x61,
- 0x6e, 0x67, 0x69, 0x6e, 0x67, 0x62, 0x61, 0x63, 0x6b, 0x20, 0x74, 0x6f, 0x20,
- 0x63, 0x61, 0x74, 0x68, 0x6f, 0x6c, 0x69, 0x63, 0x70, 0x61, 0x74, 0x74, 0x65,
- 0x72, 0x6e, 0x73, 0x63, 0x6f, 0x6c, 0x6f, 0x72, 0x3a, 0x20, 0x23, 0x67, 0x72,
- 0x65, 0x61, 0x74, 0x65, 0x73, 0x74, 0x73, 0x75, 0x70, 0x70, 0x6c, 0x69, 0x65,
- 0x73, 0x72, 0x65, 0x6c, 0x69, 0x61, 0x62, 0x6c, 0x65, 0x3c, 0x2f, 0x75, 0x6c,
- 0x3e, 0x0a, 0x09, 0x09, 0x3c, 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x20, 0x63,
- 0x69, 0x74, 0x69, 0x7a, 0x65, 0x6e, 0x73, 0x63, 0x6c, 0x6f, 0x74, 0x68, 0x69,
- 0x6e, 0x67, 0x77, 0x61, 0x74, 0x63, 0x68, 0x69, 0x6e, 0x67, 0x3c, 0x6c, 0x69,
- 0x20, 0x69, 0x64, 0x3d, 0x22, 0x73, 0x70, 0x65, 0x63, 0x69, 0x66, 0x69, 0x63,
- 0x63, 0x61, 0x72, 0x72, 0x79, 0x69, 0x6e, 0x67, 0x73, 0x65, 0x6e, 0x74, 0x65,
- 0x6e, 0x63, 0x65, 0x3c, 0x63, 0x65, 0x6e, 0x74, 0x65, 0x72, 0x3e, 0x63, 0x6f,
- 0x6e, 0x74, 0x72, 0x61, 0x73, 0x74, 0x74, 0x68, 0x69, 0x6e, 0x6b, 0x69, 0x6e,
- 0x67, 0x63, 0x61, 0x74, 0x63, 0x68, 0x28, 0x65, 0x29, 0x73, 0x6f, 0x75, 0x74,
- 0x68, 0x65, 0x72, 0x6e, 0x4d, 0x69, 0x63, 0x68, 0x61, 0x65, 0x6c, 0x20, 0x6d,
- 0x65, 0x72, 0x63, 0x68, 0x61, 0x6e, 0x74, 0x63, 0x61, 0x72, 0x6f, 0x75, 0x73,
- 0x65, 0x6c, 0x70, 0x61, 0x64, 0x64, 0x69, 0x6e, 0x67, 0x3a, 0x69, 0x6e, 0x74,
- 0x65, 0x72, 0x69, 0x6f, 0x72, 0x2e, 0x73, 0x70, 0x6c, 0x69, 0x74, 0x28, 0x22,
- 0x6c, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4f, 0x63, 0x74, 0x6f, 0x62,
- 0x65, 0x72, 0x20, 0x29, 0x7b, 0x72, 0x65, 0x74, 0x75, 0x72, 0x6e, 0x69, 0x6d,
- 0x70, 0x72, 0x6f, 0x76, 0x65, 0x64, 0x2d, 0x2d, 0x26, 0x67, 0x74, 0x3b, 0x0a,
- 0x0a, 0x63, 0x6f, 0x76, 0x65, 0x72, 0x61, 0x67, 0x65, 0x63, 0x68, 0x61, 0x69,
- 0x72, 0x6d, 0x61, 0x6e, 0x2e, 0x70, 0x6e, 0x67, 0x22, 0x20, 0x2f, 0x3e, 0x73,
- 0x75, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x52, 0x69, 0x63, 0x68, 0x61, 0x72,
- 0x64, 0x20, 0x77, 0x68, 0x61, 0x74, 0x65, 0x76, 0x65, 0x72, 0x70, 0x72, 0x6f,
- 0x62, 0x61, 0x62, 0x6c, 0x79, 0x72, 0x65, 0x63, 0x6f, 0x76, 0x65, 0x72, 0x79,
- 0x62, 0x61, 0x73, 0x65, 0x62, 0x61, 0x6c, 0x6c, 0x6a, 0x75, 0x64, 0x67, 0x6d,
- 0x65, 0x6e, 0x74, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x2e, 0x2e, 0x63,
- 0x73, 0x73, 0x22, 0x20, 0x2f, 0x3e, 0x20, 0x77, 0x65, 0x62, 0x73, 0x69, 0x74,
- 0x65, 0x72, 0x65, 0x70, 0x6f, 0x72, 0x74, 0x65, 0x64, 0x64, 0x65, 0x66, 0x61,
- 0x75, 0x6c, 0x74, 0x22, 0x2f, 0x3e, 0x3c, 0x2f, 0x61, 0x3e, 0x0d, 0x0a, 0x65,
- 0x6c, 0x65, 0x63, 0x74, 0x72, 0x69, 0x63, 0x73, 0x63, 0x6f, 0x74, 0x6c, 0x61,
- 0x6e, 0x64, 0x63, 0x72, 0x65, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x71, 0x75, 0x61,
- 0x6e, 0x74, 0x69, 0x74, 0x79, 0x2e, 0x20, 0x49, 0x53, 0x42, 0x4e, 0x20, 0x30,
- 0x64, 0x69, 0x64, 0x20, 0x6e, 0x6f, 0x74, 0x20, 0x69, 0x6e, 0x73, 0x74, 0x61,
- 0x6e, 0x63, 0x65, 0x2d, 0x73, 0x65, 0x61, 0x72, 0x63, 0x68, 0x2d, 0x22, 0x20,
- 0x6c, 0x61, 0x6e, 0x67, 0x3d, 0x22, 0x73, 0x70, 0x65, 0x61, 0x6b, 0x65, 0x72,
- 0x73, 0x43, 0x6f, 0x6d, 0x70, 0x75, 0x74, 0x65, 0x72, 0x63, 0x6f, 0x6e, 0x74,
- 0x61, 0x69, 0x6e, 0x73, 0x61, 0x72, 0x63, 0x68, 0x69, 0x76, 0x65, 0x73, 0x6d,
- 0x69, 0x6e, 0x69, 0x73, 0x74, 0x65, 0x72, 0x72, 0x65, 0x61, 0x63, 0x74, 0x69,
- 0x6f, 0x6e, 0x64, 0x69, 0x73, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x49, 0x74, 0x61,
- 0x6c, 0x69, 0x61, 0x6e, 0x6f, 0x63, 0x72, 0x69, 0x74, 0x65, 0x72, 0x69, 0x61,
- 0x73, 0x74, 0x72, 0x6f, 0x6e, 0x67, 0x6c, 0x79, 0x3a, 0x20, 0x27, 0x68, 0x74,
- 0x74, 0x70, 0x3a, 0x27, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x27, 0x63, 0x6f,
- 0x76, 0x65, 0x72, 0x69, 0x6e, 0x67, 0x6f, 0x66, 0x66, 0x65, 0x72, 0x69, 0x6e,
- 0x67, 0x61, 0x70, 0x70, 0x65, 0x61, 0x72, 0x65, 0x64, 0x42, 0x72, 0x69, 0x74,
- 0x69, 0x73, 0x68, 0x20, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x66, 0x79, 0x46,
- 0x61, 0x63, 0x65, 0x62, 0x6f, 0x6f, 0x6b, 0x6e, 0x75, 0x6d, 0x65, 0x72, 0x6f,
- 0x75, 0x73, 0x76, 0x65, 0x68, 0x69, 0x63, 0x6c, 0x65, 0x73, 0x63, 0x6f, 0x6e,
- 0x63, 0x65, 0x72, 0x6e, 0x73, 0x41, 0x6d, 0x65, 0x72, 0x69, 0x63, 0x61, 0x6e,
- 0x68, 0x61, 0x6e, 0x64, 0x6c, 0x69, 0x6e, 0x67, 0x64, 0x69, 0x76, 0x20, 0x69,
- 0x64, 0x3d, 0x22, 0x57, 0x69, 0x6c, 0x6c, 0x69, 0x61, 0x6d, 0x20, 0x70, 0x72,
- 0x6f, 0x76, 0x69, 0x64, 0x65, 0x72, 0x5f, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e,
- 0x74, 0x61, 0x63, 0x63, 0x75, 0x72, 0x61, 0x63, 0x79, 0x73, 0x65, 0x63, 0x74,
- 0x69, 0x6f, 0x6e, 0x20, 0x61, 0x6e, 0x64, 0x65, 0x72, 0x73, 0x6f, 0x6e, 0x66,
- 0x6c, 0x65, 0x78, 0x69, 0x62, 0x6c, 0x65, 0x43, 0x61, 0x74, 0x65, 0x67, 0x6f,
- 0x72, 0x79, 0x6c, 0x61, 0x77, 0x72, 0x65, 0x6e, 0x63, 0x65, 0x3c, 0x73, 0x63,
- 0x72, 0x69, 0x70, 0x74, 0x3e, 0x6c, 0x61, 0x79, 0x6f, 0x75, 0x74, 0x3d, 0x22,
- 0x61, 0x70, 0x70, 0x72, 0x6f, 0x76, 0x65, 0x64, 0x20, 0x6d, 0x61, 0x78, 0x69,
- 0x6d, 0x75, 0x6d, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x22, 0x3e, 0x3c, 0x2f,
- 0x74, 0x61, 0x62, 0x6c, 0x65, 0x3e, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65,
- 0x73, 0x68, 0x61, 0x6d, 0x69, 0x6c, 0x74, 0x6f, 0x6e, 0x63, 0x75, 0x72, 0x72,
- 0x65, 0x6e, 0x74, 0x20, 0x63, 0x61, 0x6e, 0x61, 0x64, 0x69, 0x61, 0x6e, 0x63,
- 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x2f, 0x74, 0x68, 0x65, 0x6d, 0x65,
- 0x73, 0x2f, 0x2f, 0x61, 0x72, 0x74, 0x69, 0x63, 0x6c, 0x65, 0x6f, 0x70, 0x74,
- 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x70, 0x6f, 0x72, 0x74, 0x75, 0x67, 0x61, 0x6c,
- 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3d, 0x22, 0x22, 0x69, 0x6e, 0x74, 0x65, 0x72,
- 0x76, 0x61, 0x6c, 0x77, 0x69, 0x72, 0x65, 0x6c, 0x65, 0x73, 0x73, 0x65, 0x6e,
- 0x74, 0x69, 0x74, 0x6c, 0x65, 0x64, 0x61, 0x67, 0x65, 0x6e, 0x63, 0x69, 0x65,
- 0x73, 0x53, 0x65, 0x61, 0x72, 0x63, 0x68, 0x22, 0x20, 0x6d, 0x65, 0x61, 0x73,
- 0x75, 0x72, 0x65, 0x64, 0x74, 0x68, 0x6f, 0x75, 0x73, 0x61, 0x6e, 0x64, 0x73,
- 0x70, 0x65, 0x6e, 0x64, 0x69, 0x6e, 0x67, 0x26, 0x68, 0x65, 0x6c, 0x6c, 0x69,
- 0x70, 0x3b, 0x6e, 0x65, 0x77, 0x20, 0x44, 0x61, 0x74, 0x65, 0x22, 0x20, 0x73,
- 0x69, 0x7a, 0x65, 0x3d, 0x22, 0x70, 0x61, 0x67, 0x65, 0x4e, 0x61, 0x6d, 0x65,
- 0x6d, 0x69, 0x64, 0x64, 0x6c, 0x65, 0x22, 0x20, 0x22, 0x20, 0x2f, 0x3e, 0x3c,
- 0x2f, 0x61, 0x3e, 0x68, 0x69, 0x64, 0x64, 0x65, 0x6e, 0x22, 0x3e, 0x73, 0x65,
- 0x71, 0x75, 0x65, 0x6e, 0x63, 0x65, 0x70, 0x65, 0x72, 0x73, 0x6f, 0x6e, 0x61,
- 0x6c, 0x6f, 0x76, 0x65, 0x72, 0x66, 0x6c, 0x6f, 0x77, 0x6f, 0x70, 0x69, 0x6e,
- 0x69, 0x6f, 0x6e, 0x73, 0x69, 0x6c, 0x6c, 0x69, 0x6e, 0x6f, 0x69, 0x73, 0x6c,
- 0x69, 0x6e, 0x6b, 0x73, 0x22, 0x3e, 0x0a, 0x09, 0x3c, 0x74, 0x69, 0x74, 0x6c,
- 0x65, 0x3e, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x73, 0x61, 0x74,
- 0x75, 0x72, 0x64, 0x61, 0x79, 0x74, 0x65, 0x72, 0x6d, 0x69, 0x6e, 0x61, 0x6c,
- 0x69, 0x74, 0x65, 0x6d, 0x70, 0x72, 0x6f, 0x70, 0x65, 0x6e, 0x67, 0x69, 0x6e,
- 0x65, 0x65, 0x72, 0x73, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x64, 0x65,
- 0x73, 0x69, 0x67, 0x6e, 0x65, 0x72, 0x70, 0x72, 0x6f, 0x70, 0x6f, 0x73, 0x61,
- 0x6c, 0x3d, 0x22, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x22, 0x45, 0x73, 0x70, 0x61,
- 0xc3, 0xb1, 0x6f, 0x6c, 0x72, 0x65, 0x6c, 0x65, 0x61, 0x73, 0x65, 0x73, 0x73,
- 0x75, 0x62, 0x6d, 0x69, 0x74, 0x22, 0x20, 0x65, 0x72, 0x26, 0x71, 0x75, 0x6f,
- 0x74, 0x3b, 0x61, 0x64, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x79, 0x6d,
- 0x70, 0x74, 0x6f, 0x6d, 0x73, 0x6f, 0x72, 0x69, 0x65, 0x6e, 0x74, 0x65, 0x64,
- 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x72, 0x69, 0x67, 0x68, 0x74,
- 0x22, 0x3e, 0x3c, 0x70, 0x6c, 0x65, 0x61, 0x73, 0x75, 0x72, 0x65, 0x73, 0x74,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x68, 0x69, 0x73, 0x74, 0x6f, 0x72, 0x79,
- 0x2e, 0x6c, 0x65, 0x61, 0x76, 0x69, 0x6e, 0x67, 0x20, 0x20, 0x62, 0x6f, 0x72,
- 0x64, 0x65, 0x72, 0x3d, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x73, 0x63,
- 0x65, 0x6e, 0x74, 0x65, 0x72, 0x22, 0x3e, 0x2e, 0x0a, 0x0a, 0x53, 0x6f, 0x6d,
- 0x65, 0x20, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x65, 0x64, 0x73, 0x75, 0x69,
- 0x74, 0x61, 0x62, 0x6c, 0x65, 0x62, 0x75, 0x6c, 0x67, 0x61, 0x72, 0x69, 0x61,
- 0x2e, 0x73, 0x68, 0x6f, 0x77, 0x28, 0x29, 0x3b, 0x64, 0x65, 0x73, 0x69, 0x67,
- 0x6e, 0x65, 0x64, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x6c, 0x20, 0x63, 0x6f,
- 0x6e, 0x63, 0x65, 0x70, 0x74, 0x73, 0x45, 0x78, 0x61, 0x6d, 0x70, 0x6c, 0x65,
- 0x73, 0x77, 0x69, 0x6c, 0x6c, 0x69, 0x61, 0x6d, 0x73, 0x4f, 0x72, 0x69, 0x67,
- 0x69, 0x6e, 0x61, 0x6c, 0x22, 0x3e, 0x3c, 0x73, 0x70, 0x61, 0x6e, 0x3e, 0x73,
- 0x65, 0x61, 0x72, 0x63, 0x68, 0x22, 0x3e, 0x6f, 0x70, 0x65, 0x72, 0x61, 0x74,
- 0x6f, 0x72, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x73, 0x61, 0x20, 0x26,
- 0x71, 0x75, 0x6f, 0x74, 0x3b, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x69, 0x6e, 0x67,
- 0x44, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x72, 0x65, 0x76, 0x69, 0x73,
- 0x69, 0x6f, 0x6e, 0x2e, 0x20, 0x0a, 0x0a, 0x54, 0x68, 0x65, 0x20, 0x79, 0x6f,
- 0x75, 0x72, 0x73, 0x65, 0x6c, 0x66, 0x43, 0x6f, 0x6e, 0x74, 0x61, 0x63, 0x74,
- 0x20, 0x6d, 0x69, 0x63, 0x68, 0x69, 0x67, 0x61, 0x6e, 0x45, 0x6e, 0x67, 0x6c,
- 0x69, 0x73, 0x68, 0x20, 0x63, 0x6f, 0x6c, 0x75, 0x6d, 0x62, 0x69, 0x61, 0x70,
- 0x72, 0x69, 0x6f, 0x72, 0x69, 0x74, 0x79, 0x70, 0x72, 0x69, 0x6e, 0x74, 0x69,
- 0x6e, 0x67, 0x64, 0x72, 0x69, 0x6e, 0x6b, 0x69, 0x6e, 0x67, 0x66, 0x61, 0x63,
- 0x69, 0x6c, 0x69, 0x74, 0x79, 0x72, 0x65, 0x74, 0x75, 0x72, 0x6e, 0x65, 0x64,
- 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x20, 0x6f, 0x66, 0x66, 0x69, 0x63,
- 0x65, 0x72, 0x73, 0x52, 0x75, 0x73, 0x73, 0x69, 0x61, 0x6e, 0x20, 0x67, 0x65,
- 0x6e, 0x65, 0x72, 0x61, 0x74, 0x65, 0x2d, 0x38, 0x38, 0x35, 0x39, 0x2d, 0x31,
- 0x22, 0x69, 0x6e, 0x64, 0x69, 0x63, 0x61, 0x74, 0x65, 0x66, 0x61, 0x6d, 0x69,
- 0x6c, 0x69, 0x61, 0x72, 0x20, 0x71, 0x75, 0x61, 0x6c, 0x69, 0x74, 0x79, 0x6d,
- 0x61, 0x72, 0x67, 0x69, 0x6e, 0x3a, 0x30, 0x20, 0x63, 0x6f, 0x6e, 0x74, 0x65,
- 0x6e, 0x74, 0x76, 0x69, 0x65, 0x77, 0x70, 0x6f, 0x72, 0x74, 0x63, 0x6f, 0x6e,
- 0x74, 0x61, 0x63, 0x74, 0x73, 0x2d, 0x74, 0x69, 0x74, 0x6c, 0x65, 0x22, 0x3e,
- 0x70, 0x6f, 0x72, 0x74, 0x61, 0x62, 0x6c, 0x65, 0x2e, 0x6c, 0x65, 0x6e, 0x67,
- 0x74, 0x68, 0x20, 0x65, 0x6c, 0x69, 0x67, 0x69, 0x62, 0x6c, 0x65, 0x69, 0x6e,
- 0x76, 0x6f, 0x6c, 0x76, 0x65, 0x73, 0x61, 0x74, 0x6c, 0x61, 0x6e, 0x74, 0x69,
- 0x63, 0x6f, 0x6e, 0x6c, 0x6f, 0x61, 0x64, 0x3d, 0x22, 0x64, 0x65, 0x66, 0x61,
- 0x75, 0x6c, 0x74, 0x2e, 0x73, 0x75, 0x70, 0x70, 0x6c, 0x69, 0x65, 0x64, 0x70,
- 0x61, 0x79, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x67, 0x6c, 0x6f, 0x73, 0x73, 0x61,
- 0x72, 0x79, 0x0a, 0x0a, 0x41, 0x66, 0x74, 0x65, 0x72, 0x20, 0x67, 0x75, 0x69,
- 0x64, 0x61, 0x6e, 0x63, 0x65, 0x3c, 0x2f, 0x74, 0x64, 0x3e, 0x3c, 0x74, 0x64,
- 0x65, 0x6e, 0x63, 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x6d, 0x69, 0x64, 0x64, 0x6c,
- 0x65, 0x22, 0x3e, 0x63, 0x61, 0x6d, 0x65, 0x20, 0x74, 0x6f, 0x20, 0x64, 0x69,
- 0x73, 0x70, 0x6c, 0x61, 0x79, 0x73, 0x73, 0x63, 0x6f, 0x74, 0x74, 0x69, 0x73,
- 0x68, 0x6a, 0x6f, 0x6e, 0x61, 0x74, 0x68, 0x61, 0x6e, 0x6d, 0x61, 0x6a, 0x6f,
- 0x72, 0x69, 0x74, 0x79, 0x77, 0x69, 0x64, 0x67, 0x65, 0x74, 0x73, 0x2e, 0x63,
- 0x6c, 0x69, 0x6e, 0x69, 0x63, 0x61, 0x6c, 0x74, 0x68, 0x61, 0x69, 0x6c, 0x61,
- 0x6e, 0x64, 0x74, 0x65, 0x61, 0x63, 0x68, 0x65, 0x72, 0x73, 0x3c, 0x68, 0x65,
- 0x61, 0x64, 0x3e, 0x0a, 0x09, 0x61, 0x66, 0x66, 0x65, 0x63, 0x74, 0x65, 0x64,
- 0x73, 0x75, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x73, 0x70, 0x6f, 0x69, 0x6e, 0x74,
- 0x65, 0x72, 0x3b, 0x74, 0x6f, 0x53, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x3c, 0x2f,
- 0x73, 0x6d, 0x61, 0x6c, 0x6c, 0x3e, 0x6f, 0x6b, 0x6c, 0x61, 0x68, 0x6f, 0x6d,
- 0x61, 0x77, 0x69, 0x6c, 0x6c, 0x20, 0x62, 0x65, 0x20, 0x69, 0x6e, 0x76, 0x65,
- 0x73, 0x74, 0x6f, 0x72, 0x30, 0x22, 0x20, 0x61, 0x6c, 0x74, 0x3d, 0x22, 0x68,
- 0x6f, 0x6c, 0x69, 0x64, 0x61, 0x79, 0x73, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72,
- 0x63, 0x65, 0x6c, 0x69, 0x63, 0x65, 0x6e, 0x73, 0x65, 0x64, 0x20, 0x28, 0x77,
- 0x68, 0x69, 0x63, 0x68, 0x20, 0x2e, 0x20, 0x41, 0x66, 0x74, 0x65, 0x72, 0x20,
- 0x63, 0x6f, 0x6e, 0x73, 0x69, 0x64, 0x65, 0x72, 0x76, 0x69, 0x73, 0x69, 0x74,
- 0x69, 0x6e, 0x67, 0x65, 0x78, 0x70, 0x6c, 0x6f, 0x72, 0x65, 0x72, 0x70, 0x72,
- 0x69, 0x6d, 0x61, 0x72, 0x79, 0x20, 0x73, 0x65, 0x61, 0x72, 0x63, 0x68, 0x22,
- 0x20, 0x61, 0x6e, 0x64, 0x72, 0x6f, 0x69, 0x64, 0x22, 0x71, 0x75, 0x69, 0x63,
- 0x6b, 0x6c, 0x79, 0x20, 0x6d, 0x65, 0x65, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x65,
- 0x73, 0x74, 0x69, 0x6d, 0x61, 0x74, 0x65, 0x3b, 0x72, 0x65, 0x74, 0x75, 0x72,
- 0x6e, 0x20, 0x3b, 0x63, 0x6f, 0x6c, 0x6f, 0x72, 0x3a, 0x23, 0x20, 0x68, 0x65,
- 0x69, 0x67, 0x68, 0x74, 0x3d, 0x61, 0x70, 0x70, 0x72, 0x6f, 0x76, 0x61, 0x6c,
- 0x2c, 0x20, 0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b, 0x20, 0x63, 0x68, 0x65, 0x63,
- 0x6b, 0x65, 0x64, 0x2e, 0x6d, 0x69, 0x6e, 0x2e, 0x6a, 0x73, 0x22, 0x6d, 0x61,
- 0x67, 0x6e, 0x65, 0x74, 0x69, 0x63, 0x3e, 0x3c, 0x2f, 0x61, 0x3e, 0x3c, 0x2f,
- 0x68, 0x66, 0x6f, 0x72, 0x65, 0x63, 0x61, 0x73, 0x74, 0x2e, 0x20, 0x57, 0x68,
- 0x69, 0x6c, 0x65, 0x20, 0x74, 0x68, 0x75, 0x72, 0x73, 0x64, 0x61, 0x79, 0x64,
- 0x76, 0x65, 0x72, 0x74, 0x69, 0x73, 0x65, 0x26, 0x65, 0x61, 0x63, 0x75, 0x74,
- 0x65, 0x3b, 0x68, 0x61, 0x73, 0x43, 0x6c, 0x61, 0x73, 0x73, 0x65, 0x76, 0x61,
- 0x6c, 0x75, 0x61, 0x74, 0x65, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x69, 0x6e, 0x67,
- 0x65, 0x78, 0x69, 0x73, 0x74, 0x69, 0x6e, 0x67, 0x70, 0x61, 0x74, 0x69, 0x65,
- 0x6e, 0x74, 0x73, 0x20, 0x4f, 0x6e, 0x6c, 0x69, 0x6e, 0x65, 0x20, 0x63, 0x6f,
- 0x6c, 0x6f, 0x72, 0x61, 0x64, 0x6f, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73,
- 0x22, 0x63, 0x61, 0x6d, 0x70, 0x62, 0x65, 0x6c, 0x6c, 0x3c, 0x21, 0x2d, 0x2d,
- 0x20, 0x65, 0x6e, 0x64, 0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e, 0x3e, 0x3c, 0x3c,
- 0x62, 0x72, 0x20, 0x2f, 0x3e, 0x0d, 0x0a, 0x5f, 0x70, 0x6f, 0x70, 0x75, 0x70,
- 0x73, 0x7c, 0x73, 0x63, 0x69, 0x65, 0x6e, 0x63, 0x65, 0x73, 0x2c, 0x26, 0x71,
- 0x75, 0x6f, 0x74, 0x3b, 0x20, 0x71, 0x75, 0x61, 0x6c, 0x69, 0x74, 0x79, 0x20,
- 0x57, 0x69, 0x6e, 0x64, 0x6f, 0x77, 0x73, 0x20, 0x61, 0x73, 0x73, 0x69, 0x67,
- 0x6e, 0x65, 0x64, 0x68, 0x65, 0x69, 0x67, 0x68, 0x74, 0x3a, 0x20, 0x3c, 0x62,
- 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x6c, 0x65, 0x26, 0x71, 0x75, 0x6f, 0x74,
- 0x3b, 0x20, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3d, 0x22, 0x20, 0x43, 0x6f, 0x6d,
- 0x70, 0x61, 0x6e, 0x79, 0x65, 0x78, 0x61, 0x6d, 0x70, 0x6c, 0x65, 0x73, 0x3c,
- 0x69, 0x66, 0x72, 0x61, 0x6d, 0x65, 0x20, 0x62, 0x65, 0x6c, 0x69, 0x65, 0x76,
- 0x65, 0x73, 0x70, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x74, 0x73, 0x6d, 0x61, 0x72,
- 0x73, 0x68, 0x61, 0x6c, 0x6c, 0x70, 0x61, 0x72, 0x74, 0x20, 0x6f, 0x66, 0x20,
- 0x70, 0x72, 0x6f, 0x70, 0x65, 0x72, 0x6c, 0x79, 0x29, 0x2e, 0x0a, 0x0a, 0x54,
- 0x68, 0x65, 0x20, 0x74, 0x61, 0x78, 0x6f, 0x6e, 0x6f, 0x6d, 0x79, 0x6d, 0x75,
- 0x63, 0x68, 0x20, 0x6f, 0x66, 0x20, 0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e, 0x3e,
- 0x0a, 0x22, 0x20, 0x64, 0x61, 0x74, 0x61, 0x2d, 0x73, 0x72, 0x74, 0x75, 0x67,
- 0x75, 0xc3, 0xaa, 0x73, 0x73, 0x63, 0x72, 0x6f, 0x6c, 0x6c, 0x54, 0x6f, 0x20,
- 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x3c, 0x68, 0x65, 0x61, 0x64, 0x3e,
- 0x0d, 0x0a, 0x61, 0x74, 0x74, 0x6f, 0x72, 0x6e, 0x65, 0x79, 0x65, 0x6d, 0x70,
- 0x68, 0x61, 0x73, 0x69, 0x73, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x6f, 0x72, 0x73,
- 0x66, 0x61, 0x6e, 0x63, 0x79, 0x62, 0x6f, 0x78, 0x77, 0x6f, 0x72, 0x6c, 0x64,
- 0x27, 0x73, 0x20, 0x77, 0x69, 0x6c, 0x64, 0x6c, 0x69, 0x66, 0x65, 0x63, 0x68,
- 0x65, 0x63, 0x6b, 0x65, 0x64, 0x3d, 0x73, 0x65, 0x73, 0x73, 0x69, 0x6f, 0x6e,
- 0x73, 0x70, 0x72, 0x6f, 0x67, 0x72, 0x61, 0x6d, 0x6d, 0x70, 0x78, 0x3b, 0x66,
- 0x6f, 0x6e, 0x74, 0x2d, 0x20, 0x50, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x6a,
- 0x6f, 0x75, 0x72, 0x6e, 0x61, 0x6c, 0x73, 0x62, 0x65, 0x6c, 0x69, 0x65, 0x76,
- 0x65, 0x64, 0x76, 0x61, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x74, 0x68, 0x6f,
- 0x6d, 0x70, 0x73, 0x6f, 0x6e, 0x6c, 0x69, 0x67, 0x68, 0x74, 0x69, 0x6e, 0x67,
- 0x61, 0x6e, 0x64, 0x20, 0x74, 0x68, 0x65, 0x20, 0x73, 0x70, 0x65, 0x63, 0x69,
- 0x61, 0x6c, 0x20, 0x62, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x3d, 0x30, 0x63, 0x68,
- 0x65, 0x63, 0x6b, 0x69, 0x6e, 0x67, 0x3c, 0x2f, 0x74, 0x62, 0x6f, 0x64, 0x79,
- 0x3e, 0x3c, 0x62, 0x75, 0x74, 0x74, 0x6f, 0x6e, 0x20, 0x43, 0x6f, 0x6d, 0x70,
- 0x6c, 0x65, 0x74, 0x65, 0x63, 0x6c, 0x65, 0x61, 0x72, 0x66, 0x69, 0x78, 0x0a,
- 0x3c, 0x68, 0x65, 0x61, 0x64, 0x3e, 0x0a, 0x61, 0x72, 0x74, 0x69, 0x63, 0x6c,
- 0x65, 0x20, 0x3c, 0x73, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x66, 0x69, 0x6e,
- 0x64, 0x69, 0x6e, 0x67, 0x73, 0x72, 0x6f, 0x6c, 0x65, 0x20, 0x69, 0x6e, 0x20,
- 0x70, 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x72, 0x20, 0x20, 0x4f, 0x63, 0x74, 0x6f,
- 0x62, 0x65, 0x72, 0x77, 0x65, 0x62, 0x73, 0x69, 0x74, 0x65, 0x20, 0x65, 0x78,
- 0x70, 0x6f, 0x73, 0x75, 0x72, 0x65, 0x75, 0x73, 0x65, 0x64, 0x20, 0x74, 0x6f,
- 0x20, 0x20, 0x63, 0x68, 0x61, 0x6e, 0x67, 0x65, 0x73, 0x6f, 0x70, 0x65, 0x72,
- 0x61, 0x74, 0x65, 0x64, 0x63, 0x6c, 0x69, 0x63, 0x6b, 0x69, 0x6e, 0x67, 0x65,
- 0x6e, 0x74, 0x65, 0x72, 0x69, 0x6e, 0x67, 0x63, 0x6f, 0x6d, 0x6d, 0x61, 0x6e,
- 0x64, 0x73, 0x69, 0x6e, 0x66, 0x6f, 0x72, 0x6d, 0x65, 0x64, 0x20, 0x6e, 0x75,
- 0x6d, 0x62, 0x65, 0x72, 0x73, 0x20, 0x20, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e,
- 0x63, 0x72, 0x65, 0x61, 0x74, 0x69, 0x6e, 0x67, 0x6f, 0x6e, 0x53, 0x75, 0x62,
- 0x6d, 0x69, 0x74, 0x6d, 0x61, 0x72, 0x79, 0x6c, 0x61, 0x6e, 0x64, 0x63, 0x6f,
- 0x6c, 0x6c, 0x65, 0x67, 0x65, 0x73, 0x61, 0x6e, 0x61, 0x6c, 0x79, 0x74, 0x69,
- 0x63, 0x6c, 0x69, 0x73, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x63, 0x6f, 0x6e, 0x74,
- 0x61, 0x63, 0x74, 0x2e, 0x6c, 0x6f, 0x67, 0x67, 0x65, 0x64, 0x49, 0x6e, 0x61,
- 0x64, 0x76, 0x69, 0x73, 0x6f, 0x72, 0x79, 0x73, 0x69, 0x62, 0x6c, 0x69, 0x6e,
- 0x67, 0x73, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x22, 0x73, 0x26, 0x71,
- 0x75, 0x6f, 0x74, 0x3b, 0x29, 0x73, 0x2e, 0x20, 0x54, 0x68, 0x69, 0x73, 0x20,
- 0x70, 0x61, 0x63, 0x6b, 0x61, 0x67, 0x65, 0x73, 0x63, 0x68, 0x65, 0x63, 0x6b,
- 0x62, 0x6f, 0x78, 0x73, 0x75, 0x67, 0x67, 0x65, 0x73, 0x74, 0x73, 0x70, 0x72,
- 0x65, 0x67, 0x6e, 0x61, 0x6e, 0x74, 0x74, 0x6f, 0x6d, 0x6f, 0x72, 0x72, 0x6f,
- 0x77, 0x73, 0x70, 0x61, 0x63, 0x69, 0x6e, 0x67, 0x3d, 0x69, 0x63, 0x6f, 0x6e,
- 0x2e, 0x70, 0x6e, 0x67, 0x6a, 0x61, 0x70, 0x61, 0x6e, 0x65, 0x73, 0x65, 0x63,
- 0x6f, 0x64, 0x65, 0x62, 0x61, 0x73, 0x65, 0x62, 0x75, 0x74, 0x74, 0x6f, 0x6e,
- 0x22, 0x3e, 0x67, 0x61, 0x6d, 0x62, 0x6c, 0x69, 0x6e, 0x67, 0x73, 0x75, 0x63,
- 0x68, 0x20, 0x61, 0x73, 0x20, 0x2c, 0x20, 0x77, 0x68, 0x69, 0x6c, 0x65, 0x20,
- 0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e, 0x3e, 0x20, 0x6d, 0x69, 0x73, 0x73, 0x6f,
- 0x75, 0x72, 0x69, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x69, 0x6e, 0x67, 0x74, 0x6f,
- 0x70, 0x3a, 0x31, 0x70, 0x78, 0x20, 0x2e, 0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e,
- 0x3e, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x77, 0x69, 0x64, 0x74,
- 0x68, 0x3d, 0x22, 0x32, 0x6c, 0x61, 0x7a, 0x79, 0x6c, 0x6f, 0x61, 0x64, 0x6e,
- 0x6f, 0x76, 0x65, 0x6d, 0x62, 0x65, 0x72, 0x75, 0x73, 0x65, 0x64, 0x20, 0x69,
- 0x6e, 0x20, 0x68, 0x65, 0x69, 0x67, 0x68, 0x74, 0x3d, 0x22, 0x63, 0x72, 0x69,
- 0x70, 0x74, 0x22, 0x3e, 0x0a, 0x26, 0x6e, 0x62, 0x73, 0x70, 0x3b, 0x3c, 0x2f,
- 0x3c, 0x74, 0x72, 0x3e, 0x3c, 0x74, 0x64, 0x20, 0x68, 0x65, 0x69, 0x67, 0x68,
- 0x74, 0x3a, 0x32, 0x2f, 0x70, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x74, 0x63, 0x6f,
- 0x75, 0x6e, 0x74, 0x72, 0x79, 0x20, 0x69, 0x6e, 0x63, 0x6c, 0x75, 0x64, 0x65,
- 0x20, 0x66, 0x6f, 0x6f, 0x74, 0x65, 0x72, 0x22, 0x20, 0x26, 0x6c, 0x74, 0x3b,
- 0x21, 0x2d, 0x2d, 0x20, 0x74, 0x69, 0x74, 0x6c, 0x65, 0x22, 0x3e, 0x3c, 0x2f,
- 0x6a, 0x71, 0x75, 0x65, 0x72, 0x79, 0x2e, 0x3c, 0x2f, 0x66, 0x6f, 0x72, 0x6d,
- 0x3e, 0x0a, 0x28, 0xe7, 0xae, 0x80, 0xe4, 0xbd, 0x93, 0x29, 0x28, 0xe7, 0xb9,
- 0x81, 0xe9, 0xab, 0x94, 0x29, 0x68, 0x72, 0x76, 0x61, 0x74, 0x73, 0x6b, 0x69,
- 0x69, 0x74, 0x61, 0x6c, 0x69, 0x61, 0x6e, 0x6f, 0x72, 0x6f, 0x6d, 0xc3, 0xa2,
- 0x6e, 0xc4, 0x83, 0x74, 0xc3, 0xbc, 0x72, 0x6b, 0xc3, 0xa7, 0x65, 0xd8, 0xa7,
- 0xd8, 0xb1, 0xd8, 0xaf, 0xd9, 0x88, 0x74, 0x61, 0x6d, 0x62, 0x69, 0xc3, 0xa9,
- 0x6e, 0x6e, 0x6f, 0x74, 0x69, 0x63, 0x69, 0x61, 0x73, 0x6d, 0x65, 0x6e, 0x73,
- 0x61, 0x6a, 0x65, 0x73, 0x70, 0x65, 0x72, 0x73, 0x6f, 0x6e, 0x61, 0x73, 0x64,
- 0x65, 0x72, 0x65, 0x63, 0x68, 0x6f, 0x73, 0x6e, 0x61, 0x63, 0x69, 0x6f, 0x6e,
- 0x61, 0x6c, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x69, 0x6f, 0x63, 0x6f, 0x6e,
- 0x74, 0x61, 0x63, 0x74, 0x6f, 0x75, 0x73, 0x75, 0x61, 0x72, 0x69, 0x6f, 0x73,
- 0x70, 0x72, 0x6f, 0x67, 0x72, 0x61, 0x6d, 0x61, 0x67, 0x6f, 0x62, 0x69, 0x65,
- 0x72, 0x6e, 0x6f, 0x65, 0x6d, 0x70, 0x72, 0x65, 0x73, 0x61, 0x73, 0x61, 0x6e,
- 0x75, 0x6e, 0x63, 0x69, 0x6f, 0x73, 0x76, 0x61, 0x6c, 0x65, 0x6e, 0x63, 0x69,
- 0x61, 0x63, 0x6f, 0x6c, 0x6f, 0x6d, 0x62, 0x69, 0x61, 0x64, 0x65, 0x73, 0x70,
- 0x75, 0xc3, 0xa9, 0x73, 0x64, 0x65, 0x70, 0x6f, 0x72, 0x74, 0x65, 0x73, 0x70,
- 0x72, 0x6f, 0x79, 0x65, 0x63, 0x74, 0x6f, 0x70, 0x72, 0x6f, 0x64, 0x75, 0x63,
- 0x74, 0x6f, 0x70, 0xc3, 0xba, 0x62, 0x6c, 0x69, 0x63, 0x6f, 0x6e, 0x6f, 0x73,
- 0x6f, 0x74, 0x72, 0x6f, 0x73, 0x68, 0x69, 0x73, 0x74, 0x6f, 0x72, 0x69, 0x61,
- 0x70, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x74, 0x65, 0x6d, 0x69, 0x6c, 0x6c, 0x6f,
- 0x6e, 0x65, 0x73, 0x6d, 0x65, 0x64, 0x69, 0x61, 0x6e, 0x74, 0x65, 0x70, 0x72,
- 0x65, 0x67, 0x75, 0x6e, 0x74, 0x61, 0x61, 0x6e, 0x74, 0x65, 0x72, 0x69, 0x6f,
- 0x72, 0x72, 0x65, 0x63, 0x75, 0x72, 0x73, 0x6f, 0x73, 0x70, 0x72, 0x6f, 0x62,
- 0x6c, 0x65, 0x6d, 0x61, 0x73, 0x61, 0x6e, 0x74, 0x69, 0x61, 0x67, 0x6f, 0x6e,
- 0x75, 0x65, 0x73, 0x74, 0x72, 0x6f, 0x73, 0x6f, 0x70, 0x69, 0x6e, 0x69, 0xc3,
- 0xb3, 0x6e, 0x69, 0x6d, 0x70, 0x72, 0x69, 0x6d, 0x69, 0x72, 0x6d, 0x69, 0x65,
- 0x6e, 0x74, 0x72, 0x61, 0x73, 0x61, 0x6d, 0xc3, 0xa9, 0x72, 0x69, 0x63, 0x61,
- 0x76, 0x65, 0x6e, 0x64, 0x65, 0x64, 0x6f, 0x72, 0x73, 0x6f, 0x63, 0x69, 0x65,
- 0x64, 0x61, 0x64, 0x72, 0x65, 0x73, 0x70, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x65,
- 0x61, 0x6c, 0x69, 0x7a, 0x61, 0x72, 0x72, 0x65, 0x67, 0x69, 0x73, 0x74, 0x72,
- 0x6f, 0x70, 0x61, 0x6c, 0x61, 0x62, 0x72, 0x61, 0x73, 0x69, 0x6e, 0x74, 0x65,
- 0x72, 0xc3, 0xa9, 0x73, 0x65, 0x6e, 0x74, 0x6f, 0x6e, 0x63, 0x65, 0x73, 0x65,
- 0x73, 0x70, 0x65, 0x63, 0x69, 0x61, 0x6c, 0x6d, 0x69, 0x65, 0x6d, 0x62, 0x72,
- 0x6f, 0x73, 0x72, 0x65, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x64, 0x63, 0xc3, 0xb3,
- 0x72, 0x64, 0x6f, 0x62, 0x61, 0x7a, 0x61, 0x72, 0x61, 0x67, 0x6f, 0x7a, 0x61,
- 0x70, 0xc3, 0xa1, 0x67, 0x69, 0x6e, 0x61, 0x73, 0x73, 0x6f, 0x63, 0x69, 0x61,
- 0x6c, 0x65, 0x73, 0x62, 0x6c, 0x6f, 0x71, 0x75, 0x65, 0x61, 0x72, 0x67, 0x65,
- 0x73, 0x74, 0x69, 0xc3, 0xb3, 0x6e, 0x61, 0x6c, 0x71, 0x75, 0x69, 0x6c, 0x65,
- 0x72, 0x73, 0x69, 0x73, 0x74, 0x65, 0x6d, 0x61, 0x73, 0x63, 0x69, 0x65, 0x6e,
- 0x63, 0x69, 0x61, 0x73, 0x63, 0x6f, 0x6d, 0x70, 0x6c, 0x65, 0x74, 0x6f, 0x76,
- 0x65, 0x72, 0x73, 0x69, 0xc3, 0xb3, 0x6e, 0x63, 0x6f, 0x6d, 0x70, 0x6c, 0x65,
- 0x74, 0x61, 0x65, 0x73, 0x74, 0x75, 0x64, 0x69, 0x6f, 0x73, 0x70, 0xc3, 0xba,
- 0x62, 0x6c, 0x69, 0x63, 0x61, 0x6f, 0x62, 0x6a, 0x65, 0x74, 0x69, 0x76, 0x6f,
- 0x61, 0x6c, 0x69, 0x63, 0x61, 0x6e, 0x74, 0x65, 0x62, 0x75, 0x73, 0x63, 0x61,
- 0x64, 0x6f, 0x72, 0x63, 0x61, 0x6e, 0x74, 0x69, 0x64, 0x61, 0x64, 0x65, 0x6e,
- 0x74, 0x72, 0x61, 0x64, 0x61, 0x73, 0x61, 0x63, 0x63, 0x69, 0x6f, 0x6e, 0x65,
- 0x73, 0x61, 0x72, 0x63, 0x68, 0x69, 0x76, 0x6f, 0x73, 0x73, 0x75, 0x70, 0x65,
- 0x72, 0x69, 0x6f, 0x72, 0x6d, 0x61, 0x79, 0x6f, 0x72, 0xc3, 0xad, 0x61, 0x61,
- 0x6c, 0x65, 0x6d, 0x61, 0x6e, 0x69, 0x61, 0x66, 0x75, 0x6e, 0x63, 0x69, 0xc3,
- 0xb3, 0x6e, 0xc3, 0xba, 0x6c, 0x74, 0x69, 0x6d, 0x6f, 0x73, 0x68, 0x61, 0x63,
- 0x69, 0x65, 0x6e, 0x64, 0x6f, 0x61, 0x71, 0x75, 0x65, 0x6c, 0x6c, 0x6f, 0x73,
- 0x65, 0x64, 0x69, 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x66, 0x65, 0x72, 0x6e, 0x61,
- 0x6e, 0x64, 0x6f, 0x61, 0x6d, 0x62, 0x69, 0x65, 0x6e, 0x74, 0x65, 0x66, 0x61,
- 0x63, 0x65, 0x62, 0x6f, 0x6f, 0x6b, 0x6e, 0x75, 0x65, 0x73, 0x74, 0x72, 0x61,
- 0x73, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x65, 0x73, 0x70, 0x72, 0x6f, 0x63,
- 0x65, 0x73, 0x6f, 0x73, 0x62, 0x61, 0x73, 0x74, 0x61, 0x6e, 0x74, 0x65, 0x70,
- 0x72, 0x65, 0x73, 0x65, 0x6e, 0x74, 0x61, 0x72, 0x65, 0x70, 0x6f, 0x72, 0x74,
- 0x61, 0x72, 0x63, 0x6f, 0x6e, 0x67, 0x72, 0x65, 0x73, 0x6f, 0x70, 0x75, 0x62,
- 0x6c, 0x69, 0x63, 0x61, 0x72, 0x63, 0x6f, 0x6d, 0x65, 0x72, 0x63, 0x69, 0x6f,
- 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x61, 0x74, 0x6f, 0x6a, 0xc3, 0xb3, 0x76, 0x65,
- 0x6e, 0x65, 0x73, 0x64, 0x69, 0x73, 0x74, 0x72, 0x69, 0x74, 0x6f, 0x74, 0xc3,
- 0xa9, 0x63, 0x6e, 0x69, 0x63, 0x61, 0x63, 0x6f, 0x6e, 0x6a, 0x75, 0x6e, 0x74,
- 0x6f, 0x65, 0x6e, 0x65, 0x72, 0x67, 0xc3, 0xad, 0x61, 0x74, 0x72, 0x61, 0x62,
- 0x61, 0x6a, 0x61, 0x72, 0x61, 0x73, 0x74, 0x75, 0x72, 0x69, 0x61, 0x73, 0x72,
- 0x65, 0x63, 0x69, 0x65, 0x6e, 0x74, 0x65, 0x75, 0x74, 0x69, 0x6c, 0x69, 0x7a,
- 0x61, 0x72, 0x62, 0x6f, 0x6c, 0x65, 0x74, 0xc3, 0xad, 0x6e, 0x73, 0x61, 0x6c,
- 0x76, 0x61, 0x64, 0x6f, 0x72, 0x63, 0x6f, 0x72, 0x72, 0x65, 0x63, 0x74, 0x61,
- 0x74, 0x72, 0x61, 0x62, 0x61, 0x6a, 0x6f, 0x73, 0x70, 0x72, 0x69, 0x6d, 0x65,
- 0x72, 0x6f, 0x73, 0x6e, 0x65, 0x67, 0x6f, 0x63, 0x69, 0x6f, 0x73, 0x6c, 0x69,
- 0x62, 0x65, 0x72, 0x74, 0x61, 0x64, 0x64, 0x65, 0x74, 0x61, 0x6c, 0x6c, 0x65,
- 0x73, 0x70, 0x61, 0x6e, 0x74, 0x61, 0x6c, 0x6c, 0x61, 0x70, 0x72, 0xc3, 0xb3,
- 0x78, 0x69, 0x6d, 0x6f, 0x61, 0x6c, 0x6d, 0x65, 0x72, 0xc3, 0xad, 0x61, 0x61,
- 0x6e, 0x69, 0x6d, 0x61, 0x6c, 0x65, 0x73, 0x71, 0x75, 0x69, 0xc3, 0xa9, 0x6e,
- 0x65, 0x73, 0x63, 0x6f, 0x72, 0x61, 0x7a, 0xc3, 0xb3, 0x6e, 0x73, 0x65, 0x63,
- 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x62, 0x75, 0x73, 0x63, 0x61, 0x6e, 0x64, 0x6f,
- 0x6f, 0x70, 0x63, 0x69, 0x6f, 0x6e, 0x65, 0x73, 0x65, 0x78, 0x74, 0x65, 0x72,
- 0x69, 0x6f, 0x72, 0x63, 0x6f, 0x6e, 0x63, 0x65, 0x70, 0x74, 0x6f, 0x74, 0x6f,
- 0x64, 0x61, 0x76, 0xc3, 0xad, 0x61, 0x67, 0x61, 0x6c, 0x65, 0x72, 0xc3, 0xad,
- 0x61, 0x65, 0x73, 0x63, 0x72, 0x69, 0x62, 0x69, 0x72, 0x6d, 0x65, 0x64, 0x69,
- 0x63, 0x69, 0x6e, 0x61, 0x6c, 0x69, 0x63, 0x65, 0x6e, 0x63, 0x69, 0x61, 0x63,
- 0x6f, 0x6e, 0x73, 0x75, 0x6c, 0x74, 0x61, 0x61, 0x73, 0x70, 0x65, 0x63, 0x74,
- 0x6f, 0x73, 0x63, 0x72, 0xc3, 0xad, 0x74, 0x69, 0x63, 0x61, 0x64, 0xc3, 0xb3,
- 0x6c, 0x61, 0x72, 0x65, 0x73, 0x6a, 0x75, 0x73, 0x74, 0x69, 0x63, 0x69, 0x61,
- 0x64, 0x65, 0x62, 0x65, 0x72, 0xc3, 0xa1, 0x6e, 0x70, 0x65, 0x72, 0xc3, 0xad,
- 0x6f, 0x64, 0x6f, 0x6e, 0x65, 0x63, 0x65, 0x73, 0x69, 0x74, 0x61, 0x6d, 0x61,
- 0x6e, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x70, 0x65, 0x71, 0x75, 0x65, 0xc3, 0xb1,
- 0x6f, 0x72, 0x65, 0x63, 0x69, 0x62, 0x69, 0x64, 0x61, 0x74, 0x72, 0x69, 0x62,
- 0x75, 0x6e, 0x61, 0x6c, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x69, 0x66, 0x65, 0x63,
- 0x61, 0x6e, 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x63, 0x61, 0x6e, 0x61, 0x72, 0x69,
- 0x61, 0x73, 0x64, 0x65, 0x73, 0x63, 0x61, 0x72, 0x67, 0x61, 0x64, 0x69, 0x76,
- 0x65, 0x72, 0x73, 0x6f, 0x73, 0x6d, 0x61, 0x6c, 0x6c, 0x6f, 0x72, 0x63, 0x61,
- 0x72, 0x65, 0x71, 0x75, 0x69, 0x65, 0x72, 0x65, 0x74, 0xc3, 0xa9, 0x63, 0x6e,
- 0x69, 0x63, 0x6f, 0x64, 0x65, 0x62, 0x65, 0x72, 0xc3, 0xad, 0x61, 0x76, 0x69,
- 0x76, 0x69, 0x65, 0x6e, 0x64, 0x61, 0x66, 0x69, 0x6e, 0x61, 0x6e, 0x7a, 0x61,
- 0x73, 0x61, 0x64, 0x65, 0x6c, 0x61, 0x6e, 0x74, 0x65, 0x66, 0x75, 0x6e, 0x63,
- 0x69, 0x6f, 0x6e, 0x61, 0x63, 0x6f, 0x6e, 0x73, 0x65, 0x6a, 0x6f, 0x73, 0x64,
- 0x69, 0x66, 0xc3, 0xad, 0x63, 0x69, 0x6c, 0x63, 0x69, 0x75, 0x64, 0x61, 0x64,
- 0x65, 0x73, 0x61, 0x6e, 0x74, 0x69, 0x67, 0x75, 0x61, 0x73, 0x61, 0x76, 0x61,
- 0x6e, 0x7a, 0x61, 0x64, 0x61, 0x74, 0xc3, 0xa9, 0x72, 0x6d, 0x69, 0x6e, 0x6f,
- 0x75, 0x6e, 0x69, 0x64, 0x61, 0x64, 0x65, 0x73, 0x73, 0xc3, 0xa1, 0x6e, 0x63,
- 0x68, 0x65, 0x7a, 0x63, 0x61, 0x6d, 0x70, 0x61, 0xc3, 0xb1, 0x61, 0x73, 0x6f,
- 0x66, 0x74, 0x6f, 0x6e, 0x69, 0x63, 0x72, 0x65, 0x76, 0x69, 0x73, 0x74, 0x61,
- 0x73, 0x63, 0x6f, 0x6e, 0x74, 0x69, 0x65, 0x6e, 0x65, 0x73, 0x65, 0x63, 0x74,
- 0x6f, 0x72, 0x65, 0x73, 0x6d, 0x6f, 0x6d, 0x65, 0x6e, 0x74, 0x6f, 0x73, 0x66,
- 0x61, 0x63, 0x75, 0x6c, 0x74, 0x61, 0x64, 0x63, 0x72, 0xc3, 0xa9, 0x64, 0x69,
- 0x74, 0x6f, 0x64, 0x69, 0x76, 0x65, 0x72, 0x73, 0x61, 0x73, 0x73, 0x75, 0x70,
- 0x75, 0x65, 0x73, 0x74, 0x6f, 0x66, 0x61, 0x63, 0x74, 0x6f, 0x72, 0x65, 0x73,
- 0x73, 0x65, 0x67, 0x75, 0x6e, 0x64, 0x6f, 0x73, 0x70, 0x65, 0x71, 0x75, 0x65,
- 0xc3, 0xb1, 0x61, 0xd0, 0xb3, 0xd0, 0xbe, 0xd0, 0xb4, 0xd0, 0xb0, 0xd0, 0xb5,
- 0xd1, 0x81, 0xd0, 0xbb, 0xd0, 0xb8, 0xd0, 0xb5, 0xd1, 0x81, 0xd1, 0x82, 0xd1,
- 0x8c, 0xd0, 0xb1, 0xd1, 0x8b, 0xd0, 0xbb, 0xd0, 0xbe, 0xd0, 0xb1, 0xd1, 0x8b,
- 0xd1, 0x82, 0xd1, 0x8c, 0xd1, 0x8d, 0xd1, 0x82, 0xd0, 0xbe, 0xd0, 0xbc, 0xd0,
- 0x95, 0xd1, 0x81, 0xd0, 0xbb, 0xd0, 0xb8, 0xd1, 0x82, 0xd0, 0xbe, 0xd0, 0xb3,
- 0xd0, 0xbe, 0xd0, 0xbc, 0xd0, 0xb5, 0xd0, 0xbd, 0xd1, 0x8f, 0xd0, 0xb2, 0xd1,
- 0x81, 0xd0, 0xb5, 0xd1, 0x85, 0xd1, 0x8d, 0xd1, 0x82, 0xd0, 0xbe, 0xd0, 0xb9,
- 0xd0, 0xb4, 0xd0, 0xb0, 0xd0, 0xb6, 0xd0, 0xb5, 0xd0, 0xb1, 0xd1, 0x8b, 0xd0,
- 0xbb, 0xd0, 0xb8, 0xd0, 0xb3, 0xd0, 0xbe, 0xd0, 0xb4, 0xd1, 0x83, 0xd0, 0xb4,
- 0xd0, 0xb5, 0xd0, 0xbd, 0xd1, 0x8c, 0xd1, 0x8d, 0xd1, 0x82, 0xd0, 0xbe, 0xd1,
- 0x82, 0xd0, 0xb1, 0xd1, 0x8b, 0xd0, 0xbb, 0xd0, 0xb0, 0xd1, 0x81, 0xd0, 0xb5,
- 0xd0, 0xb1, 0xd1, 0x8f, 0xd0, 0xbe, 0xd0, 0xb4, 0xd0, 0xb8, 0xd0, 0xbd, 0xd1,
- 0x81, 0xd0, 0xb5, 0xd0, 0xb1, 0xd0, 0xb5, 0xd0, 0xbd, 0xd0, 0xb0, 0xd0, 0xb4,
- 0xd0, 0xbe, 0xd1, 0x81, 0xd0, 0xb0, 0xd0, 0xb9, 0xd1, 0x82, 0xd1, 0x84, 0xd0,
- 0xbe, 0xd1, 0x82, 0xd0, 0xbe, 0xd0, 0xbd, 0xd0, 0xb5, 0xd0, 0xb3, 0xd0, 0xbe,
- 0xd1, 0x81, 0xd0, 0xb2, 0xd0, 0xbe, 0xd0, 0xb8, 0xd1, 0x81, 0xd0, 0xb2, 0xd0,
- 0xbe, 0xd0, 0xb9, 0xd0, 0xb8, 0xd0, 0xb3, 0xd1, 0x80, 0xd1, 0x8b, 0xd1, 0x82,
- 0xd0, 0xbe, 0xd0, 0xb6, 0xd0, 0xb5, 0xd0, 0xb2, 0xd1, 0x81, 0xd0, 0xb5, 0xd0,
- 0xbc, 0xd1, 0x81, 0xd0, 0xb2, 0xd0, 0xbe, 0xd1, 0x8e, 0xd0, 0xbb, 0xd0, 0xb8,
- 0xd1, 0x88, 0xd1, 0x8c, 0xd1, 0x8d, 0xd1, 0x82, 0xd0, 0xb8, 0xd1, 0x85, 0xd0,
- 0xbf, 0xd0, 0xbe, 0xd0, 0xba, 0xd0, 0xb0, 0xd0, 0xb4, 0xd0, 0xbd, 0xd0, 0xb5,
- 0xd0, 0xb9, 0xd0, 0xb4, 0xd0, 0xbe, 0xd0, 0xbc, 0xd0, 0xb0, 0xd0, 0xbc, 0xd0,
- 0xb8, 0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xbb, 0xd0, 0xb8, 0xd0, 0xb1, 0xd0, 0xbe,
- 0xd1, 0x82, 0xd0, 0xb5, 0xd0, 0xbc, 0xd1, 0x83, 0xd1, 0x85, 0xd0, 0xbe, 0xd1,
- 0x82, 0xd1, 0x8f, 0xd0, 0xb4, 0xd0, 0xb2, 0xd1, 0x83, 0xd1, 0x85, 0xd1, 0x81,
- 0xd0, 0xb5, 0xd1, 0x82, 0xd0, 0xb8, 0xd0, 0xbb, 0xd1, 0x8e, 0xd0, 0xb4, 0xd0,
- 0xb8, 0xd0, 0xb4, 0xd0, 0xb5, 0xd0, 0xbb, 0xd0, 0xbe, 0xd0, 0xbc, 0xd0, 0xb8,
- 0xd1, 0x80, 0xd0, 0xb5, 0xd1, 0x82, 0xd0, 0xb5, 0xd0, 0xb1, 0xd1, 0x8f, 0xd1,
- 0x81, 0xd0, 0xb2, 0xd0, 0xbe, 0xd0, 0xb5, 0xd0, 0xb2, 0xd0, 0xb8, 0xd0, 0xb4,
- 0xd0, 0xb5, 0xd1, 0x87, 0xd0, 0xb5, 0xd0, 0xb3, 0xd0, 0xbe, 0xd1, 0x8d, 0xd1,
- 0x82, 0xd0, 0xb8, 0xd0, 0xbc, 0xd1, 0x81, 0xd1, 0x87, 0xd0, 0xb5, 0xd1, 0x82,
- 0xd1, 0x82, 0xd0, 0xb5, 0xd0, 0xbc, 0xd1, 0x8b, 0xd1, 0x86, 0xd0, 0xb5, 0xd0,
- 0xbd, 0xd1, 0x8b, 0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xb0, 0xd0, 0xbb, 0xd0, 0xb2,
- 0xd0, 0xb5, 0xd0, 0xb4, 0xd1, 0x8c, 0xd1, 0x82, 0xd0, 0xb5, 0xd0, 0xbc, 0xd0,
- 0xb5, 0xd0, 0xb2, 0xd0, 0xbe, 0xd0, 0xb4, 0xd1, 0x8b, 0xd1, 0x82, 0xd0, 0xb5,
- 0xd0, 0xb1, 0xd0, 0xb5, 0xd0, 0xb2, 0xd1, 0x8b, 0xd1, 0x88, 0xd0, 0xb5, 0xd0,
- 0xbd, 0xd0, 0xb0, 0xd0, 0xbc, 0xd0, 0xb8, 0xd1, 0x82, 0xd0, 0xb8, 0xd0, 0xbf,
- 0xd0, 0xb0, 0xd1, 0x82, 0xd0, 0xbe, 0xd0, 0xbc, 0xd1, 0x83, 0xd0, 0xbf, 0xd1,
- 0x80, 0xd0, 0xb0, 0xd0, 0xb2, 0xd0, 0xbb, 0xd0, 0xb8, 0xd1, 0x86, 0xd0, 0xb0,
- 0xd0, 0xbe, 0xd0, 0xb4, 0xd0, 0xbd, 0xd0, 0xb0, 0xd0, 0xb3, 0xd0, 0xbe, 0xd0,
- 0xb4, 0xd1, 0x8b, 0xd0, 0xb7, 0xd0, 0xbd, 0xd0, 0xb0, 0xd1, 0x8e, 0xd0, 0xbc,
- 0xd0, 0xbe, 0xd0, 0xb3, 0xd1, 0x83, 0xd0, 0xb4, 0xd1, 0x80, 0xd1, 0x83, 0xd0,
- 0xb3, 0xd0, 0xb2, 0xd1, 0x81, 0xd0, 0xb5, 0xd0, 0xb9, 0xd0, 0xb8, 0xd0, 0xb4,
- 0xd0, 0xb5, 0xd1, 0x82, 0xd0, 0xba, 0xd0, 0xb8, 0xd0, 0xbd, 0xd0, 0xbe, 0xd0,
- 0xbe, 0xd0, 0xb4, 0xd0, 0xbd, 0xd0, 0xbe, 0xd0, 0xb4, 0xd0, 0xb5, 0xd0, 0xbb,
- 0xd0, 0xb0, 0xd0, 0xb4, 0xd0, 0xb5, 0xd0, 0xbb, 0xd0, 0xb5, 0xd1, 0x81, 0xd1,
- 0x80, 0xd0, 0xbe, 0xd0, 0xba, 0xd0, 0xb8, 0xd1, 0x8e, 0xd0, 0xbd, 0xd1, 0x8f,
- 0xd0, 0xb2, 0xd0, 0xb5, 0xd1, 0x81, 0xd1, 0x8c, 0xd0, 0x95, 0xd1, 0x81, 0xd1,
- 0x82, 0xd1, 0x8c, 0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xb7, 0xd0, 0xb0, 0xd0, 0xbd,
- 0xd0, 0xb0, 0xd1, 0x88, 0xd0, 0xb8, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x84, 0xd9,
- 0x87, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xaa, 0xd9, 0x8a, 0xd8, 0xac, 0xd9, 0x85,
- 0xd9, 0x8a, 0xd8, 0xb9, 0xd8, 0xae, 0xd8, 0xa7, 0xd8, 0xb5, 0xd8, 0xa9, 0xd8,
- 0xa7, 0xd9, 0x84, 0xd8, 0xb0, 0xd9, 0x8a, 0xd8, 0xb9, 0xd9, 0x84, 0xd9, 0x8a,
- 0xd9, 0x87, 0xd8, 0xac, 0xd8, 0xaf, 0xd9, 0x8a, 0xd8, 0xaf, 0xd8, 0xa7, 0xd9,
- 0x84, 0xd8, 0xa2, 0xd9, 0x86, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb1, 0xd8, 0xaf,
- 0xd8, 0xaa, 0xd8, 0xad, 0xd9, 0x83, 0xd9, 0x85, 0xd8, 0xb5, 0xd9, 0x81, 0xd8,
- 0xad, 0xd8, 0xa9, 0xd9, 0x83, 0xd8, 0xa7, 0xd9, 0x86, 0xd8, 0xaa, 0xd8, 0xa7,
- 0xd9, 0x84, 0xd9, 0x84, 0xd9, 0x8a, 0xd9, 0x8a, 0xd9, 0x83, 0xd9, 0x88, 0xd9,
- 0x86, 0xd8, 0xb4, 0xd8, 0xa8, 0xd9, 0x83, 0xd8, 0xa9, 0xd9, 0x81, 0xd9, 0x8a,
- 0xd9, 0x87, 0xd8, 0xa7, 0xd8, 0xa8, 0xd9, 0x86, 0xd8, 0xa7, 0xd8, 0xaa, 0xd8,
- 0xad, 0xd9, 0x88, 0xd8, 0xa7, 0xd8, 0xa1, 0xd8, 0xa3, 0xd9, 0x83, 0xd8, 0xab,
- 0xd8, 0xb1, 0xd8, 0xae, 0xd9, 0x84, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa7, 0xd9,
- 0x84, 0xd8, 0xad, 0xd8, 0xa8, 0xd8, 0xaf, 0xd9, 0x84, 0xd9, 0x8a, 0xd9, 0x84,
- 0xd8, 0xaf, 0xd8, 0xb1, 0xd9, 0x88, 0xd8, 0xb3, 0xd8, 0xa7, 0xd8, 0xb6, 0xd8,
- 0xba, 0xd8, 0xb7, 0xd8, 0xaa, 0xd9, 0x83, 0xd9, 0x88, 0xd9, 0x86, 0xd9, 0x87,
- 0xd9, 0x86, 0xd8, 0xa7, 0xd9, 0x83, 0xd8, 0xb3, 0xd8, 0xa7, 0xd8, 0xad, 0xd8,
- 0xa9, 0xd9, 0x86, 0xd8, 0xa7, 0xd8, 0xaf, 0xd9, 0x8a, 0xd8, 0xa7, 0xd9, 0x84,
- 0xd8, 0xb7, 0xd8, 0xa8, 0xd8, 0xb9, 0xd9, 0x84, 0xd9, 0x8a, 0xd9, 0x83, 0xd8,
- 0xb4, 0xd9, 0x83, 0xd8, 0xb1, 0xd8, 0xa7, 0xd9, 0x8a, 0xd9, 0x85, 0xd9, 0x83,
- 0xd9, 0x86, 0xd9, 0x85, 0xd9, 0x86, 0xd9, 0x87, 0xd8, 0xa7, 0xd8, 0xb4, 0xd8,
- 0xb1, 0xd9, 0x83, 0xd8, 0xa9, 0xd8, 0xb1, 0xd8, 0xa6, 0xd9, 0x8a, 0xd8, 0xb3,
- 0xd9, 0x86, 0xd8, 0xb4, 0xd9, 0x8a, 0xd8, 0xb7, 0xd9, 0x85, 0xd8, 0xa7, 0xd8,
- 0xb0, 0xd8, 0xa7, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x81, 0xd9, 0x86, 0xd8, 0xb4,
- 0xd8, 0xa8, 0xd8, 0xa7, 0xd8, 0xa8, 0xd8, 0xaa, 0xd8, 0xb9, 0xd8, 0xa8, 0xd8,
- 0xb1, 0xd8, 0xb1, 0xd8, 0xad, 0xd9, 0x85, 0xd8, 0xa9, 0xd9, 0x83, 0xd8, 0xa7,
- 0xd9, 0x81, 0xd8, 0xa9, 0xd9, 0x8a, 0xd9, 0x82, 0xd9, 0x88, 0xd9, 0x84, 0xd9,
- 0x85, 0xd8, 0xb1, 0xd9, 0x83, 0xd8, 0xb2, 0xd9, 0x83, 0xd9, 0x84, 0xd9, 0x85,
- 0xd8, 0xa9, 0xd8, 0xa3, 0xd8, 0xad, 0xd9, 0x85, 0xd8, 0xaf, 0xd9, 0x82, 0xd9,
- 0x84, 0xd8, 0xa8, 0xd9, 0x8a, 0xd9, 0x8a, 0xd8, 0xb9, 0xd9, 0x86, 0xd9, 0x8a,
- 0xd8, 0xb5, 0xd9, 0x88, 0xd8, 0xb1, 0xd8, 0xa9, 0xd8, 0xb7, 0xd8, 0xb1, 0xd9,
- 0x8a, 0xd9, 0x82, 0xd8, 0xb4, 0xd8, 0xa7, 0xd8, 0xb1, 0xd9, 0x83, 0xd8, 0xac,
- 0xd9, 0x88, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa3, 0xd8, 0xae, 0xd8, 0xb1, 0xd9,
- 0x89, 0xd9, 0x85, 0xd8, 0xb9, 0xd9, 0x86, 0xd8, 0xa7, 0xd8, 0xa7, 0xd8, 0xa8,
- 0xd8, 0xad, 0xd8, 0xab, 0xd8, 0xb9, 0xd8, 0xb1, 0xd9, 0x88, 0xd8, 0xb6, 0xd8,
- 0xa8, 0xd8, 0xb4, 0xd9, 0x83, 0xd9, 0x84, 0xd9, 0x85, 0xd8, 0xb3, 0xd8, 0xac,
- 0xd9, 0x84, 0xd8, 0xa8, 0xd9, 0x86, 0xd8, 0xa7, 0xd9, 0x86, 0xd8, 0xae, 0xd8,
- 0xa7, 0xd9, 0x84, 0xd8, 0xaf, 0xd9, 0x83, 0xd8, 0xaa, 0xd8, 0xa7, 0xd8, 0xa8,
- 0xd9, 0x83, 0xd9, 0x84, 0xd9, 0x8a, 0xd8, 0xa9, 0xd8, 0xa8, 0xd8, 0xaf, 0xd9,
- 0x88, 0xd9, 0x86, 0xd8, 0xa3, 0xd9, 0x8a, 0xd8, 0xb6, 0xd8, 0xa7, 0xd9, 0x8a,
- 0xd9, 0x88, 0xd8, 0xac, 0xd8, 0xaf, 0xd9, 0x81, 0xd8, 0xb1, 0xd9, 0x8a, 0xd9,
- 0x82, 0xd9, 0x83, 0xd8, 0xaa, 0xd8, 0xa8, 0xd8, 0xaa, 0xd8, 0xa3, 0xd9, 0x81,
- 0xd8, 0xb6, 0xd9, 0x84, 0xd9, 0x85, 0xd8, 0xb7, 0xd8, 0xa8, 0xd8, 0xae, 0xd8,
- 0xa7, 0xd9, 0x83, 0xd8, 0xab, 0xd8, 0xb1, 0xd8, 0xa8, 0xd8, 0xa7, 0xd8, 0xb1,
- 0xd9, 0x83, 0xd8, 0xa7, 0xd9, 0x81, 0xd8, 0xb6, 0xd9, 0x84, 0xd8, 0xa7, 0xd8,
- 0xad, 0xd9, 0x84, 0xd9, 0x89, 0xd9, 0x86, 0xd9, 0x81, 0xd8, 0xb3, 0xd9, 0x87,
- 0xd8, 0xa3, 0xd9, 0x8a, 0xd8, 0xa7, 0xd9, 0x85, 0xd8, 0xb1, 0xd8, 0xaf, 0xd9,
- 0x88, 0xd8, 0xaf, 0xd8, 0xa3, 0xd9, 0x86, 0xd9, 0x87, 0xd8, 0xa7, 0xd8, 0xaf,
- 0xd9, 0x8a, 0xd9, 0x86, 0xd8, 0xa7, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa7, 0xd9,
- 0x86, 0xd9, 0x85, 0xd8, 0xb9, 0xd8, 0xb1, 0xd8, 0xb6, 0xd8, 0xaa, 0xd8, 0xb9,
- 0xd9, 0x84, 0xd9, 0x85, 0xd8, 0xaf, 0xd8, 0xa7, 0xd8, 0xae, 0xd9, 0x84, 0xd9,
- 0x85, 0xd9, 0x85, 0xd9, 0x83, 0xd9, 0x86, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
- 0x00, 0x00, 0x01, 0x00, 0x01, 0x00, 0x01, 0x00, 0x01, 0x00, 0x02, 0x00, 0x02,
- 0x00, 0x02, 0x00, 0x02, 0x00, 0x04, 0x00, 0x04, 0x00, 0x04, 0x00, 0x04, 0x00,
- 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, 0x07, 0x07, 0x06, 0x05, 0x04, 0x03,
- 0x02, 0x01, 0x00, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, 0x0f, 0x0f, 0x0e,
- 0x0d, 0x0c, 0x0b, 0x0a, 0x09, 0x08, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16,
- 0x17, 0x17, 0x16, 0x15, 0x14, 0x13, 0x12, 0x11, 0x10, 0x18, 0x19, 0x1a, 0x1b,
- 0x1c, 0x1d, 0x1e, 0x1f, 0x1f, 0x1e, 0x1d, 0x1c, 0x1b, 0x1a, 0x19, 0x18, 0xff,
- 0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff,
- 0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00,
- 0x00, 0x01, 0x00, 0x00, 0x00, 0x01, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00,
- 0xff, 0xff, 0x00, 0x01, 0x00, 0x00, 0x00, 0x01, 0x00, 0x00, 0xff, 0xff, 0x00,
- 0x01, 0x00, 0x00, 0x00, 0x08, 0x00, 0x08, 0x00, 0x08, 0x00, 0x08, 0x00, 0x00,
- 0x00, 0x01, 0x00, 0x02, 0x00, 0x03, 0x00, 0x04, 0x00, 0x05, 0x00, 0x06, 0x00,
- 0x07, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x73, 0x63, 0x6f, 0x75,
- 0x6e, 0x74, 0x72, 0x69, 0x65, 0x73, 0x71, 0x75, 0x65, 0x73, 0x74, 0x69, 0x6f,
- 0x6e, 0x73, 0x65, 0x71, 0x75, 0x69, 0x70, 0x6d, 0x65, 0x6e, 0x74, 0x63, 0x6f,
- 0x6d, 0x6d, 0x75, 0x6e, 0x69, 0x74, 0x79, 0x61, 0x76, 0x61, 0x69, 0x6c, 0x61,
- 0x62, 0x6c, 0x65, 0x68, 0x69, 0x67, 0x68, 0x6c, 0x69, 0x67, 0x68, 0x74, 0x44,
- 0x54, 0x44, 0x2f, 0x78, 0x68, 0x74, 0x6d, 0x6c, 0x6d, 0x61, 0x72, 0x6b, 0x65,
- 0x74, 0x69, 0x6e, 0x67, 0x6b, 0x6e, 0x6f, 0x77, 0x6c, 0x65, 0x64, 0x67, 0x65,
- 0x73, 0x6f, 0x6d, 0x65, 0x74, 0x68, 0x69, 0x6e, 0x67, 0x63, 0x6f, 0x6e, 0x74,
- 0x61, 0x69, 0x6e, 0x65, 0x72, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x69, 0x6f,
- 0x6e, 0x73, 0x75, 0x62, 0x73, 0x63, 0x72, 0x69, 0x62, 0x65, 0x61, 0x64, 0x76,
- 0x65, 0x72, 0x74, 0x69, 0x73, 0x65, 0x63, 0x68, 0x61, 0x72, 0x61, 0x63, 0x74,
- 0x65, 0x72, 0x22, 0x20, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3d, 0x22, 0x3c, 0x2f,
- 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x3e, 0x41, 0x75, 0x73, 0x74, 0x72, 0x61,
- 0x6c, 0x69, 0x61, 0x22, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x73,
- 0x69, 0x74, 0x75, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x75, 0x74, 0x68, 0x6f,
- 0x72, 0x69, 0x74, 0x79, 0x66, 0x6f, 0x6c, 0x6c, 0x6f, 0x77, 0x69, 0x6e, 0x67,
- 0x70, 0x72, 0x69, 0x6d, 0x61, 0x72, 0x69, 0x6c, 0x79, 0x6f, 0x70, 0x65, 0x72,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x63, 0x68, 0x61, 0x6c, 0x6c, 0x65, 0x6e, 0x67,
- 0x65, 0x64, 0x65, 0x76, 0x65, 0x6c, 0x6f, 0x70, 0x65, 0x64, 0x61, 0x6e, 0x6f,
- 0x6e, 0x79, 0x6d, 0x6f, 0x75, 0x73, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f,
- 0x6e, 0x20, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x63, 0x6f,
- 0x6d, 0x70, 0x61, 0x6e, 0x69, 0x65, 0x73, 0x73, 0x74, 0x72, 0x75, 0x63, 0x74,
- 0x75, 0x72, 0x65, 0x61, 0x67, 0x72, 0x65, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x22,
- 0x20, 0x74, 0x69, 0x74, 0x6c, 0x65, 0x3d, 0x22, 0x70, 0x6f, 0x74, 0x65, 0x6e,
- 0x74, 0x69, 0x61, 0x6c, 0x65, 0x64, 0x75, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e,
- 0x61, 0x72, 0x67, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x73, 0x65, 0x63, 0x6f,
- 0x6e, 0x64, 0x61, 0x72, 0x79, 0x63, 0x6f, 0x70, 0x79, 0x72, 0x69, 0x67, 0x68,
- 0x74, 0x6c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x73, 0x65, 0x78, 0x63,
- 0x6c, 0x75, 0x73, 0x69, 0x76, 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69,
- 0x6f, 0x6e, 0x3c, 0x2f, 0x66, 0x6f, 0x72, 0x6d, 0x3e, 0x0d, 0x0a, 0x73, 0x74,
- 0x61, 0x74, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x74, 0x74, 0x65, 0x6e, 0x74,
- 0x69, 0x6f, 0x6e, 0x42, 0x69, 0x6f, 0x67, 0x72, 0x61, 0x70, 0x68, 0x79, 0x7d,
- 0x20, 0x65, 0x6c, 0x73, 0x65, 0x20, 0x7b, 0x0a, 0x73, 0x6f, 0x6c, 0x75, 0x74,
- 0x69, 0x6f, 0x6e, 0x73, 0x77, 0x68, 0x65, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20,
- 0x41, 0x6e, 0x61, 0x6c, 0x79, 0x74, 0x69, 0x63, 0x73, 0x74, 0x65, 0x6d, 0x70,
- 0x6c, 0x61, 0x74, 0x65, 0x73, 0x64, 0x61, 0x6e, 0x67, 0x65, 0x72, 0x6f, 0x75,
- 0x73, 0x73, 0x61, 0x74, 0x65, 0x6c, 0x6c, 0x69, 0x74, 0x65, 0x64, 0x6f, 0x63,
- 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x73, 0x68,
- 0x65, 0x72, 0x69, 0x6d, 0x70, 0x6f, 0x72, 0x74, 0x61, 0x6e, 0x74, 0x70, 0x72,
- 0x6f, 0x74, 0x6f, 0x74, 0x79, 0x70, 0x65, 0x69, 0x6e, 0x66, 0x6c, 0x75, 0x65,
- 0x6e, 0x63, 0x65, 0x26, 0x72, 0x61, 0x71, 0x75, 0x6f, 0x3b, 0x3c, 0x2f, 0x65,
- 0x66, 0x66, 0x65, 0x63, 0x74, 0x69, 0x76, 0x65, 0x67, 0x65, 0x6e, 0x65, 0x72,
- 0x61, 0x6c, 0x6c, 0x79, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x66, 0x6f, 0x72, 0x6d,
- 0x62, 0x65, 0x61, 0x75, 0x74, 0x69, 0x66, 0x75, 0x6c, 0x74, 0x72, 0x61, 0x6e,
- 0x73, 0x70, 0x6f, 0x72, 0x74, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x65,
- 0x64, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x73, 0x68, 0x65, 0x64, 0x70, 0x72, 0x6f,
- 0x6d, 0x69, 0x6e, 0x65, 0x6e, 0x74, 0x75, 0x6e, 0x74, 0x69, 0x6c, 0x20, 0x74,
- 0x68, 0x65, 0x74, 0x68, 0x75, 0x6d, 0x62, 0x6e, 0x61, 0x69, 0x6c, 0x4e, 0x61,
- 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x20, 0x2e, 0x66, 0x6f, 0x63, 0x75, 0x73,
- 0x28, 0x29, 0x3b, 0x6f, 0x76, 0x65, 0x72, 0x20, 0x74, 0x68, 0x65, 0x20, 0x6d,
- 0x69, 0x67, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6e, 0x6e, 0x6f, 0x75,
- 0x6e, 0x63, 0x65, 0x64, 0x66, 0x6f, 0x6f, 0x74, 0x65, 0x72, 0x22, 0x3e, 0x0a,
- 0x65, 0x78, 0x63, 0x65, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x6c, 0x65, 0x73, 0x73,
- 0x20, 0x74, 0x68, 0x61, 0x6e, 0x65, 0x78, 0x70, 0x65, 0x6e, 0x73, 0x69, 0x76,
- 0x65, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x66, 0x72, 0x61,
- 0x6d, 0x65, 0x77, 0x6f, 0x72, 0x6b, 0x74, 0x65, 0x72, 0x72, 0x69, 0x74, 0x6f,
- 0x72, 0x79, 0x6e, 0x64, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x63, 0x75,
- 0x72, 0x72, 0x65, 0x6e, 0x74, 0x6c, 0x79, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x4e,
- 0x61, 0x6d, 0x65, 0x63, 0x72, 0x69, 0x74, 0x69, 0x63, 0x69, 0x73, 0x6d, 0x74,
- 0x72, 0x61, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x65, 0x6c, 0x73, 0x65, 0x77,
- 0x68, 0x65, 0x72, 0x65, 0x41, 0x6c, 0x65, 0x78, 0x61, 0x6e, 0x64, 0x65, 0x72,
- 0x61, 0x70, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x65, 0x64, 0x6d, 0x61, 0x74, 0x65,
- 0x72, 0x69, 0x61, 0x6c, 0x73, 0x62, 0x72, 0x6f, 0x61, 0x64, 0x63, 0x61, 0x73,
- 0x74, 0x6d, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x65, 0x64, 0x61, 0x66, 0x66,
- 0x69, 0x6c, 0x69, 0x61, 0x74, 0x65, 0x3c, 0x2f, 0x6f, 0x70, 0x74, 0x69, 0x6f,
- 0x6e, 0x3e, 0x74, 0x72, 0x65, 0x61, 0x74, 0x6d, 0x65, 0x6e, 0x74, 0x64, 0x69,
- 0x66, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x74, 0x2f, 0x64, 0x65, 0x66, 0x61, 0x75,
- 0x6c, 0x74, 0x2e, 0x50, 0x72, 0x65, 0x73, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x6f,
- 0x6e, 0x63, 0x6c, 0x69, 0x63, 0x6b, 0x3d, 0x22, 0x62, 0x69, 0x6f, 0x67, 0x72,
- 0x61, 0x70, 0x68, 0x79, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x77, 0x69, 0x73, 0x65,
- 0x70, 0x65, 0x72, 0x6d, 0x61, 0x6e, 0x65, 0x6e, 0x74, 0x46, 0x72, 0x61, 0x6e,
- 0xc3, 0xa7, 0x61, 0x69, 0x73, 0x48, 0x6f, 0x6c, 0x6c, 0x79, 0x77, 0x6f, 0x6f,
- 0x64, 0x65, 0x78, 0x70, 0x61, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x74, 0x61,
- 0x6e, 0x64, 0x61, 0x72, 0x64, 0x73, 0x3c, 0x2f, 0x73, 0x74, 0x79, 0x6c, 0x65,
- 0x3e, 0x0a, 0x72, 0x65, 0x64, 0x75, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x44, 0x65,
- 0x63, 0x65, 0x6d, 0x62, 0x65, 0x72, 0x20, 0x70, 0x72, 0x65, 0x66, 0x65, 0x72,
- 0x72, 0x65, 0x64, 0x43, 0x61, 0x6d, 0x62, 0x72, 0x69, 0x64, 0x67, 0x65, 0x6f,
- 0x70, 0x70, 0x6f, 0x6e, 0x65, 0x6e, 0x74, 0x73, 0x42, 0x75, 0x73, 0x69, 0x6e,
- 0x65, 0x73, 0x73, 0x20, 0x63, 0x6f, 0x6e, 0x66, 0x75, 0x73, 0x69, 0x6f, 0x6e,
- 0x3e, 0x0a, 0x3c, 0x74, 0x69, 0x74, 0x6c, 0x65, 0x3e, 0x70, 0x72, 0x65, 0x73,
- 0x65, 0x6e, 0x74, 0x65, 0x64, 0x65, 0x78, 0x70, 0x6c, 0x61, 0x69, 0x6e, 0x65,
- 0x64, 0x64, 0x6f, 0x65, 0x73, 0x20, 0x6e, 0x6f, 0x74, 0x20, 0x77, 0x6f, 0x72,
- 0x6c, 0x64, 0x77, 0x69, 0x64, 0x65, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x66, 0x61,
- 0x63, 0x65, 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x6e, 0x65,
- 0x77, 0x73, 0x70, 0x61, 0x70, 0x65, 0x72, 0x3c, 0x2f, 0x74, 0x61, 0x62, 0x6c,
- 0x65, 0x3e, 0x0a, 0x6d, 0x6f, 0x75, 0x6e, 0x74, 0x61, 0x69, 0x6e, 0x73, 0x6c,
- 0x69, 0x6b, 0x65, 0x20, 0x74, 0x68, 0x65, 0x20, 0x65, 0x73, 0x73, 0x65, 0x6e,
- 0x74, 0x69, 0x61, 0x6c, 0x66, 0x69, 0x6e, 0x61, 0x6e, 0x63, 0x69, 0x61, 0x6c,
- 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x63, 0x74, 0x69,
- 0x6f, 0x6e, 0x3d, 0x22, 0x2f, 0x61, 0x62, 0x61, 0x6e, 0x64, 0x6f, 0x6e, 0x65,
- 0x64, 0x45, 0x64, 0x75, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x70, 0x61, 0x72,
- 0x73, 0x65, 0x49, 0x6e, 0x74, 0x28, 0x73, 0x74, 0x61, 0x62, 0x69, 0x6c, 0x69,
- 0x74, 0x79, 0x75, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x20, 0x74, 0x6f, 0x3c, 0x2f,
- 0x74, 0x69, 0x74, 0x6c, 0x65, 0x3e, 0x0a, 0x72, 0x65, 0x6c, 0x61, 0x74, 0x69,
- 0x6f, 0x6e, 0x73, 0x4e, 0x6f, 0x74, 0x65, 0x20, 0x74, 0x68, 0x61, 0x74, 0x65,
- 0x66, 0x66, 0x69, 0x63, 0x69, 0x65, 0x6e, 0x74, 0x70, 0x65, 0x72, 0x66, 0x6f,
- 0x72, 0x6d, 0x65, 0x64, 0x74, 0x77, 0x6f, 0x20, 0x79, 0x65, 0x61, 0x72, 0x73,
- 0x53, 0x69, 0x6e, 0x63, 0x65, 0x20, 0x74, 0x68, 0x65, 0x74, 0x68, 0x65, 0x72,
- 0x65, 0x66, 0x6f, 0x72, 0x65, 0x77, 0x72, 0x61, 0x70, 0x70, 0x65, 0x72, 0x22,
- 0x3e, 0x61, 0x6c, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x74, 0x65, 0x69, 0x6e, 0x63,
- 0x72, 0x65, 0x61, 0x73, 0x65, 0x64, 0x42, 0x61, 0x74, 0x74, 0x6c, 0x65, 0x20,
- 0x6f, 0x66, 0x70, 0x65, 0x72, 0x63, 0x65, 0x69, 0x76, 0x65, 0x64, 0x74, 0x72,
- 0x79, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x6f, 0x6e, 0x65, 0x63, 0x65, 0x73, 0x73,
- 0x61, 0x72, 0x79, 0x70, 0x6f, 0x72, 0x74, 0x72, 0x61, 0x79, 0x65, 0x64, 0x65,
- 0x6c, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x45, 0x6c, 0x69, 0x7a, 0x61,
- 0x62, 0x65, 0x74, 0x68, 0x3c, 0x2f, 0x69, 0x66, 0x72, 0x61, 0x6d, 0x65, 0x3e,
- 0x64, 0x69, 0x73, 0x63, 0x6f, 0x76, 0x65, 0x72, 0x79, 0x69, 0x6e, 0x73, 0x75,
- 0x72, 0x61, 0x6e, 0x63, 0x65, 0x73, 0x2e, 0x6c, 0x65, 0x6e, 0x67, 0x74, 0x68,
- 0x3b, 0x6c, 0x65, 0x67, 0x65, 0x6e, 0x64, 0x61, 0x72, 0x79, 0x47, 0x65, 0x6f,
- 0x67, 0x72, 0x61, 0x70, 0x68, 0x79, 0x63, 0x61, 0x6e, 0x64, 0x69, 0x64, 0x61,
- 0x74, 0x65, 0x63, 0x6f, 0x72, 0x70, 0x6f, 0x72, 0x61, 0x74, 0x65, 0x73, 0x6f,
- 0x6d, 0x65, 0x74, 0x69, 0x6d, 0x65, 0x73, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63,
- 0x65, 0x73, 0x2e, 0x69, 0x6e, 0x68, 0x65, 0x72, 0x69, 0x74, 0x65, 0x64, 0x3c,
- 0x2f, 0x73, 0x74, 0x72, 0x6f, 0x6e, 0x67, 0x3e, 0x43, 0x6f, 0x6d, 0x6d, 0x75,
- 0x6e, 0x69, 0x74, 0x79, 0x72, 0x65, 0x6c, 0x69, 0x67, 0x69, 0x6f, 0x75, 0x73,
- 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x43, 0x6f, 0x6d, 0x6d,
- 0x69, 0x74, 0x74, 0x65, 0x65, 0x62, 0x75, 0x69, 0x6c, 0x64, 0x69, 0x6e, 0x67,
- 0x73, 0x74, 0x68, 0x65, 0x20, 0x77, 0x6f, 0x72, 0x6c, 0x64, 0x6e, 0x6f, 0x20,
- 0x6c, 0x6f, 0x6e, 0x67, 0x65, 0x72, 0x62, 0x65, 0x67, 0x69, 0x6e, 0x6e, 0x69,
- 0x6e, 0x67, 0x72, 0x65, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63, 0x65, 0x63, 0x61,
- 0x6e, 0x6e, 0x6f, 0x74, 0x20, 0x62, 0x65, 0x66, 0x72, 0x65, 0x71, 0x75, 0x65,
- 0x6e, 0x63, 0x79, 0x74, 0x79, 0x70, 0x69, 0x63, 0x61, 0x6c, 0x6c, 0x79, 0x69,
- 0x6e, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x20, 0x72, 0x65, 0x6c, 0x61, 0x74,
- 0x69, 0x76, 0x65, 0x3b, 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x69, 0x6e, 0x67,
- 0x70, 0x72, 0x65, 0x73, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x6e, 0x69, 0x74,
- 0x69, 0x61, 0x6c, 0x6c, 0x79, 0x74, 0x65, 0x63, 0x68, 0x6e, 0x69, 0x71, 0x75,
- 0x65, 0x74, 0x68, 0x65, 0x20, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x69, 0x74, 0x20,
- 0x63, 0x61, 0x6e, 0x20, 0x62, 0x65, 0x65, 0x78, 0x69, 0x73, 0x74, 0x65, 0x6e,
- 0x63, 0x65, 0x75, 0x6e, 0x64, 0x65, 0x72, 0x6c, 0x69, 0x6e, 0x65, 0x74, 0x68,
- 0x69, 0x73, 0x20, 0x74, 0x69, 0x6d, 0x65, 0x74, 0x65, 0x6c, 0x65, 0x70, 0x68,
- 0x6f, 0x6e, 0x65, 0x69, 0x74, 0x65, 0x6d, 0x73, 0x63, 0x6f, 0x70, 0x65, 0x70,
- 0x72, 0x61, 0x63, 0x74, 0x69, 0x63, 0x65, 0x73, 0x61, 0x64, 0x76, 0x61, 0x6e,
- 0x74, 0x61, 0x67, 0x65, 0x29, 0x3b, 0x72, 0x65, 0x74, 0x75, 0x72, 0x6e, 0x20,
- 0x46, 0x6f, 0x72, 0x20, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x70, 0x72, 0x6f, 0x76,
- 0x69, 0x64, 0x69, 0x6e, 0x67, 0x64, 0x65, 0x6d, 0x6f, 0x63, 0x72, 0x61, 0x63,
- 0x79, 0x62, 0x6f, 0x74, 0x68, 0x20, 0x74, 0x68, 0x65, 0x20, 0x65, 0x78, 0x74,
- 0x65, 0x6e, 0x73, 0x69, 0x76, 0x65, 0x73, 0x75, 0x66, 0x66, 0x65, 0x72, 0x69,
- 0x6e, 0x67, 0x73, 0x75, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x65, 0x64, 0x63, 0x6f,
- 0x6d, 0x70, 0x75, 0x74, 0x65, 0x72, 0x73, 0x20, 0x66, 0x75, 0x6e, 0x63, 0x74,
- 0x69, 0x6f, 0x6e, 0x70, 0x72, 0x61, 0x63, 0x74, 0x69, 0x63, 0x61, 0x6c, 0x73,
- 0x61, 0x69, 0x64, 0x20, 0x74, 0x68, 0x61, 0x74, 0x69, 0x74, 0x20, 0x6d, 0x61,
- 0x79, 0x20, 0x62, 0x65, 0x45, 0x6e, 0x67, 0x6c, 0x69, 0x73, 0x68, 0x3c, 0x2f,
- 0x66, 0x72, 0x6f, 0x6d, 0x20, 0x74, 0x68, 0x65, 0x20, 0x73, 0x63, 0x68, 0x65,
- 0x64, 0x75, 0x6c, 0x65, 0x64, 0x64, 0x6f, 0x77, 0x6e, 0x6c, 0x6f, 0x61, 0x64,
- 0x73, 0x3c, 0x2f, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x3e, 0x0a, 0x73, 0x75, 0x73,
- 0x70, 0x65, 0x63, 0x74, 0x65, 0x64, 0x6d, 0x61, 0x72, 0x67, 0x69, 0x6e, 0x3a,
- 0x20, 0x30, 0x73, 0x70, 0x69, 0x72, 0x69, 0x74, 0x75, 0x61, 0x6c, 0x3c, 0x2f,
- 0x68, 0x65, 0x61, 0x64, 0x3e, 0x0a, 0x0a, 0x6d, 0x69, 0x63, 0x72, 0x6f, 0x73,
- 0x6f, 0x66, 0x74, 0x67, 0x72, 0x61, 0x64, 0x75, 0x61, 0x6c, 0x6c, 0x79, 0x64,
- 0x69, 0x73, 0x63, 0x75, 0x73, 0x73, 0x65, 0x64, 0x68, 0x65, 0x20, 0x62, 0x65,
- 0x63, 0x61, 0x6d, 0x65, 0x65, 0x78, 0x65, 0x63, 0x75, 0x74, 0x69, 0x76, 0x65,
- 0x6a, 0x71, 0x75, 0x65, 0x72, 0x79, 0x2e, 0x6a, 0x73, 0x68, 0x6f, 0x75, 0x73,
- 0x65, 0x68, 0x6f, 0x6c, 0x64, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x72, 0x6d, 0x65,
- 0x64, 0x70, 0x75, 0x72, 0x63, 0x68, 0x61, 0x73, 0x65, 0x64, 0x6c, 0x69, 0x74,
- 0x65, 0x72, 0x61, 0x6c, 0x6c, 0x79, 0x64, 0x65, 0x73, 0x74, 0x72, 0x6f, 0x79,
- 0x65, 0x64, 0x75, 0x70, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x76, 0x61,
- 0x72, 0x69, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x72, 0x65, 0x6d, 0x61, 0x69, 0x6e,
- 0x69, 0x6e, 0x67, 0x69, 0x74, 0x20, 0x69, 0x73, 0x20, 0x6e, 0x6f, 0x74, 0x63,
- 0x65, 0x6e, 0x74, 0x75, 0x72, 0x69, 0x65, 0x73, 0x4a, 0x61, 0x70, 0x61, 0x6e,
- 0x65, 0x73, 0x65, 0x20, 0x61, 0x6d, 0x6f, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65,
- 0x63, 0x6f, 0x6d, 0x70, 0x6c, 0x65, 0x74, 0x65, 0x64, 0x61, 0x6c, 0x67, 0x6f,
- 0x72, 0x69, 0x74, 0x68, 0x6d, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x65, 0x73, 0x74,
- 0x73, 0x72, 0x65, 0x62, 0x65, 0x6c, 0x6c, 0x69, 0x6f, 0x6e, 0x75, 0x6e, 0x64,
- 0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, 0x65, 0x6e, 0x63, 0x6f, 0x75, 0x72, 0x61,
- 0x67, 0x65, 0x72, 0x65, 0x73, 0x69, 0x7a, 0x61, 0x62, 0x6c, 0x65, 0x69, 0x6e,
- 0x76, 0x6f, 0x6c, 0x76, 0x69, 0x6e, 0x67, 0x73, 0x65, 0x6e, 0x73, 0x69, 0x74,
- 0x69, 0x76, 0x65, 0x75, 0x6e, 0x69, 0x76, 0x65, 0x72, 0x73, 0x61, 0x6c, 0x70,
- 0x72, 0x6f, 0x76, 0x69, 0x73, 0x69, 0x6f, 0x6e, 0x28, 0x61, 0x6c, 0x74, 0x68,
- 0x6f, 0x75, 0x67, 0x68, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x69, 0x6e, 0x67,
- 0x63, 0x6f, 0x6e, 0x64, 0x75, 0x63, 0x74, 0x65, 0x64, 0x29, 0x2c, 0x20, 0x77,
- 0x68, 0x69, 0x63, 0x68, 0x20, 0x63, 0x6f, 0x6e, 0x74, 0x69, 0x6e, 0x75, 0x65,
- 0x64, 0x2d, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x22, 0x3e, 0x46, 0x65, 0x62,
- 0x72, 0x75, 0x61, 0x72, 0x79, 0x20, 0x6e, 0x75, 0x6d, 0x65, 0x72, 0x6f, 0x75,
- 0x73, 0x20, 0x6f, 0x76, 0x65, 0x72, 0x66, 0x6c, 0x6f, 0x77, 0x3a, 0x63, 0x6f,
- 0x6d, 0x70, 0x6f, 0x6e, 0x65, 0x6e, 0x74, 0x66, 0x72, 0x61, 0x67, 0x6d, 0x65,
- 0x6e, 0x74, 0x73, 0x65, 0x78, 0x63, 0x65, 0x6c, 0x6c, 0x65, 0x6e, 0x74, 0x63,
- 0x6f, 0x6c, 0x73, 0x70, 0x61, 0x6e, 0x3d, 0x22, 0x74, 0x65, 0x63, 0x68, 0x6e,
- 0x69, 0x63, 0x61, 0x6c, 0x6e, 0x65, 0x61, 0x72, 0x20, 0x74, 0x68, 0x65, 0x20,
- 0x41, 0x64, 0x76, 0x61, 0x6e, 0x63, 0x65, 0x64, 0x20, 0x73, 0x6f, 0x75, 0x72,
- 0x63, 0x65, 0x20, 0x6f, 0x66, 0x65, 0x78, 0x70, 0x72, 0x65, 0x73, 0x73, 0x65,
- 0x64, 0x48, 0x6f, 0x6e, 0x67, 0x20, 0x4b, 0x6f, 0x6e, 0x67, 0x20, 0x46, 0x61,
- 0x63, 0x65, 0x62, 0x6f, 0x6f, 0x6b, 0x6d, 0x75, 0x6c, 0x74, 0x69, 0x70, 0x6c,
- 0x65, 0x20, 0x6d, 0x65, 0x63, 0x68, 0x61, 0x6e, 0x69, 0x73, 0x6d, 0x65, 0x6c,
- 0x65, 0x76, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x6f, 0x66, 0x66, 0x65, 0x6e, 0x73,
- 0x69, 0x76, 0x65, 0x3c, 0x2f, 0x66, 0x6f, 0x72, 0x6d, 0x3e, 0x0a, 0x09, 0x73,
- 0x70, 0x6f, 0x6e, 0x73, 0x6f, 0x72, 0x65, 0x64, 0x64, 0x6f, 0x63, 0x75, 0x6d,
- 0x65, 0x6e, 0x74, 0x2e, 0x6f, 0x72, 0x20, 0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b,
- 0x74, 0x68, 0x65, 0x72, 0x65, 0x20, 0x61, 0x72, 0x65, 0x74, 0x68, 0x6f, 0x73,
- 0x65, 0x20, 0x77, 0x68, 0x6f, 0x6d, 0x6f, 0x76, 0x65, 0x6d, 0x65, 0x6e, 0x74,
- 0x73, 0x70, 0x72, 0x6f, 0x63, 0x65, 0x73, 0x73, 0x65, 0x73, 0x64, 0x69, 0x66,
- 0x66, 0x69, 0x63, 0x75, 0x6c, 0x74, 0x73, 0x75, 0x62, 0x6d, 0x69, 0x74, 0x74,
- 0x65, 0x64, 0x72, 0x65, 0x63, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x64, 0x63, 0x6f,
- 0x6e, 0x76, 0x69, 0x6e, 0x63, 0x65, 0x64, 0x70, 0x72, 0x6f, 0x6d, 0x6f, 0x74,
- 0x69, 0x6e, 0x67, 0x22, 0x20, 0x77, 0x69, 0x64, 0x74, 0x68, 0x3d, 0x22, 0x2e,
- 0x72, 0x65, 0x70, 0x6c, 0x61, 0x63, 0x65, 0x28, 0x63, 0x6c, 0x61, 0x73, 0x73,
- 0x69, 0x63, 0x61, 0x6c, 0x63, 0x6f, 0x61, 0x6c, 0x69, 0x74, 0x69, 0x6f, 0x6e,
- 0x68, 0x69, 0x73, 0x20, 0x66, 0x69, 0x72, 0x73, 0x74, 0x64, 0x65, 0x63, 0x69,
- 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x61, 0x73, 0x73, 0x69, 0x73, 0x74, 0x61, 0x6e,
- 0x74, 0x69, 0x6e, 0x64, 0x69, 0x63, 0x61, 0x74, 0x65, 0x64, 0x65, 0x76, 0x6f,
- 0x6c, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x2d, 0x77, 0x72, 0x61, 0x70, 0x70, 0x65,
- 0x72, 0x22, 0x65, 0x6e, 0x6f, 0x75, 0x67, 0x68, 0x20, 0x74, 0x6f, 0x61, 0x6c,
- 0x6f, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65, 0x64, 0x65, 0x6c, 0x69, 0x76, 0x65,
- 0x72, 0x65, 0x64, 0x2d, 0x2d, 0x3e, 0x0d, 0x0a, 0x3c, 0x21, 0x2d, 0x2d, 0x41,
- 0x6d, 0x65, 0x72, 0x69, 0x63, 0x61, 0x6e, 0x20, 0x70, 0x72, 0x6f, 0x74, 0x65,
- 0x63, 0x74, 0x65, 0x64, 0x4e, 0x6f, 0x76, 0x65, 0x6d, 0x62, 0x65, 0x72, 0x20,
- 0x3c, 0x2f, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3e, 0x3c, 0x66, 0x75, 0x72, 0x6e,
- 0x69, 0x74, 0x75, 0x72, 0x65, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x65, 0x74,
- 0x20, 0x20, 0x6f, 0x6e, 0x62, 0x6c, 0x75, 0x72, 0x3d, 0x22, 0x73, 0x75, 0x73,
- 0x70, 0x65, 0x6e, 0x64, 0x65, 0x64, 0x72, 0x65, 0x63, 0x69, 0x70, 0x69, 0x65,
- 0x6e, 0x74, 0x62, 0x61, 0x73, 0x65, 0x64, 0x20, 0x6f, 0x6e, 0x20, 0x4d, 0x6f,
- 0x72, 0x65, 0x6f, 0x76, 0x65, 0x72, 0x2c, 0x61, 0x62, 0x6f, 0x6c, 0x69, 0x73,
- 0x68, 0x65, 0x64, 0x63, 0x6f, 0x6c, 0x6c, 0x65, 0x63, 0x74, 0x65, 0x64, 0x77,
- 0x65, 0x72, 0x65, 0x20, 0x6d, 0x61, 0x64, 0x65, 0x65, 0x6d, 0x6f, 0x74, 0x69,
- 0x6f, 0x6e, 0x61, 0x6c, 0x65, 0x6d, 0x65, 0x72, 0x67, 0x65, 0x6e, 0x63, 0x79,
- 0x6e, 0x61, 0x72, 0x72, 0x61, 0x74, 0x69, 0x76, 0x65, 0x61, 0x64, 0x76, 0x6f,
- 0x63, 0x61, 0x74, 0x65, 0x73, 0x70, 0x78, 0x3b, 0x62, 0x6f, 0x72, 0x64, 0x65,
- 0x72, 0x63, 0x6f, 0x6d, 0x6d, 0x69, 0x74, 0x74, 0x65, 0x64, 0x64, 0x69, 0x72,
- 0x3d, 0x22, 0x6c, 0x74, 0x72, 0x22, 0x65, 0x6d, 0x70, 0x6c, 0x6f, 0x79, 0x65,
- 0x65, 0x73, 0x72, 0x65, 0x73, 0x65, 0x61, 0x72, 0x63, 0x68, 0x2e, 0x20, 0x73,
- 0x65, 0x6c, 0x65, 0x63, 0x74, 0x65, 0x64, 0x73, 0x75, 0x63, 0x63, 0x65, 0x73,
- 0x73, 0x6f, 0x72, 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x65, 0x72, 0x73, 0x64,
- 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x65, 0x64, 0x53, 0x65, 0x70, 0x74, 0x65,
- 0x6d, 0x62, 0x65, 0x72, 0x61, 0x64, 0x64, 0x43, 0x6c, 0x61, 0x73, 0x73, 0x28,
- 0x46, 0x61, 0x63, 0x65, 0x62, 0x6f, 0x6f, 0x6b, 0x20, 0x73, 0x75, 0x67, 0x67,
- 0x65, 0x73, 0x74, 0x65, 0x64, 0x61, 0x6e, 0x64, 0x20, 0x6c, 0x61, 0x74, 0x65,
- 0x72, 0x6f, 0x70, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6e, 0x67, 0x65, 0x6c, 0x61,
- 0x62, 0x6f, 0x72, 0x61, 0x74, 0x65, 0x53, 0x6f, 0x6d, 0x65, 0x74, 0x69, 0x6d,
- 0x65, 0x73, 0x49, 0x6e, 0x73, 0x74, 0x69, 0x74, 0x75, 0x74, 0x65, 0x63, 0x65,
- 0x72, 0x74, 0x61, 0x69, 0x6e, 0x6c, 0x79, 0x69, 0x6e, 0x73, 0x74, 0x61, 0x6c,
- 0x6c, 0x65, 0x64, 0x66, 0x6f, 0x6c, 0x6c, 0x6f, 0x77, 0x65, 0x72, 0x73, 0x4a,
- 0x65, 0x72, 0x75, 0x73, 0x61, 0x6c, 0x65, 0x6d, 0x74, 0x68, 0x65, 0x79, 0x20,
- 0x68, 0x61, 0x76, 0x65, 0x63, 0x6f, 0x6d, 0x70, 0x75, 0x74, 0x69, 0x6e, 0x67,
- 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x65, 0x64, 0x70, 0x72, 0x6f, 0x76,
- 0x69, 0x6e, 0x63, 0x65, 0x73, 0x67, 0x75, 0x61, 0x72, 0x61, 0x6e, 0x74, 0x65,
- 0x65, 0x61, 0x72, 0x62, 0x69, 0x74, 0x72, 0x61, 0x72, 0x79, 0x72, 0x65, 0x63,
- 0x6f, 0x67, 0x6e, 0x69, 0x7a, 0x65, 0x77, 0x61, 0x6e, 0x74, 0x65, 0x64, 0x20,
- 0x74, 0x6f, 0x70, 0x78, 0x3b, 0x77, 0x69, 0x64, 0x74, 0x68, 0x3a, 0x74, 0x68,
- 0x65, 0x6f, 0x72, 0x79, 0x20, 0x6f, 0x66, 0x62, 0x65, 0x68, 0x61, 0x76, 0x69,
- 0x6f, 0x75, 0x72, 0x57, 0x68, 0x69, 0x6c, 0x65, 0x20, 0x74, 0x68, 0x65, 0x65,
- 0x73, 0x74, 0x69, 0x6d, 0x61, 0x74, 0x65, 0x64, 0x62, 0x65, 0x67, 0x61, 0x6e,
- 0x20, 0x74, 0x6f, 0x20, 0x69, 0x74, 0x20, 0x62, 0x65, 0x63, 0x61, 0x6d, 0x65,
- 0x6d, 0x61, 0x67, 0x6e, 0x69, 0x74, 0x75, 0x64, 0x65, 0x6d, 0x75, 0x73, 0x74,
- 0x20, 0x68, 0x61, 0x76, 0x65, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x74, 0x68, 0x61,
- 0x6e, 0x44, 0x69, 0x72, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x79, 0x65, 0x78, 0x74,
- 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x65, 0x63, 0x72, 0x65, 0x74, 0x61,
- 0x72, 0x79, 0x6e, 0x61, 0x74, 0x75, 0x72, 0x61, 0x6c, 0x6c, 0x79, 0x6f, 0x63,
- 0x63, 0x75, 0x72, 0x72, 0x69, 0x6e, 0x67, 0x76, 0x61, 0x72, 0x69, 0x61, 0x62,
- 0x6c, 0x65, 0x73, 0x67, 0x69, 0x76, 0x65, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x70,
- 0x6c, 0x61, 0x74, 0x66, 0x6f, 0x72, 0x6d, 0x2e, 0x3c, 0x2f, 0x6c, 0x61, 0x62,
- 0x65, 0x6c, 0x3e, 0x3c, 0x66, 0x61, 0x69, 0x6c, 0x65, 0x64, 0x20, 0x74, 0x6f,
- 0x63, 0x6f, 0x6d, 0x70, 0x6f, 0x75, 0x6e, 0x64, 0x73, 0x6b, 0x69, 0x6e, 0x64,
- 0x73, 0x20, 0x6f, 0x66, 0x20, 0x73, 0x6f, 0x63, 0x69, 0x65, 0x74, 0x69, 0x65,
- 0x73, 0x61, 0x6c, 0x6f, 0x6e, 0x67, 0x73, 0x69, 0x64, 0x65, 0x20, 0x2d, 0x2d,
- 0x26, 0x67, 0x74, 0x3b, 0x0a, 0x0a, 0x73, 0x6f, 0x75, 0x74, 0x68, 0x77, 0x65,
- 0x73, 0x74, 0x74, 0x68, 0x65, 0x20, 0x72, 0x69, 0x67, 0x68, 0x74, 0x72, 0x61,
- 0x64, 0x69, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x6d, 0x61, 0x79, 0x20, 0x68, 0x61,
- 0x76, 0x65, 0x20, 0x75, 0x6e, 0x65, 0x73, 0x63, 0x61, 0x70, 0x65, 0x28, 0x73,
- 0x70, 0x6f, 0x6b, 0x65, 0x6e, 0x20, 0x69, 0x6e, 0x22, 0x20, 0x68, 0x72, 0x65,
- 0x66, 0x3d, 0x22, 0x2f, 0x70, 0x72, 0x6f, 0x67, 0x72, 0x61, 0x6d, 0x6d, 0x65,
- 0x6f, 0x6e, 0x6c, 0x79, 0x20, 0x74, 0x68, 0x65, 0x20, 0x63, 0x6f, 0x6d, 0x65,
- 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x6f, 0x72,
- 0x79, 0x62, 0x75, 0x72, 0x69, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x61, 0x20, 0x73,
- 0x69, 0x6d, 0x69, 0x6c, 0x61, 0x72, 0x74, 0x68, 0x65, 0x79, 0x20, 0x77, 0x65,
- 0x72, 0x65, 0x3c, 0x2f, 0x66, 0x6f, 0x6e, 0x74, 0x3e, 0x3c, 0x2f, 0x4e, 0x6f,
- 0x72, 0x77, 0x65, 0x67, 0x69, 0x61, 0x6e, 0x73, 0x70, 0x65, 0x63, 0x69, 0x66,
- 0x69, 0x65, 0x64, 0x70, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x69, 0x6e, 0x67, 0x70,
- 0x61, 0x73, 0x73, 0x65, 0x6e, 0x67, 0x65, 0x72, 0x28, 0x6e, 0x65, 0x77, 0x20,
- 0x44, 0x61, 0x74, 0x65, 0x74, 0x65, 0x6d, 0x70, 0x6f, 0x72, 0x61, 0x72, 0x79,
- 0x66, 0x69, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x41, 0x66, 0x74, 0x65,
- 0x72, 0x20, 0x74, 0x68, 0x65, 0x65, 0x71, 0x75, 0x61, 0x74, 0x69, 0x6f, 0x6e,
- 0x73, 0x64, 0x6f, 0x77, 0x6e, 0x6c, 0x6f, 0x61, 0x64, 0x2e, 0x72, 0x65, 0x67,
- 0x75, 0x6c, 0x61, 0x72, 0x6c, 0x79, 0x64, 0x65, 0x76, 0x65, 0x6c, 0x6f, 0x70,
- 0x65, 0x72, 0x61, 0x62, 0x6f, 0x76, 0x65, 0x20, 0x74, 0x68, 0x65, 0x6c, 0x69,
- 0x6e, 0x6b, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x70, 0x68, 0x65, 0x6e, 0x6f, 0x6d,
- 0x65, 0x6e, 0x61, 0x70, 0x65, 0x72, 0x69, 0x6f, 0x64, 0x20, 0x6f, 0x66, 0x74,
- 0x6f, 0x6f, 0x6c, 0x74, 0x69, 0x70, 0x22, 0x3e, 0x73, 0x75, 0x62, 0x73, 0x74,
- 0x61, 0x6e, 0x63, 0x65, 0x61, 0x75, 0x74, 0x6f, 0x6d, 0x61, 0x74, 0x69, 0x63,
- 0x61, 0x73, 0x70, 0x65, 0x63, 0x74, 0x20, 0x6f, 0x66, 0x41, 0x6d, 0x6f, 0x6e,
- 0x67, 0x20, 0x74, 0x68, 0x65, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x65,
- 0x64, 0x65, 0x73, 0x74, 0x69, 0x6d, 0x61, 0x74, 0x65, 0x73, 0x41, 0x69, 0x72,
- 0x20, 0x46, 0x6f, 0x72, 0x63, 0x65, 0x73, 0x79, 0x73, 0x74, 0x65, 0x6d, 0x20,
- 0x6f, 0x66, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x69, 0x76, 0x65, 0x69, 0x6d,
- 0x6d, 0x65, 0x64, 0x69, 0x61, 0x74, 0x65, 0x6d, 0x61, 0x6b, 0x69, 0x6e, 0x67,
- 0x20, 0x69, 0x74, 0x70, 0x61, 0x69, 0x6e, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x63,
- 0x6f, 0x6e, 0x71, 0x75, 0x65, 0x72, 0x65, 0x64, 0x61, 0x72, 0x65, 0x20, 0x73,
- 0x74, 0x69, 0x6c, 0x6c, 0x70, 0x72, 0x6f, 0x63, 0x65, 0x64, 0x75, 0x72, 0x65,
- 0x67, 0x72, 0x6f, 0x77, 0x74, 0x68, 0x20, 0x6f, 0x66, 0x68, 0x65, 0x61, 0x64,
- 0x65, 0x64, 0x20, 0x62, 0x79, 0x45, 0x75, 0x72, 0x6f, 0x70, 0x65, 0x61, 0x6e,
- 0x20, 0x64, 0x69, 0x76, 0x69, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x6d, 0x6f, 0x6c,
- 0x65, 0x63, 0x75, 0x6c, 0x65, 0x73, 0x66, 0x72, 0x61, 0x6e, 0x63, 0x68, 0x69,
- 0x73, 0x65, 0x69, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x74,
- 0x74, 0x72, 0x61, 0x63, 0x74, 0x65, 0x64, 0x63, 0x68, 0x69, 0x6c, 0x64, 0x68,
- 0x6f, 0x6f, 0x64, 0x61, 0x6c, 0x73, 0x6f, 0x20, 0x75, 0x73, 0x65, 0x64, 0x64,
- 0x65, 0x64, 0x69, 0x63, 0x61, 0x74, 0x65, 0x64, 0x73, 0x69, 0x6e, 0x67, 0x61,
- 0x70, 0x6f, 0x72, 0x65, 0x64, 0x65, 0x67, 0x72, 0x65, 0x65, 0x20, 0x6f, 0x66,
- 0x66, 0x61, 0x74, 0x68, 0x65, 0x72, 0x20, 0x6f, 0x66, 0x63, 0x6f, 0x6e, 0x66,
- 0x6c, 0x69, 0x63, 0x74, 0x73, 0x3c, 0x2f, 0x61, 0x3e, 0x3c, 0x2f, 0x70, 0x3e,
- 0x0a, 0x63, 0x61, 0x6d, 0x65, 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x77, 0x65, 0x72,
- 0x65, 0x20, 0x75, 0x73, 0x65, 0x64, 0x6e, 0x6f, 0x74, 0x65, 0x20, 0x74, 0x68,
- 0x61, 0x74, 0x72, 0x65, 0x63, 0x65, 0x69, 0x76, 0x69, 0x6e, 0x67, 0x45, 0x78,
- 0x65, 0x63, 0x75, 0x74, 0x69, 0x76, 0x65, 0x65, 0x76, 0x65, 0x6e, 0x20, 0x6d,
- 0x6f, 0x72, 0x65, 0x61, 0x63, 0x63, 0x65, 0x73, 0x73, 0x20, 0x74, 0x6f, 0x63,
- 0x6f, 0x6d, 0x6d, 0x61, 0x6e, 0x64, 0x65, 0x72, 0x50, 0x6f, 0x6c, 0x69, 0x74,
- 0x69, 0x63, 0x61, 0x6c, 0x6d, 0x75, 0x73, 0x69, 0x63, 0x69, 0x61, 0x6e, 0x73,
- 0x64, 0x65, 0x6c, 0x69, 0x63, 0x69, 0x6f, 0x75, 0x73, 0x70, 0x72, 0x69, 0x73,
- 0x6f, 0x6e, 0x65, 0x72, 0x73, 0x61, 0x64, 0x76, 0x65, 0x6e, 0x74, 0x20, 0x6f,
- 0x66, 0x55, 0x54, 0x46, 0x2d, 0x38, 0x22, 0x20, 0x2f, 0x3e, 0x3c, 0x21, 0x5b,
- 0x43, 0x44, 0x41, 0x54, 0x41, 0x5b, 0x22, 0x3e, 0x43, 0x6f, 0x6e, 0x74, 0x61,
- 0x63, 0x74, 0x53, 0x6f, 0x75, 0x74, 0x68, 0x65, 0x72, 0x6e, 0x20, 0x62, 0x67,
- 0x63, 0x6f, 0x6c, 0x6f, 0x72, 0x3d, 0x22, 0x73, 0x65, 0x72, 0x69, 0x65, 0x73,
- 0x20, 0x6f, 0x66, 0x2e, 0x20, 0x49, 0x74, 0x20, 0x77, 0x61, 0x73, 0x20, 0x69,
- 0x6e, 0x20, 0x45, 0x75, 0x72, 0x6f, 0x70, 0x65, 0x70, 0x65, 0x72, 0x6d, 0x69,
- 0x74, 0x74, 0x65, 0x64, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x65, 0x2e,
- 0x61, 0x70, 0x70, 0x65, 0x61, 0x72, 0x69, 0x6e, 0x67, 0x6f, 0x66, 0x66, 0x69,
- 0x63, 0x69, 0x61, 0x6c, 0x73, 0x73, 0x65, 0x72, 0x69, 0x6f, 0x75, 0x73, 0x6c,
- 0x79, 0x2d, 0x6c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x69, 0x6e, 0x69,
- 0x74, 0x69, 0x61, 0x74, 0x65, 0x64, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x64, 0x69,
- 0x6e, 0x67, 0x6c, 0x6f, 0x6e, 0x67, 0x2d, 0x74, 0x65, 0x72, 0x6d, 0x69, 0x6e,
- 0x66, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x75, 0x63, 0x68, 0x20, 0x74,
- 0x68, 0x61, 0x74, 0x67, 0x65, 0x74, 0x43, 0x6f, 0x6f, 0x6b, 0x69, 0x65, 0x6d,
- 0x61, 0x72, 0x6b, 0x65, 0x64, 0x20, 0x62, 0x79, 0x3c, 0x2f, 0x62, 0x75, 0x74,
- 0x74, 0x6f, 0x6e, 0x3e, 0x69, 0x6d, 0x70, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74,
- 0x62, 0x75, 0x74, 0x20, 0x69, 0x74, 0x20, 0x69, 0x73, 0x69, 0x6e, 0x63, 0x72,
- 0x65, 0x61, 0x73, 0x65, 0x73, 0x64, 0x6f, 0x77, 0x6e, 0x20, 0x74, 0x68, 0x65,
- 0x20, 0x72, 0x65, 0x71, 0x75, 0x69, 0x72, 0x69, 0x6e, 0x67, 0x64, 0x65, 0x70,
- 0x65, 0x6e, 0x64, 0x65, 0x6e, 0x74, 0x2d, 0x2d, 0x3e, 0x0a, 0x3c, 0x21, 0x2d,
- 0x2d, 0x20, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x69, 0x65, 0x77, 0x57, 0x69,
- 0x74, 0x68, 0x20, 0x74, 0x68, 0x65, 0x20, 0x63, 0x6f, 0x70, 0x69, 0x65, 0x73,
- 0x20, 0x6f, 0x66, 0x63, 0x6f, 0x6e, 0x73, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x77,
- 0x61, 0x73, 0x20, 0x62, 0x75, 0x69, 0x6c, 0x74, 0x56, 0x65, 0x6e, 0x65, 0x7a,
- 0x75, 0x65, 0x6c, 0x61, 0x28, 0x66, 0x6f, 0x72, 0x6d, 0x65, 0x72, 0x6c, 0x79,
- 0x74, 0x68, 0x65, 0x20, 0x73, 0x74, 0x61, 0x74, 0x65, 0x70, 0x65, 0x72, 0x73,
- 0x6f, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x74, 0x72, 0x61, 0x74, 0x65, 0x67, 0x69,
- 0x63, 0x66, 0x61, 0x76, 0x6f, 0x75, 0x72, 0x20, 0x6f, 0x66, 0x69, 0x6e, 0x76,
- 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x57, 0x69, 0x6b, 0x69, 0x70, 0x65, 0x64,
- 0x69, 0x61, 0x63, 0x6f, 0x6e, 0x74, 0x69, 0x6e, 0x65, 0x6e, 0x74, 0x76, 0x69,
- 0x72, 0x74, 0x75, 0x61, 0x6c, 0x6c, 0x79, 0x77, 0x68, 0x69, 0x63, 0x68, 0x20,
- 0x77, 0x61, 0x73, 0x70, 0x72, 0x69, 0x6e, 0x63, 0x69, 0x70, 0x6c, 0x65, 0x43,
- 0x6f, 0x6d, 0x70, 0x6c, 0x65, 0x74, 0x65, 0x20, 0x69, 0x64, 0x65, 0x6e, 0x74,
- 0x69, 0x63, 0x61, 0x6c, 0x73, 0x68, 0x6f, 0x77, 0x20, 0x74, 0x68, 0x61, 0x74,
- 0x70, 0x72, 0x69, 0x6d, 0x69, 0x74, 0x69, 0x76, 0x65, 0x61, 0x77, 0x61, 0x79,
- 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x6d, 0x6f, 0x6c, 0x65, 0x63, 0x75, 0x6c, 0x61,
- 0x72, 0x70, 0x72, 0x65, 0x63, 0x69, 0x73, 0x65, 0x6c, 0x79, 0x64, 0x69, 0x73,
- 0x73, 0x6f, 0x6c, 0x76, 0x65, 0x64, 0x55, 0x6e, 0x64, 0x65, 0x72, 0x20, 0x74,
- 0x68, 0x65, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x3d, 0x22, 0x3e, 0x26,
- 0x6e, 0x62, 0x73, 0x70, 0x3b, 0x3c, 0x2f, 0x49, 0x74, 0x20, 0x69, 0x73, 0x20,
- 0x74, 0x68, 0x65, 0x20, 0x54, 0x68, 0x69, 0x73, 0x20, 0x69, 0x73, 0x20, 0x77,
- 0x69, 0x6c, 0x6c, 0x20, 0x68, 0x61, 0x76, 0x65, 0x6f, 0x72, 0x67, 0x61, 0x6e,
- 0x69, 0x73, 0x6d, 0x73, 0x73, 0x6f, 0x6d, 0x65, 0x20, 0x74, 0x69, 0x6d, 0x65,
- 0x46, 0x72, 0x69, 0x65, 0x64, 0x72, 0x69, 0x63, 0x68, 0x77, 0x61, 0x73, 0x20,
- 0x66, 0x69, 0x72, 0x73, 0x74, 0x74, 0x68, 0x65, 0x20, 0x6f, 0x6e, 0x6c, 0x79,
- 0x20, 0x66, 0x61, 0x63, 0x74, 0x20, 0x74, 0x68, 0x61, 0x74, 0x66, 0x6f, 0x72,
- 0x6d, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x70, 0x72, 0x65, 0x63, 0x65, 0x64, 0x69,
- 0x6e, 0x67, 0x54, 0x65, 0x63, 0x68, 0x6e, 0x69, 0x63, 0x61, 0x6c, 0x70, 0x68,
- 0x79, 0x73, 0x69, 0x63, 0x69, 0x73, 0x74, 0x6f, 0x63, 0x63, 0x75, 0x72, 0x73,
- 0x20, 0x69, 0x6e, 0x6e, 0x61, 0x76, 0x69, 0x67, 0x61, 0x74, 0x6f, 0x72, 0x73,
- 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x3e, 0x73, 0x70, 0x61, 0x6e, 0x20,
- 0x69, 0x64, 0x3d, 0x22, 0x73, 0x6f, 0x75, 0x67, 0x68, 0x74, 0x20, 0x74, 0x6f,
- 0x62, 0x65, 0x6c, 0x6f, 0x77, 0x20, 0x74, 0x68, 0x65, 0x73, 0x75, 0x72, 0x76,
- 0x69, 0x76, 0x69, 0x6e, 0x67, 0x7d, 0x3c, 0x2f, 0x73, 0x74, 0x79, 0x6c, 0x65,
- 0x3e, 0x68, 0x69, 0x73, 0x20, 0x64, 0x65, 0x61, 0x74, 0x68, 0x61, 0x73, 0x20,
- 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x63, 0x61, 0x75, 0x73, 0x65, 0x64, 0x20,
- 0x62, 0x79, 0x70, 0x61, 0x72, 0x74, 0x69, 0x61, 0x6c, 0x6c, 0x79, 0x65, 0x78,
- 0x69, 0x73, 0x74, 0x69, 0x6e, 0x67, 0x20, 0x75, 0x73, 0x69, 0x6e, 0x67, 0x20,
- 0x74, 0x68, 0x65, 0x77, 0x61, 0x73, 0x20, 0x67, 0x69, 0x76, 0x65, 0x6e, 0x61,
- 0x20, 0x6c, 0x69, 0x73, 0x74, 0x20, 0x6f, 0x66, 0x6c, 0x65, 0x76, 0x65, 0x6c,
- 0x73, 0x20, 0x6f, 0x66, 0x6e, 0x6f, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66,
- 0x4f, 0x66, 0x66, 0x69, 0x63, 0x69, 0x61, 0x6c, 0x20, 0x64, 0x69, 0x73, 0x6d,
- 0x69, 0x73, 0x73, 0x65, 0x64, 0x73, 0x63, 0x69, 0x65, 0x6e, 0x74, 0x69, 0x73,
- 0x74, 0x72, 0x65, 0x73, 0x65, 0x6d, 0x62, 0x6c, 0x65, 0x73, 0x64, 0x75, 0x70,
- 0x6c, 0x69, 0x63, 0x61, 0x74, 0x65, 0x65, 0x78, 0x70, 0x6c, 0x6f, 0x73, 0x69,
- 0x76, 0x65, 0x72, 0x65, 0x63, 0x6f, 0x76, 0x65, 0x72, 0x65, 0x64, 0x61, 0x6c,
- 0x6c, 0x20, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x67, 0x61, 0x6c, 0x6c, 0x65, 0x72,
- 0x69, 0x65, 0x73, 0x7b, 0x70, 0x61, 0x64, 0x64, 0x69, 0x6e, 0x67, 0x3a, 0x70,
- 0x65, 0x6f, 0x70, 0x6c, 0x65, 0x20, 0x6f, 0x66, 0x72, 0x65, 0x67, 0x69, 0x6f,
- 0x6e, 0x20, 0x6f, 0x66, 0x61, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x65, 0x73,
- 0x61, 0x73, 0x73, 0x6f, 0x63, 0x69, 0x61, 0x74, 0x65, 0x69, 0x6d, 0x67, 0x20,
- 0x61, 0x6c, 0x74, 0x3d, 0x22, 0x69, 0x6e, 0x20, 0x6d, 0x6f, 0x64, 0x65, 0x72,
- 0x6e, 0x73, 0x68, 0x6f, 0x75, 0x6c, 0x64, 0x20, 0x62, 0x65, 0x6d, 0x65, 0x74,
- 0x68, 0x6f, 0x64, 0x20, 0x6f, 0x66, 0x72, 0x65, 0x70, 0x6f, 0x72, 0x74, 0x69,
- 0x6e, 0x67, 0x74, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x6e, 0x65,
- 0x65, 0x64, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x74, 0x68, 0x65, 0x20, 0x47, 0x72,
- 0x65, 0x61, 0x74, 0x72, 0x65, 0x67, 0x61, 0x72, 0x64, 0x69, 0x6e, 0x67, 0x73,
- 0x65, 0x65, 0x6d, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x76, 0x69, 0x65, 0x77, 0x65,
- 0x64, 0x20, 0x61, 0x73, 0x69, 0x6d, 0x70, 0x61, 0x63, 0x74, 0x20, 0x6f, 0x6e,
- 0x69, 0x64, 0x65, 0x61, 0x20, 0x74, 0x68, 0x61, 0x74, 0x74, 0x68, 0x65, 0x20,
- 0x57, 0x6f, 0x72, 0x6c, 0x64, 0x68, 0x65, 0x69, 0x67, 0x68, 0x74, 0x20, 0x6f,
- 0x66, 0x65, 0x78, 0x70, 0x61, 0x6e, 0x64, 0x69, 0x6e, 0x67, 0x54, 0x68, 0x65,
- 0x73, 0x65, 0x20, 0x61, 0x72, 0x65, 0x63, 0x75, 0x72, 0x72, 0x65, 0x6e, 0x74,
- 0x22, 0x3e, 0x63, 0x61, 0x72, 0x65, 0x66, 0x75, 0x6c, 0x6c, 0x79, 0x6d, 0x61,
- 0x69, 0x6e, 0x74, 0x61, 0x69, 0x6e, 0x73, 0x63, 0x68, 0x61, 0x72, 0x67, 0x65,
- 0x20, 0x6f, 0x66, 0x43, 0x6c, 0x61, 0x73, 0x73, 0x69, 0x63, 0x61, 0x6c, 0x61,
- 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x65, 0x64, 0x70, 0x72, 0x65, 0x64, 0x69,
- 0x63, 0x74, 0x65, 0x64, 0x6f, 0x77, 0x6e, 0x65, 0x72, 0x73, 0x68, 0x69, 0x70,
- 0x3c, 0x64, 0x69, 0x76, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x72, 0x69, 0x67, 0x68,
- 0x74, 0x22, 0x3e, 0x0d, 0x0a, 0x72, 0x65, 0x73, 0x69, 0x64, 0x65, 0x6e, 0x63,
- 0x65, 0x6c, 0x65, 0x61, 0x76, 0x65, 0x20, 0x74, 0x68, 0x65, 0x63, 0x6f, 0x6e,
- 0x74, 0x65, 0x6e, 0x74, 0x22, 0x3e, 0x61, 0x72, 0x65, 0x20, 0x6f, 0x66, 0x74,
- 0x65, 0x6e, 0x20, 0x20, 0x7d, 0x29, 0x28, 0x29, 0x3b, 0x0d, 0x0a, 0x70, 0x72,
- 0x6f, 0x62, 0x61, 0x62, 0x6c, 0x79, 0x20, 0x50, 0x72, 0x6f, 0x66, 0x65, 0x73,
- 0x73, 0x6f, 0x72, 0x2d, 0x62, 0x75, 0x74, 0x74, 0x6f, 0x6e, 0x22, 0x20, 0x72,
- 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x64, 0x65, 0x64, 0x73, 0x61, 0x79, 0x73, 0x20,
- 0x74, 0x68, 0x61, 0x74, 0x68, 0x61, 0x64, 0x20, 0x74, 0x6f, 0x20, 0x62, 0x65,
- 0x70, 0x6c, 0x61, 0x63, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x48, 0x75, 0x6e, 0x67,
- 0x61, 0x72, 0x69, 0x61, 0x6e, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x20, 0x6f,
- 0x66, 0x73, 0x65, 0x72, 0x76, 0x65, 0x73, 0x20, 0x61, 0x73, 0x55, 0x6e, 0x69,
- 0x76, 0x65, 0x72, 0x73, 0x61, 0x6c, 0x65, 0x78, 0x65, 0x63, 0x75, 0x74, 0x69,
- 0x6f, 0x6e, 0x61, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x65, 0x66, 0x6f,
- 0x72, 0x20, 0x77, 0x68, 0x69, 0x63, 0x68, 0x69, 0x6e, 0x66, 0x65, 0x63, 0x74,
- 0x69, 0x6f, 0x6e, 0x61, 0x67, 0x72, 0x65, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x68,
- 0x6f, 0x77, 0x65, 0x76, 0x65, 0x72, 0x2c, 0x20, 0x70, 0x6f, 0x70, 0x75, 0x6c,
- 0x61, 0x72, 0x22, 0x3e, 0x70, 0x6c, 0x61, 0x63, 0x65, 0x64, 0x20, 0x6f, 0x6e,
- 0x63, 0x6f, 0x6e, 0x73, 0x74, 0x72, 0x75, 0x63, 0x74, 0x65, 0x6c, 0x65, 0x63,
- 0x74, 0x6f, 0x72, 0x61, 0x6c, 0x73, 0x79, 0x6d, 0x62, 0x6f, 0x6c, 0x20, 0x6f,
- 0x66, 0x69, 0x6e, 0x63, 0x6c, 0x75, 0x64, 0x69, 0x6e, 0x67, 0x72, 0x65, 0x74,
- 0x75, 0x72, 0x6e, 0x20, 0x74, 0x6f, 0x61, 0x72, 0x63, 0x68, 0x69, 0x74, 0x65,
- 0x63, 0x74, 0x43, 0x68, 0x72, 0x69, 0x73, 0x74, 0x69, 0x61, 0x6e, 0x70, 0x72,
- 0x65, 0x76, 0x69, 0x6f, 0x75, 0x73, 0x20, 0x6c, 0x69, 0x76, 0x69, 0x6e, 0x67,
- 0x20, 0x69, 0x6e, 0x65, 0x61, 0x73, 0x69, 0x65, 0x72, 0x20, 0x74, 0x6f, 0x70,
- 0x72, 0x6f, 0x66, 0x65, 0x73, 0x73, 0x6f, 0x72, 0x0a, 0x26, 0x6c, 0x74, 0x3b,
- 0x21, 0x2d, 0x2d, 0x20, 0x65, 0x66, 0x66, 0x65, 0x63, 0x74, 0x20, 0x6f, 0x66,
- 0x61, 0x6e, 0x61, 0x6c, 0x79, 0x74, 0x69, 0x63, 0x73, 0x77, 0x61, 0x73, 0x20,
- 0x74, 0x61, 0x6b, 0x65, 0x6e, 0x77, 0x68, 0x65, 0x72, 0x65, 0x20, 0x74, 0x68,
- 0x65, 0x74, 0x6f, 0x6f, 0x6b, 0x20, 0x6f, 0x76, 0x65, 0x72, 0x62, 0x65, 0x6c,
- 0x69, 0x65, 0x66, 0x20, 0x69, 0x6e, 0x41, 0x66, 0x72, 0x69, 0x6b, 0x61, 0x61,
- 0x6e, 0x73, 0x61, 0x73, 0x20, 0x66, 0x61, 0x72, 0x20, 0x61, 0x73, 0x70, 0x72,
- 0x65, 0x76, 0x65, 0x6e, 0x74, 0x65, 0x64, 0x77, 0x6f, 0x72, 0x6b, 0x20, 0x77,
- 0x69, 0x74, 0x68, 0x61, 0x20, 0x73, 0x70, 0x65, 0x63, 0x69, 0x61, 0x6c, 0x3c,
- 0x66, 0x69, 0x65, 0x6c, 0x64, 0x73, 0x65, 0x74, 0x43, 0x68, 0x72, 0x69, 0x73,
- 0x74, 0x6d, 0x61, 0x73, 0x52, 0x65, 0x74, 0x72, 0x69, 0x65, 0x76, 0x65, 0x64,
- 0x0a, 0x0a, 0x49, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x62, 0x61, 0x63, 0x6b,
- 0x20, 0x69, 0x6e, 0x74, 0x6f, 0x6e, 0x6f, 0x72, 0x74, 0x68, 0x65, 0x61, 0x73,
- 0x74, 0x6d, 0x61, 0x67, 0x61, 0x7a, 0x69, 0x6e, 0x65, 0x73, 0x3e, 0x3c, 0x73,
- 0x74, 0x72, 0x6f, 0x6e, 0x67, 0x3e, 0x63, 0x6f, 0x6d, 0x6d, 0x69, 0x74, 0x74,
- 0x65, 0x65, 0x67, 0x6f, 0x76, 0x65, 0x72, 0x6e, 0x69, 0x6e, 0x67, 0x67, 0x72,
- 0x6f, 0x75, 0x70, 0x73, 0x20, 0x6f, 0x66, 0x73, 0x74, 0x6f, 0x72, 0x65, 0x64,
- 0x20, 0x69, 0x6e, 0x65, 0x73, 0x74, 0x61, 0x62, 0x6c, 0x69, 0x73, 0x68, 0x61,
- 0x20, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x6c, 0x69, 0x74, 0x73, 0x20, 0x66,
- 0x69, 0x72, 0x73, 0x74, 0x74, 0x68, 0x65, 0x69, 0x72, 0x20, 0x6f, 0x77, 0x6e,
- 0x70, 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x74, 0x65, 0x64, 0x61, 0x6e, 0x20, 0x6f,
- 0x62, 0x6a, 0x65, 0x63, 0x74, 0x43, 0x61, 0x72, 0x69, 0x62, 0x62, 0x65, 0x61,
- 0x6e, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x20, 0x74, 0x68, 0x65, 0x64, 0x69, 0x73,
- 0x74, 0x72, 0x69, 0x63, 0x74, 0x73, 0x77, 0x69, 0x73, 0x63, 0x6f, 0x6e, 0x73,
- 0x69, 0x6e, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x3b, 0x20,
- 0x77, 0x69, 0x64, 0x74, 0x68, 0x3a, 0x20, 0x69, 0x6e, 0x68, 0x61, 0x62, 0x69,
- 0x74, 0x65, 0x64, 0x53, 0x6f, 0x63, 0x69, 0x61, 0x6c, 0x69, 0x73, 0x74, 0x4a,
- 0x61, 0x6e, 0x75, 0x61, 0x72, 0x79, 0x20, 0x31, 0x3c, 0x2f, 0x66, 0x6f, 0x6f,
- 0x74, 0x65, 0x72, 0x3e, 0x73, 0x69, 0x6d, 0x69, 0x6c, 0x61, 0x72, 0x6c, 0x79,
- 0x63, 0x68, 0x6f, 0x69, 0x63, 0x65, 0x20, 0x6f, 0x66, 0x74, 0x68, 0x65, 0x20,
- 0x73, 0x61, 0x6d, 0x65, 0x20, 0x73, 0x70, 0x65, 0x63, 0x69, 0x66, 0x69, 0x63,
- 0x20, 0x62, 0x75, 0x73, 0x69, 0x6e, 0x65, 0x73, 0x73, 0x20, 0x54, 0x68, 0x65,
- 0x20, 0x66, 0x69, 0x72, 0x73, 0x74, 0x2e, 0x6c, 0x65, 0x6e, 0x67, 0x74, 0x68,
- 0x3b, 0x20, 0x64, 0x65, 0x73, 0x69, 0x72, 0x65, 0x20, 0x74, 0x6f, 0x64, 0x65,
- 0x61, 0x6c, 0x20, 0x77, 0x69, 0x74, 0x68, 0x73, 0x69, 0x6e, 0x63, 0x65, 0x20,
- 0x74, 0x68, 0x65, 0x75, 0x73, 0x65, 0x72, 0x41, 0x67, 0x65, 0x6e, 0x74, 0x63,
- 0x6f, 0x6e, 0x63, 0x65, 0x69, 0x76, 0x65, 0x64, 0x69, 0x6e, 0x64, 0x65, 0x78,
- 0x2e, 0x70, 0x68, 0x70, 0x61, 0x73, 0x20, 0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b,
- 0x65, 0x6e, 0x67, 0x61, 0x67, 0x65, 0x20, 0x69, 0x6e, 0x72, 0x65, 0x63, 0x65,
- 0x6e, 0x74, 0x6c, 0x79, 0x2c, 0x66, 0x65, 0x77, 0x20, 0x79, 0x65, 0x61, 0x72,
- 0x73, 0x77, 0x65, 0x72, 0x65, 0x20, 0x61, 0x6c, 0x73, 0x6f, 0x0a, 0x3c, 0x68,
- 0x65, 0x61, 0x64, 0x3e, 0x0a, 0x3c, 0x65, 0x64, 0x69, 0x74, 0x65, 0x64, 0x20,
- 0x62, 0x79, 0x61, 0x72, 0x65, 0x20, 0x6b, 0x6e, 0x6f, 0x77, 0x6e, 0x63, 0x69,
- 0x74, 0x69, 0x65, 0x73, 0x20, 0x69, 0x6e, 0x61, 0x63, 0x63, 0x65, 0x73, 0x73,
- 0x6b, 0x65, 0x79, 0x63, 0x6f, 0x6e, 0x64, 0x65, 0x6d, 0x6e, 0x65, 0x64, 0x61,
- 0x6c, 0x73, 0x6f, 0x20, 0x68, 0x61, 0x76, 0x65, 0x73, 0x65, 0x72, 0x76, 0x69,
- 0x63, 0x65, 0x73, 0x2c, 0x66, 0x61, 0x6d, 0x69, 0x6c, 0x79, 0x20, 0x6f, 0x66,
- 0x53, 0x63, 0x68, 0x6f, 0x6f, 0x6c, 0x20, 0x6f, 0x66, 0x63, 0x6f, 0x6e, 0x76,
- 0x65, 0x72, 0x74, 0x65, 0x64, 0x6e, 0x61, 0x74, 0x75, 0x72, 0x65, 0x20, 0x6f,
- 0x66, 0x20, 0x6c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x6d, 0x69, 0x6e,
- 0x69, 0x73, 0x74, 0x65, 0x72, 0x73, 0x3c, 0x2f, 0x6f, 0x62, 0x6a, 0x65, 0x63,
- 0x74, 0x3e, 0x74, 0x68, 0x65, 0x72, 0x65, 0x20, 0x69, 0x73, 0x20, 0x61, 0x20,
- 0x70, 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x72, 0x73, 0x65, 0x71, 0x75, 0x65, 0x6e,
- 0x63, 0x65, 0x73, 0x61, 0x64, 0x76, 0x6f, 0x63, 0x61, 0x74, 0x65, 0x64, 0x54,
- 0x68, 0x65, 0x79, 0x20, 0x77, 0x65, 0x72, 0x65, 0x61, 0x6e, 0x79, 0x20, 0x6f,
- 0x74, 0x68, 0x65, 0x72, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x3d,
- 0x65, 0x6e, 0x74, 0x65, 0x72, 0x20, 0x74, 0x68, 0x65, 0x6d, 0x75, 0x63, 0x68,
- 0x20, 0x6d, 0x6f, 0x72, 0x65, 0x72, 0x65, 0x66, 0x6c, 0x65, 0x63, 0x74, 0x65,
- 0x64, 0x77, 0x61, 0x73, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x6f, 0x72, 0x69,
- 0x67, 0x69, 0x6e, 0x61, 0x6c, 0x20, 0x61, 0x20, 0x74, 0x79, 0x70, 0x69, 0x63,
- 0x61, 0x6c, 0x77, 0x68, 0x65, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x79, 0x65, 0x6e,
- 0x67, 0x69, 0x6e, 0x65, 0x65, 0x72, 0x73, 0x63, 0x6f, 0x75, 0x6c, 0x64, 0x20,
- 0x6e, 0x6f, 0x74, 0x72, 0x65, 0x73, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x73, 0x77,
- 0x65, 0x64, 0x6e, 0x65, 0x73, 0x64, 0x61, 0x79, 0x74, 0x68, 0x65, 0x20, 0x74,
- 0x68, 0x69, 0x72, 0x64, 0x20, 0x70, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x74, 0x73,
- 0x4a, 0x61, 0x6e, 0x75, 0x61, 0x72, 0x79, 0x20, 0x32, 0x77, 0x68, 0x61, 0x74,
- 0x20, 0x74, 0x68, 0x65, 0x79, 0x61, 0x20, 0x63, 0x65, 0x72, 0x74, 0x61, 0x69,
- 0x6e, 0x72, 0x65, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x70, 0x72, 0x6f,
- 0x63, 0x65, 0x73, 0x73, 0x6f, 0x72, 0x61, 0x66, 0x74, 0x65, 0x72, 0x20, 0x68,
- 0x69, 0x73, 0x74, 0x68, 0x65, 0x20, 0x6c, 0x61, 0x73, 0x74, 0x20, 0x63, 0x6f,
- 0x6e, 0x74, 0x61, 0x69, 0x6e, 0x65, 0x64, 0x22, 0x3e, 0x3c, 0x2f, 0x64, 0x69,
- 0x76, 0x3e, 0x0a, 0x3c, 0x2f, 0x61, 0x3e, 0x3c, 0x2f, 0x74, 0x64, 0x3e, 0x64,
- 0x65, 0x70, 0x65, 0x6e, 0x64, 0x20, 0x6f, 0x6e, 0x73, 0x65, 0x61, 0x72, 0x63,
- 0x68, 0x22, 0x3e, 0x0a, 0x70, 0x69, 0x65, 0x63, 0x65, 0x73, 0x20, 0x6f, 0x66,
- 0x63, 0x6f, 0x6d, 0x70, 0x65, 0x74, 0x69, 0x6e, 0x67, 0x52, 0x65, 0x66, 0x65,
- 0x72, 0x65, 0x6e, 0x63, 0x65, 0x74, 0x65, 0x6e, 0x6e, 0x65, 0x73, 0x73, 0x65,
- 0x65, 0x77, 0x68, 0x69, 0x63, 0x68, 0x20, 0x68, 0x61, 0x73, 0x20, 0x76, 0x65,
- 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x3d, 0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e, 0x3e,
- 0x20, 0x3c, 0x3c, 0x2f, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x3e, 0x67, 0x69,
- 0x76, 0x65, 0x73, 0x20, 0x74, 0x68, 0x65, 0x68, 0x69, 0x73, 0x74, 0x6f, 0x72,
- 0x69, 0x61, 0x6e, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3d, 0x22, 0x22, 0x3e, 0x70,
- 0x61, 0x64, 0x64, 0x69, 0x6e, 0x67, 0x3a, 0x30, 0x76, 0x69, 0x65, 0x77, 0x20,
- 0x74, 0x68, 0x61, 0x74, 0x74, 0x6f, 0x67, 0x65, 0x74, 0x68, 0x65, 0x72, 0x2c,
- 0x74, 0x68, 0x65, 0x20, 0x6d, 0x6f, 0x73, 0x74, 0x20, 0x77, 0x61, 0x73, 0x20,
- 0x66, 0x6f, 0x75, 0x6e, 0x64, 0x73, 0x75, 0x62, 0x73, 0x65, 0x74, 0x20, 0x6f,
- 0x66, 0x61, 0x74, 0x74, 0x61, 0x63, 0x6b, 0x20, 0x6f, 0x6e, 0x63, 0x68, 0x69,
- 0x6c, 0x64, 0x72, 0x65, 0x6e, 0x2c, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x73, 0x20,
- 0x6f, 0x66, 0x70, 0x65, 0x72, 0x73, 0x6f, 0x6e, 0x61, 0x6c, 0x20, 0x70, 0x6f,
- 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x3a, 0x61, 0x6c, 0x6c, 0x65, 0x67, 0x65,
- 0x64, 0x6c, 0x79, 0x43, 0x6c, 0x65, 0x76, 0x65, 0x6c, 0x61, 0x6e, 0x64, 0x77,
- 0x61, 0x73, 0x20, 0x6c, 0x61, 0x74, 0x65, 0x72, 0x61, 0x6e, 0x64, 0x20, 0x61,
- 0x66, 0x74, 0x65, 0x72, 0x61, 0x72, 0x65, 0x20, 0x67, 0x69, 0x76, 0x65, 0x6e,
- 0x77, 0x61, 0x73, 0x20, 0x73, 0x74, 0x69, 0x6c, 0x6c, 0x73, 0x63, 0x72, 0x6f,
- 0x6c, 0x6c, 0x69, 0x6e, 0x67, 0x64, 0x65, 0x73, 0x69, 0x67, 0x6e, 0x20, 0x6f,
- 0x66, 0x6d, 0x61, 0x6b, 0x65, 0x73, 0x20, 0x74, 0x68, 0x65, 0x6d, 0x75, 0x63,
- 0x68, 0x20, 0x6c, 0x65, 0x73, 0x73, 0x41, 0x6d, 0x65, 0x72, 0x69, 0x63, 0x61,
- 0x6e, 0x73, 0x2e, 0x0a, 0x0a, 0x41, 0x66, 0x74, 0x65, 0x72, 0x20, 0x2c, 0x20,
- 0x62, 0x75, 0x74, 0x20, 0x74, 0x68, 0x65, 0x4d, 0x75, 0x73, 0x65, 0x75, 0x6d,
- 0x20, 0x6f, 0x66, 0x6c, 0x6f, 0x75, 0x69, 0x73, 0x69, 0x61, 0x6e, 0x61, 0x28,
- 0x66, 0x72, 0x6f, 0x6d, 0x20, 0x74, 0x68, 0x65, 0x6d, 0x69, 0x6e, 0x6e, 0x65,
- 0x73, 0x6f, 0x74, 0x61, 0x70, 0x61, 0x72, 0x74, 0x69, 0x63, 0x6c, 0x65, 0x73,
- 0x61, 0x20, 0x70, 0x72, 0x6f, 0x63, 0x65, 0x73, 0x73, 0x44, 0x6f, 0x6d, 0x69,
- 0x6e, 0x69, 0x63, 0x61, 0x6e, 0x76, 0x6f, 0x6c, 0x75, 0x6d, 0x65, 0x20, 0x6f,
- 0x66, 0x72, 0x65, 0x74, 0x75, 0x72, 0x6e, 0x69, 0x6e, 0x67, 0x64, 0x65, 0x66,
- 0x65, 0x6e, 0x73, 0x69, 0x76, 0x65, 0x30, 0x30, 0x70, 0x78, 0x7c, 0x72, 0x69,
- 0x67, 0x68, 0x6d, 0x61, 0x64, 0x65, 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x6d, 0x6f,
- 0x75, 0x73, 0x65, 0x6f, 0x76, 0x65, 0x72, 0x22, 0x20, 0x73, 0x74, 0x79, 0x6c,
- 0x65, 0x3d, 0x22, 0x73, 0x74, 0x61, 0x74, 0x65, 0x73, 0x20, 0x6f, 0x66, 0x28,
- 0x77, 0x68, 0x69, 0x63, 0x68, 0x20, 0x69, 0x73, 0x63, 0x6f, 0x6e, 0x74, 0x69,
- 0x6e, 0x75, 0x65, 0x73, 0x46, 0x72, 0x61, 0x6e, 0x63, 0x69, 0x73, 0x63, 0x6f,
- 0x62, 0x75, 0x69, 0x6c, 0x64, 0x69, 0x6e, 0x67, 0x20, 0x77, 0x69, 0x74, 0x68,
- 0x6f, 0x75, 0x74, 0x20, 0x61, 0x77, 0x69, 0x74, 0x68, 0x20, 0x73, 0x6f, 0x6d,
- 0x65, 0x77, 0x68, 0x6f, 0x20, 0x77, 0x6f, 0x75, 0x6c, 0x64, 0x61, 0x20, 0x66,
- 0x6f, 0x72, 0x6d, 0x20, 0x6f, 0x66, 0x61, 0x20, 0x70, 0x61, 0x72, 0x74, 0x20,
- 0x6f, 0x66, 0x62, 0x65, 0x66, 0x6f, 0x72, 0x65, 0x20, 0x69, 0x74, 0x6b, 0x6e,
- 0x6f, 0x77, 0x6e, 0x20, 0x61, 0x73, 0x20, 0x20, 0x53, 0x65, 0x72, 0x76, 0x69,
- 0x63, 0x65, 0x73, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x61,
- 0x6e, 0x64, 0x20, 0x6f, 0x66, 0x74, 0x65, 0x6e, 0x6d, 0x65, 0x61, 0x73, 0x75,
- 0x72, 0x69, 0x6e, 0x67, 0x61, 0x6e, 0x64, 0x20, 0x69, 0x74, 0x20, 0x69, 0x73,
- 0x70, 0x61, 0x70, 0x65, 0x72, 0x62, 0x61, 0x63, 0x6b, 0x76, 0x61, 0x6c, 0x75,
- 0x65, 0x73, 0x20, 0x6f, 0x66, 0x0d, 0x0a, 0x3c, 0x74, 0x69, 0x74, 0x6c, 0x65,
- 0x3e, 0x3d, 0x20, 0x77, 0x69, 0x6e, 0x64, 0x6f, 0x77, 0x2e, 0x64, 0x65, 0x74,
- 0x65, 0x72, 0x6d, 0x69, 0x6e, 0x65, 0x65, 0x72, 0x26, 0x71, 0x75, 0x6f, 0x74,
- 0x3b, 0x20, 0x70, 0x6c, 0x61, 0x79, 0x65, 0x64, 0x20, 0x62, 0x79, 0x61, 0x6e,
- 0x64, 0x20, 0x65, 0x61, 0x72, 0x6c, 0x79, 0x3c, 0x2f, 0x63, 0x65, 0x6e, 0x74,
- 0x65, 0x72, 0x3e, 0x66, 0x72, 0x6f, 0x6d, 0x20, 0x74, 0x68, 0x69, 0x73, 0x74,
- 0x68, 0x65, 0x20, 0x74, 0x68, 0x72, 0x65, 0x65, 0x70, 0x6f, 0x77, 0x65, 0x72,
- 0x20, 0x61, 0x6e, 0x64, 0x6f, 0x66, 0x20, 0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b,
- 0x69, 0x6e, 0x6e, 0x65, 0x72, 0x48, 0x54, 0x4d, 0x4c, 0x3c, 0x61, 0x20, 0x68,
- 0x72, 0x65, 0x66, 0x3d, 0x22, 0x79, 0x3a, 0x69, 0x6e, 0x6c, 0x69, 0x6e, 0x65,
- 0x3b, 0x43, 0x68, 0x75, 0x72, 0x63, 0x68, 0x20, 0x6f, 0x66, 0x74, 0x68, 0x65,
- 0x20, 0x65, 0x76, 0x65, 0x6e, 0x74, 0x76, 0x65, 0x72, 0x79, 0x20, 0x68, 0x69,
- 0x67, 0x68, 0x6f, 0x66, 0x66, 0x69, 0x63, 0x69, 0x61, 0x6c, 0x20, 0x2d, 0x68,
- 0x65, 0x69, 0x67, 0x68, 0x74, 0x3a, 0x20, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e,
- 0x74, 0x3d, 0x22, 0x2f, 0x63, 0x67, 0x69, 0x2d, 0x62, 0x69, 0x6e, 0x2f, 0x74,
- 0x6f, 0x20, 0x63, 0x72, 0x65, 0x61, 0x74, 0x65, 0x61, 0x66, 0x72, 0x69, 0x6b,
- 0x61, 0x61, 0x6e, 0x73, 0x65, 0x73, 0x70, 0x65, 0x72, 0x61, 0x6e, 0x74, 0x6f,
- 0x66, 0x72, 0x61, 0x6e, 0xc3, 0xa7, 0x61, 0x69, 0x73, 0x6c, 0x61, 0x74, 0x76,
- 0x69, 0x65, 0xc5, 0xa1, 0x75, 0x6c, 0x69, 0x65, 0x74, 0x75, 0x76, 0x69, 0xc5,
- 0xb3, 0xc4, 0x8c, 0x65, 0xc5, 0xa1, 0x74, 0x69, 0x6e, 0x61, 0xc4, 0x8d, 0x65,
- 0xc5, 0xa1, 0x74, 0x69, 0x6e, 0x61, 0xe0, 0xb9, 0x84, 0xe0, 0xb8, 0x97, 0xe0,
- 0xb8, 0xa2, 0xe6, 0x97, 0xa5, 0xe6, 0x9c, 0xac, 0xe8, 0xaa, 0x9e, 0xe7, 0xae,
- 0x80, 0xe4, 0xbd, 0x93, 0xe5, 0xad, 0x97, 0xe7, 0xb9, 0x81, 0xe9, 0xab, 0x94,
- 0xe5, 0xad, 0x97, 0xed, 0x95, 0x9c, 0xea, 0xb5, 0xad, 0xec, 0x96, 0xb4, 0xe4,
- 0xb8, 0xba, 0xe4, 0xbb, 0x80, 0xe4, 0xb9, 0x88, 0xe8, 0xae, 0xa1, 0xe7, 0xae,
- 0x97, 0xe6, 0x9c, 0xba, 0xe7, 0xac, 0x94, 0xe8, 0xae, 0xb0, 0xe6, 0x9c, 0xac,
- 0xe8, 0xa8, 0x8e, 0xe8, 0xab, 0x96, 0xe5, 0x8d, 0x80, 0xe6, 0x9c, 0x8d, 0xe5,
- 0x8a, 0xa1, 0xe5, 0x99, 0xa8, 0xe4, 0xba, 0x92, 0xe8, 0x81, 0x94, 0xe7, 0xbd,
- 0x91, 0xe6, 0x88, 0xbf, 0xe5, 0x9c, 0xb0, 0xe4, 0xba, 0xa7, 0xe4, 0xbf, 0xb1,
- 0xe4, 0xb9, 0x90, 0xe9, 0x83, 0xa8, 0xe5, 0x87, 0xba, 0xe7, 0x89, 0x88, 0xe7,
- 0xa4, 0xbe, 0xe6, 0x8e, 0x92, 0xe8, 0xa1, 0x8c, 0xe6, 0xa6, 0x9c, 0xe9, 0x83,
- 0xa8, 0xe8, 0x90, 0xbd, 0xe6, 0xa0, 0xbc, 0xe8, 0xbf, 0x9b, 0xe4, 0xb8, 0x80,
- 0xe6, 0xad, 0xa5, 0xe6, 0x94, 0xaf, 0xe4, 0xbb, 0x98, 0xe5, 0xae, 0x9d, 0xe9,
- 0xaa, 0x8c, 0xe8, 0xaf, 0x81, 0xe7, 0xa0, 0x81, 0xe5, 0xa7, 0x94, 0xe5, 0x91,
- 0x98, 0xe4, 0xbc, 0x9a, 0xe6, 0x95, 0xb0, 0xe6, 0x8d, 0xae, 0xe5, 0xba, 0x93,
- 0xe6, 0xb6, 0x88, 0xe8, 0xb4, 0xb9, 0xe8, 0x80, 0x85, 0xe5, 0x8a, 0x9e, 0xe5,
- 0x85, 0xac, 0xe5, 0xae, 0xa4, 0xe8, 0xae, 0xa8, 0xe8, 0xae, 0xba, 0xe5, 0x8c,
- 0xba, 0xe6, 0xb7, 0xb1, 0xe5, 0x9c, 0xb3, 0xe5, 0xb8, 0x82, 0xe6, 0x92, 0xad,
- 0xe6, 0x94, 0xbe, 0xe5, 0x99, 0xa8, 0xe5, 0x8c, 0x97, 0xe4, 0xba, 0xac, 0xe5,
- 0xb8, 0x82, 0xe5, 0xa4, 0xa7, 0xe5, 0xad, 0xa6, 0xe7, 0x94, 0x9f, 0xe8, 0xb6,
- 0x8a, 0xe6, 0x9d, 0xa5, 0xe8, 0xb6, 0x8a, 0xe7, 0xae, 0xa1, 0xe7, 0x90, 0x86,
- 0xe5, 0x91, 0x98, 0xe4, 0xbf, 0xa1, 0xe6, 0x81, 0xaf, 0xe7, 0xbd, 0x91, 0x73,
- 0x65, 0x72, 0x76, 0x69, 0x63, 0x69, 0x6f, 0x73, 0x61, 0x72, 0x74, 0xc3, 0xad,
- 0x63, 0x75, 0x6c, 0x6f, 0x61, 0x72, 0x67, 0x65, 0x6e, 0x74, 0x69, 0x6e, 0x61,
- 0x62, 0x61, 0x72, 0x63, 0x65, 0x6c, 0x6f, 0x6e, 0x61, 0x63, 0x75, 0x61, 0x6c,
- 0x71, 0x75, 0x69, 0x65, 0x72, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x63, 0x61, 0x64,
- 0x6f, 0x70, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x74, 0x6f, 0x73, 0x70, 0x6f, 0x6c,
- 0xc3, 0xad, 0x74, 0x69, 0x63, 0x61, 0x72, 0x65, 0x73, 0x70, 0x75, 0x65, 0x73,
- 0x74, 0x61, 0x77, 0x69, 0x6b, 0x69, 0x70, 0x65, 0x64, 0x69, 0x61, 0x73, 0x69,
- 0x67, 0x75, 0x69, 0x65, 0x6e, 0x74, 0x65, 0x62, 0xc3, 0xba, 0x73, 0x71, 0x75,
- 0x65, 0x64, 0x61, 0x63, 0x6f, 0x6d, 0x75, 0x6e, 0x69, 0x64, 0x61, 0x64, 0x73,
- 0x65, 0x67, 0x75, 0x72, 0x69, 0x64, 0x61, 0x64, 0x70, 0x72, 0x69, 0x6e, 0x63,
- 0x69, 0x70, 0x61, 0x6c, 0x70, 0x72, 0x65, 0x67, 0x75, 0x6e, 0x74, 0x61, 0x73,
- 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x69, 0x64, 0x6f, 0x72, 0x65, 0x73, 0x70,
- 0x6f, 0x6e, 0x64, 0x65, 0x72, 0x76, 0x65, 0x6e, 0x65, 0x7a, 0x75, 0x65, 0x6c,
- 0x61, 0x70, 0x72, 0x6f, 0x62, 0x6c, 0x65, 0x6d, 0x61, 0x73, 0x64, 0x69, 0x63,
- 0x69, 0x65, 0x6d, 0x62, 0x72, 0x65, 0x72, 0x65, 0x6c, 0x61, 0x63, 0x69, 0xc3,
- 0xb3, 0x6e, 0x6e, 0x6f, 0x76, 0x69, 0x65, 0x6d, 0x62, 0x72, 0x65, 0x73, 0x69,
- 0x6d, 0x69, 0x6c, 0x61, 0x72, 0x65, 0x73, 0x70, 0x72, 0x6f, 0x79, 0x65, 0x63,
- 0x74, 0x6f, 0x73, 0x70, 0x72, 0x6f, 0x67, 0x72, 0x61, 0x6d, 0x61, 0x73, 0x69,
- 0x6e, 0x73, 0x74, 0x69, 0x74, 0x75, 0x74, 0x6f, 0x61, 0x63, 0x74, 0x69, 0x76,
- 0x69, 0x64, 0x61, 0x64, 0x65, 0x6e, 0x63, 0x75, 0x65, 0x6e, 0x74, 0x72, 0x61,
- 0x65, 0x63, 0x6f, 0x6e, 0x6f, 0x6d, 0xc3, 0xad, 0x61, 0x69, 0x6d, 0xc3, 0xa1,
- 0x67, 0x65, 0x6e, 0x65, 0x73, 0x63, 0x6f, 0x6e, 0x74, 0x61, 0x63, 0x74, 0x61,
- 0x72, 0x64, 0x65, 0x73, 0x63, 0x61, 0x72, 0x67, 0x61, 0x72, 0x6e, 0x65, 0x63,
- 0x65, 0x73, 0x61, 0x72, 0x69, 0x6f, 0x61, 0x74, 0x65, 0x6e, 0x63, 0x69, 0xc3,
- 0xb3, 0x6e, 0x74, 0x65, 0x6c, 0xc3, 0xa9, 0x66, 0x6f, 0x6e, 0x6f, 0x63, 0x6f,
- 0x6d, 0x69, 0x73, 0x69, 0xc3, 0xb3, 0x6e, 0x63, 0x61, 0x6e, 0x63, 0x69, 0x6f,
- 0x6e, 0x65, 0x73, 0x63, 0x61, 0x70, 0x61, 0x63, 0x69, 0x64, 0x61, 0x64, 0x65,
- 0x6e, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x61, 0x72, 0x61, 0x6e, 0xc3, 0xa1, 0x6c,
- 0x69, 0x73, 0x69, 0x73, 0x66, 0x61, 0x76, 0x6f, 0x72, 0x69, 0x74, 0x6f, 0x73,
- 0x74, 0xc3, 0xa9, 0x72, 0x6d, 0x69, 0x6e, 0x6f, 0x73, 0x70, 0x72, 0x6f, 0x76,
- 0x69, 0x6e, 0x63, 0x69, 0x61, 0x65, 0x74, 0x69, 0x71, 0x75, 0x65, 0x74, 0x61,
- 0x73, 0x65, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x6f, 0x73, 0x66, 0x75, 0x6e,
- 0x63, 0x69, 0x6f, 0x6e, 0x65, 0x73, 0x72, 0x65, 0x73, 0x75, 0x6c, 0x74, 0x61,
- 0x64, 0x6f, 0x63, 0x61, 0x72, 0xc3, 0xa1, 0x63, 0x74, 0x65, 0x72, 0x70, 0x72,
- 0x6f, 0x70, 0x69, 0x65, 0x64, 0x61, 0x64, 0x70, 0x72, 0x69, 0x6e, 0x63, 0x69,
- 0x70, 0x69, 0x6f, 0x6e, 0x65, 0x63, 0x65, 0x73, 0x69, 0x64, 0x61, 0x64, 0x6d,
- 0x75, 0x6e, 0x69, 0x63, 0x69, 0x70, 0x61, 0x6c, 0x63, 0x72, 0x65, 0x61, 0x63,
- 0x69, 0xc3, 0xb3, 0x6e, 0x64, 0x65, 0x73, 0x63, 0x61, 0x72, 0x67, 0x61, 0x73,
- 0x70, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x63, 0x69, 0x61, 0x63, 0x6f, 0x6d, 0x65,
- 0x72, 0x63, 0x69, 0x61, 0x6c, 0x6f, 0x70, 0x69, 0x6e, 0x69, 0x6f, 0x6e, 0x65,
- 0x73, 0x65, 0x6a, 0x65, 0x72, 0x63, 0x69, 0x63, 0x69, 0x6f, 0x65, 0x64, 0x69,
- 0x74, 0x6f, 0x72, 0x69, 0x61, 0x6c, 0x73, 0x61, 0x6c, 0x61, 0x6d, 0x61, 0x6e,
- 0x63, 0x61, 0x67, 0x6f, 0x6e, 0x7a, 0xc3, 0xa1, 0x6c, 0x65, 0x7a, 0x64, 0x6f,
- 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x6f, 0x70, 0x65, 0x6c, 0xc3, 0xad, 0x63,
- 0x75, 0x6c, 0x61, 0x72, 0x65, 0x63, 0x69, 0x65, 0x6e, 0x74, 0x65, 0x73, 0x67,
- 0x65, 0x6e, 0x65, 0x72, 0x61, 0x6c, 0x65, 0x73, 0x74, 0x61, 0x72, 0x72, 0x61,
- 0x67, 0x6f, 0x6e, 0x61, 0x70, 0x72, 0xc3, 0xa1, 0x63, 0x74, 0x69, 0x63, 0x61,
- 0x6e, 0x6f, 0x76, 0x65, 0x64, 0x61, 0x64, 0x65, 0x73, 0x70, 0x72, 0x6f, 0x70,
- 0x75, 0x65, 0x73, 0x74, 0x61, 0x70, 0x61, 0x63, 0x69, 0x65, 0x6e, 0x74, 0x65,
- 0x73, 0x74, 0xc3, 0xa9, 0x63, 0x6e, 0x69, 0x63, 0x61, 0x73, 0x6f, 0x62, 0x6a,
- 0x65, 0x74, 0x69, 0x76, 0x6f, 0x73, 0x63, 0x6f, 0x6e, 0x74, 0x61, 0x63, 0x74,
- 0x6f, 0x73, 0xe0, 0xa4, 0xae, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x82, 0xe0, 0xa4,
- 0xb2, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0x8f, 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x88,
- 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xbe, 0xe0,
- 0xa4, 0xb8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa5, 0xe0, 0xa4, 0x8f, 0xe0, 0xa4,
- 0xb5, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x87,
- 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x88, 0xe0, 0xa4, 0x95, 0xe0,
- 0xa5, 0x81, 0xe0, 0xa4, 0x9b, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4,
- 0xbe, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa6, 0xe0, 0xa4, 0x95,
- 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xad, 0xe0,
- 0xa5, 0x80, 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0x8f, 0xe0, 0xa4,
- 0xb0, 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xae, 0xe0, 0xa5, 0x88,
- 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xa6, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xa8, 0xe0,
- 0xa4, 0xac, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa4, 0x64, 0x69, 0x70, 0x6c, 0x6f,
- 0x64, 0x6f, 0x63, 0x73, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xaf,
- 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x82, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xa8, 0xe0,
- 0xa4, 0xbe, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4,
- 0xbe, 0xe0, 0xa4, 0xab, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0x94,
- 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xb0, 0xe0,
- 0xa4, 0xb9, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x97, 0xe0, 0xa4,
- 0xb9, 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0x86, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xbe,
- 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xa6, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb6, 0xe0,
- 0xa4, 0xb9, 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0x88, 0xe0, 0xa4, 0x96, 0xe0, 0xa5,
- 0x87, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xa6, 0xe0, 0xa4, 0xbf,
- 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xb5, 0xe0,
- 0xa5, 0x87, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x80, 0xe0, 0xa4,
- 0xa8, 0xe0, 0xa4, 0xac, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0x9a, 0xe0, 0xa4, 0xae,
- 0xe0, 0xa5, 0x8c, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xbe, 0xe0,
- 0xa4, 0xb2, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x96, 0xe0, 0xa4,
- 0x9c, 0xe0, 0xa5, 0x89, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xa6,
- 0xe0, 0xa4, 0xa6, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xa5, 0xe0, 0xa4, 0xbe, 0xe0,
- 0xa4, 0xa8, 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xb6, 0xe0, 0xa4,
- 0xb9, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0x85, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0x97,
- 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xad, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xa8, 0xe0,
- 0xa4, 0x97, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4,
- 0xb8, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0x95,
- 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0x8f, 0xe0, 0xa4, 0x89, 0xe0, 0xa4, 0xb8, 0xe0,
- 0xa5, 0x87, 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0xaf, 0xe0, 0xa5, 0x80, 0xe0, 0xa4,
- 0xb9, 0xe0, 0xa5, 0x82, 0xe0, 0xa4, 0x81, 0xe0, 0xa4, 0x86, 0xe0, 0xa4, 0x97,
- 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x9f, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xae, 0xe0,
- 0xa4, 0x96, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0x95, 0xe0, 0xa4,
- 0xbe, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0x85, 0xe0, 0xa4, 0xad, 0xe0, 0xa5, 0x80,
- 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0xaf, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xa4, 0xe0,
- 0xa5, 0x81, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xb5, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4,
- 0x9f, 0xe0, 0xa4, 0xa6, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0x85,
- 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0x90, 0xe0, 0xa4, 0xb8, 0xe0,
- 0xa5, 0x87, 0xe0, 0xa4, 0xae, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4,
- 0xb2, 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xbe,
- 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0x8a, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xb0, 0xe0,
- 0xa4, 0x9a, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0x90, 0xe0, 0xa4,
- 0xb8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa6, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb0,
- 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xa6, 0xe0,
- 0xa4, 0xbf, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0x82, 0xe0, 0xa4,
- 0xa6, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb9,
- 0xe0, 0xa5, 0x82, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xbe, 0xe0,
- 0xa4, 0x96, 0xe0, 0xa4, 0x9c, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4,
- 0xac, 0xe0, 0xa4, 0x9f, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xbf,
- 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0x87, 0xe0, 0xa4, 0xb8, 0xe0, 0xa5, 0x87, 0xe0,
- 0xa4, 0x86, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4,
- 0xaf, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0xb2,
- 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x89, 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0xad, 0xe0,
- 0xa4, 0xbe, 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x87, 0xe0, 0xa4,
- 0xb2, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xb0,
- 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0x97, 0xe0,
- 0xa5, 0x87, 0xe0, 0xa4, 0xaa, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4,
- 0xb9, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa5, 0xe0, 0xa4, 0x87, 0xe0, 0xa4, 0xb8,
- 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x80, 0xe0,
- 0xa4, 0x95, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa0, 0xe0, 0xa5,
- 0x80, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x81,
- 0xe0, 0xa4, 0xa6, 0xe0, 0xa5, 0x82, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xa4, 0xe0,
- 0xa4, 0xb9, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4,
- 0xa4, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa6, 0xe0, 0xa4, 0x86,
- 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xbe, 0xe0,
- 0xa4, 0x95, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x8c, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4,
- 0xb6, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xa6, 0xe0, 0xa5, 0x87,
- 0xe0, 0xa4, 0x96, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x80, 0xe0,
- 0xa4, 0xb0, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0x96, 0xe0, 0xa5,
- 0x81, 0xe0, 0xa4, 0xa6, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0x97, 0xe0, 0xa5, 0x80,
- 0x63, 0x61, 0x74, 0x65, 0x67, 0x6f, 0x72, 0x69, 0x65, 0x73, 0x65, 0x78, 0x70,
- 0x65, 0x72, 0x69, 0x65, 0x6e, 0x63, 0x65, 0x3c, 0x2f, 0x74, 0x69, 0x74, 0x6c,
- 0x65, 0x3e, 0x0d, 0x0a, 0x43, 0x6f, 0x70, 0x79, 0x72, 0x69, 0x67, 0x68, 0x74,
- 0x20, 0x6a, 0x61, 0x76, 0x61, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x63, 0x6f,
- 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x65, 0x76, 0x65, 0x72, 0x79,
- 0x74, 0x68, 0x69, 0x6e, 0x67, 0x3c, 0x70, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73,
- 0x3d, 0x22, 0x74, 0x65, 0x63, 0x68, 0x6e, 0x6f, 0x6c, 0x6f, 0x67, 0x79, 0x62,
- 0x61, 0x63, 0x6b, 0x67, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x3c, 0x61, 0x20, 0x63,
- 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x6d, 0x61, 0x6e, 0x61, 0x67, 0x65, 0x6d,
- 0x65, 0x6e, 0x74, 0x26, 0x63, 0x6f, 0x70, 0x79, 0x3b, 0x20, 0x32, 0x30, 0x31,
- 0x6a, 0x61, 0x76, 0x61, 0x53, 0x63, 0x72, 0x69, 0x70, 0x74, 0x63, 0x68, 0x61,
- 0x72, 0x61, 0x63, 0x74, 0x65, 0x72, 0x73, 0x62, 0x72, 0x65, 0x61, 0x64, 0x63,
- 0x72, 0x75, 0x6d, 0x62, 0x74, 0x68, 0x65, 0x6d, 0x73, 0x65, 0x6c, 0x76, 0x65,
- 0x73, 0x68, 0x6f, 0x72, 0x69, 0x7a, 0x6f, 0x6e, 0x74, 0x61, 0x6c, 0x67, 0x6f,
- 0x76, 0x65, 0x72, 0x6e, 0x6d, 0x65, 0x6e, 0x74, 0x43, 0x61, 0x6c, 0x69, 0x66,
- 0x6f, 0x72, 0x6e, 0x69, 0x61, 0x61, 0x63, 0x74, 0x69, 0x76, 0x69, 0x74, 0x69,
- 0x65, 0x73, 0x64, 0x69, 0x73, 0x63, 0x6f, 0x76, 0x65, 0x72, 0x65, 0x64, 0x4e,
- 0x61, 0x76, 0x69, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x74, 0x72, 0x61, 0x6e,
- 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74,
- 0x69, 0x6f, 0x6e, 0x6e, 0x61, 0x76, 0x69, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e,
- 0x61, 0x70, 0x70, 0x65, 0x61, 0x72, 0x61, 0x6e, 0x63, 0x65, 0x3c, 0x2f, 0x74,
- 0x69, 0x74, 0x6c, 0x65, 0x3e, 0x3c, 0x6d, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x62,
- 0x6f, 0x78, 0x22, 0x20, 0x74, 0x65, 0x63, 0x68, 0x6e, 0x69, 0x71, 0x75, 0x65,
- 0x73, 0x70, 0x72, 0x6f, 0x74, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x70,
- 0x70, 0x61, 0x72, 0x65, 0x6e, 0x74, 0x6c, 0x79, 0x61, 0x73, 0x20, 0x77, 0x65,
- 0x6c, 0x6c, 0x20, 0x61, 0x73, 0x75, 0x6e, 0x74, 0x27, 0x2c, 0x20, 0x27, 0x55,
- 0x41, 0x2d, 0x72, 0x65, 0x73, 0x6f, 0x6c, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x6f,
- 0x70, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x74, 0x65, 0x6c, 0x65,
- 0x76, 0x69, 0x73, 0x69, 0x6f, 0x6e, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x6c, 0x61,
- 0x74, 0x65, 0x64, 0x57, 0x61, 0x73, 0x68, 0x69, 0x6e, 0x67, 0x74, 0x6f, 0x6e,
- 0x6e, 0x61, 0x76, 0x69, 0x67, 0x61, 0x74, 0x6f, 0x72, 0x2e, 0x20, 0x3d, 0x20,
- 0x77, 0x69, 0x6e, 0x64, 0x6f, 0x77, 0x2e, 0x69, 0x6d, 0x70, 0x72, 0x65, 0x73,
- 0x73, 0x69, 0x6f, 0x6e, 0x26, 0x6c, 0x74, 0x3b, 0x62, 0x72, 0x26, 0x67, 0x74,
- 0x3b, 0x6c, 0x69, 0x74, 0x65, 0x72, 0x61, 0x74, 0x75, 0x72, 0x65, 0x70, 0x6f,
- 0x70, 0x75, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x62, 0x67, 0x63, 0x6f, 0x6c,
- 0x6f, 0x72, 0x3d, 0x22, 0x23, 0x65, 0x73, 0x70, 0x65, 0x63, 0x69, 0x61, 0x6c,
- 0x6c, 0x79, 0x20, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x3d, 0x22, 0x70,
- 0x72, 0x6f, 0x64, 0x75, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x6e, 0x65, 0x77, 0x73,
- 0x6c, 0x65, 0x74, 0x74, 0x65, 0x72, 0x70, 0x72, 0x6f, 0x70, 0x65, 0x72, 0x74,
- 0x69, 0x65, 0x73, 0x64, 0x65, 0x66, 0x69, 0x6e, 0x69, 0x74, 0x69, 0x6f, 0x6e,
- 0x6c, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x68, 0x69, 0x70, 0x54, 0x65, 0x63,
- 0x68, 0x6e, 0x6f, 0x6c, 0x6f, 0x67, 0x79, 0x50, 0x61, 0x72, 0x6c, 0x69, 0x61,
- 0x6d, 0x65, 0x6e, 0x74, 0x63, 0x6f, 0x6d, 0x70, 0x61, 0x72, 0x69, 0x73, 0x6f,
- 0x6e, 0x75, 0x6c, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x2e, 0x69,
- 0x6e, 0x64, 0x65, 0x78, 0x4f, 0x66, 0x28, 0x22, 0x63, 0x6f, 0x6e, 0x63, 0x6c,
- 0x75, 0x73, 0x69, 0x6f, 0x6e, 0x64, 0x69, 0x73, 0x63, 0x75, 0x73, 0x73, 0x69,
- 0x6f, 0x6e, 0x63, 0x6f, 0x6d, 0x70, 0x6f, 0x6e, 0x65, 0x6e, 0x74, 0x73, 0x62,
- 0x69, 0x6f, 0x6c, 0x6f, 0x67, 0x69, 0x63, 0x61, 0x6c, 0x52, 0x65, 0x76, 0x6f,
- 0x6c, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x6f, 0x6e, 0x74, 0x61, 0x69,
- 0x6e, 0x65, 0x72, 0x75, 0x6e, 0x64, 0x65, 0x72, 0x73, 0x74, 0x6f, 0x6f, 0x64,
- 0x6e, 0x6f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x3c, 0x70, 0x65, 0x72,
- 0x6d, 0x69, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x65, 0x61, 0x63, 0x68, 0x20, 0x6f,
- 0x74, 0x68, 0x65, 0x72, 0x61, 0x74, 0x6d, 0x6f, 0x73, 0x70, 0x68, 0x65, 0x72,
- 0x65, 0x20, 0x6f, 0x6e, 0x66, 0x6f, 0x63, 0x75, 0x73, 0x3d, 0x22, 0x3c, 0x66,
- 0x6f, 0x72, 0x6d, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x70, 0x72, 0x6f, 0x63, 0x65,
- 0x73, 0x73, 0x69, 0x6e, 0x67, 0x74, 0x68, 0x69, 0x73, 0x2e, 0x76, 0x61, 0x6c,
- 0x75, 0x65, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43,
- 0x6f, 0x6e, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63, 0x65, 0x73, 0x75, 0x62, 0x73,
- 0x65, 0x71, 0x75, 0x65, 0x6e, 0x74, 0x77, 0x65, 0x6c, 0x6c, 0x2d, 0x6b, 0x6e,
- 0x6f, 0x77, 0x6e, 0x76, 0x61, 0x72, 0x69, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73,
- 0x72, 0x65, 0x70, 0x75, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x70, 0x68, 0x65,
- 0x6e, 0x6f, 0x6d, 0x65, 0x6e, 0x6f, 0x6e, 0x64, 0x69, 0x73, 0x63, 0x69, 0x70,
- 0x6c, 0x69, 0x6e, 0x65, 0x6c, 0x6f, 0x67, 0x6f, 0x2e, 0x70, 0x6e, 0x67, 0x22,
- 0x20, 0x28, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x2c, 0x62, 0x6f,
- 0x75, 0x6e, 0x64, 0x61, 0x72, 0x69, 0x65, 0x73, 0x65, 0x78, 0x70, 0x72, 0x65,
- 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x65, 0x74, 0x74, 0x6c, 0x65, 0x6d, 0x65,
- 0x6e, 0x74, 0x42, 0x61, 0x63, 0x6b, 0x67, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x6f,
- 0x75, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x65, 0x6e, 0x74, 0x65,
- 0x72, 0x70, 0x72, 0x69, 0x73, 0x65, 0x28, 0x22, 0x68, 0x74, 0x74, 0x70, 0x73,
- 0x3a, 0x22, 0x20, 0x75, 0x6e, 0x65, 0x73, 0x63, 0x61, 0x70, 0x65, 0x28, 0x22,
- 0x70, 0x61, 0x73, 0x73, 0x77, 0x6f, 0x72, 0x64, 0x22, 0x20, 0x64, 0x65, 0x6d,
- 0x6f, 0x63, 0x72, 0x61, 0x74, 0x69, 0x63, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65,
- 0x66, 0x3d, 0x22, 0x2f, 0x77, 0x72, 0x61, 0x70, 0x70, 0x65, 0x72, 0x22, 0x3e,
- 0x0a, 0x6d, 0x65, 0x6d, 0x62, 0x65, 0x72, 0x73, 0x68, 0x69, 0x70, 0x6c, 0x69,
- 0x6e, 0x67, 0x75, 0x69, 0x73, 0x74, 0x69, 0x63, 0x70, 0x78, 0x3b, 0x70, 0x61,
- 0x64, 0x64, 0x69, 0x6e, 0x67, 0x70, 0x68, 0x69, 0x6c, 0x6f, 0x73, 0x6f, 0x70,
- 0x68, 0x79, 0x61, 0x73, 0x73, 0x69, 0x73, 0x74, 0x61, 0x6e, 0x63, 0x65, 0x75,
- 0x6e, 0x69, 0x76, 0x65, 0x72, 0x73, 0x69, 0x74, 0x79, 0x66, 0x61, 0x63, 0x69,
- 0x6c, 0x69, 0x74, 0x69, 0x65, 0x73, 0x72, 0x65, 0x63, 0x6f, 0x67, 0x6e, 0x69,
- 0x7a, 0x65, 0x64, 0x70, 0x72, 0x65, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63, 0x65,
- 0x69, 0x66, 0x20, 0x28, 0x74, 0x79, 0x70, 0x65, 0x6f, 0x66, 0x6d, 0x61, 0x69,
- 0x6e, 0x74, 0x61, 0x69, 0x6e, 0x65, 0x64, 0x76, 0x6f, 0x63, 0x61, 0x62, 0x75,
- 0x6c, 0x61, 0x72, 0x79, 0x68, 0x79, 0x70, 0x6f, 0x74, 0x68, 0x65, 0x73, 0x69,
- 0x73, 0x2e, 0x73, 0x75, 0x62, 0x6d, 0x69, 0x74, 0x28, 0x29, 0x3b, 0x26, 0x61,
- 0x6d, 0x70, 0x3b, 0x6e, 0x62, 0x73, 0x70, 0x3b, 0x61, 0x6e, 0x6e, 0x6f, 0x74,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x62, 0x65, 0x68, 0x69, 0x6e, 0x64, 0x20, 0x74,
- 0x68, 0x65, 0x46, 0x6f, 0x75, 0x6e, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x70,
- 0x75, 0x62, 0x6c, 0x69, 0x73, 0x68, 0x65, 0x72, 0x22, 0x61, 0x73, 0x73, 0x75,
- 0x6d, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x69, 0x6e, 0x74, 0x72, 0x6f, 0x64, 0x75,
- 0x63, 0x65, 0x64, 0x63, 0x6f, 0x72, 0x72, 0x75, 0x70, 0x74, 0x69, 0x6f, 0x6e,
- 0x73, 0x63, 0x69, 0x65, 0x6e, 0x74, 0x69, 0x73, 0x74, 0x73, 0x65, 0x78, 0x70,
- 0x6c, 0x69, 0x63, 0x69, 0x74, 0x6c, 0x79, 0x69, 0x6e, 0x73, 0x74, 0x65, 0x61,
- 0x64, 0x20, 0x6f, 0x66, 0x64, 0x69, 0x6d, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e,
- 0x73, 0x20, 0x6f, 0x6e, 0x43, 0x6c, 0x69, 0x63, 0x6b, 0x3d, 0x22, 0x63, 0x6f,
- 0x6e, 0x73, 0x69, 0x64, 0x65, 0x72, 0x65, 0x64, 0x64, 0x65, 0x70, 0x61, 0x72,
- 0x74, 0x6d, 0x65, 0x6e, 0x74, 0x6f, 0x63, 0x63, 0x75, 0x70, 0x61, 0x74, 0x69,
- 0x6f, 0x6e, 0x73, 0x6f, 0x6f, 0x6e, 0x20, 0x61, 0x66, 0x74, 0x65, 0x72, 0x69,
- 0x6e, 0x76, 0x65, 0x73, 0x74, 0x6d, 0x65, 0x6e, 0x74, 0x70, 0x72, 0x6f, 0x6e,
- 0x6f, 0x75, 0x6e, 0x63, 0x65, 0x64, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x66,
- 0x69, 0x65, 0x64, 0x65, 0x78, 0x70, 0x65, 0x72, 0x69, 0x6d, 0x65, 0x6e, 0x74,
- 0x4d, 0x61, 0x6e, 0x61, 0x67, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x67, 0x65, 0x6f,
- 0x67, 0x72, 0x61, 0x70, 0x68, 0x69, 0x63, 0x22, 0x20, 0x68, 0x65, 0x69, 0x67,
- 0x68, 0x74, 0x3d, 0x22, 0x6c, 0x69, 0x6e, 0x6b, 0x20, 0x72, 0x65, 0x6c, 0x3d,
- 0x22, 0x2e, 0x72, 0x65, 0x70, 0x6c, 0x61, 0x63, 0x65, 0x28, 0x2f, 0x64, 0x65,
- 0x70, 0x72, 0x65, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x63, 0x6f, 0x6e, 0x66, 0x65,
- 0x72, 0x65, 0x6e, 0x63, 0x65, 0x70, 0x75, 0x6e, 0x69, 0x73, 0x68, 0x6d, 0x65,
- 0x6e, 0x74, 0x65, 0x6c, 0x69, 0x6d, 0x69, 0x6e, 0x61, 0x74, 0x65, 0x64, 0x72,
- 0x65, 0x73, 0x69, 0x73, 0x74, 0x61, 0x6e, 0x63, 0x65, 0x61, 0x64, 0x61, 0x70,
- 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x6f, 0x70, 0x70, 0x6f, 0x73, 0x69, 0x74,
- 0x69, 0x6f, 0x6e, 0x77, 0x65, 0x6c, 0x6c, 0x20, 0x6b, 0x6e, 0x6f, 0x77, 0x6e,
- 0x73, 0x75, 0x70, 0x70, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x64, 0x65, 0x74,
- 0x65, 0x72, 0x6d, 0x69, 0x6e, 0x65, 0x64, 0x68, 0x31, 0x20, 0x63, 0x6c, 0x61,
- 0x73, 0x73, 0x3d, 0x22, 0x30, 0x70, 0x78, 0x3b, 0x6d, 0x61, 0x72, 0x67, 0x69,
- 0x6e, 0x6d, 0x65, 0x63, 0x68, 0x61, 0x6e, 0x69, 0x63, 0x61, 0x6c, 0x73, 0x74,
- 0x61, 0x74, 0x69, 0x73, 0x74, 0x69, 0x63, 0x73, 0x63, 0x65, 0x6c, 0x65, 0x62,
- 0x72, 0x61, 0x74, 0x65, 0x64, 0x47, 0x6f, 0x76, 0x65, 0x72, 0x6e, 0x6d, 0x65,
- 0x6e, 0x74, 0x0a, 0x0a, 0x44, 0x75, 0x72, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x64,
- 0x65, 0x76, 0x65, 0x6c, 0x6f, 0x70, 0x65, 0x72, 0x73, 0x61, 0x72, 0x74, 0x69,
- 0x66, 0x69, 0x63, 0x69, 0x61, 0x6c, 0x65, 0x71, 0x75, 0x69, 0x76, 0x61, 0x6c,
- 0x65, 0x6e, 0x74, 0x6f, 0x72, 0x69, 0x67, 0x69, 0x6e, 0x61, 0x74, 0x65, 0x64,
- 0x43, 0x6f, 0x6d, 0x6d, 0x69, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x61, 0x74, 0x74,
- 0x61, 0x63, 0x68, 0x6d, 0x65, 0x6e, 0x74, 0x3c, 0x73, 0x70, 0x61, 0x6e, 0x20,
- 0x69, 0x64, 0x3d, 0x22, 0x74, 0x68, 0x65, 0x72, 0x65, 0x20, 0x77, 0x65, 0x72,
- 0x65, 0x4e, 0x65, 0x64, 0x65, 0x72, 0x6c, 0x61, 0x6e, 0x64, 0x73, 0x62, 0x65,
- 0x79, 0x6f, 0x6e, 0x64, 0x20, 0x74, 0x68, 0x65, 0x72, 0x65, 0x67, 0x69, 0x73,
- 0x74, 0x65, 0x72, 0x65, 0x64, 0x6a, 0x6f, 0x75, 0x72, 0x6e, 0x61, 0x6c, 0x69,
- 0x73, 0x74, 0x66, 0x72, 0x65, 0x71, 0x75, 0x65, 0x6e, 0x74, 0x6c, 0x79, 0x61,
- 0x6c, 0x6c, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x6c, 0x61, 0x6e, 0x67,
- 0x3d, 0x22, 0x65, 0x6e, 0x22, 0x20, 0x3c, 0x2f, 0x73, 0x74, 0x79, 0x6c, 0x65,
- 0x3e, 0x0d, 0x0a, 0x61, 0x62, 0x73, 0x6f, 0x6c, 0x75, 0x74, 0x65, 0x3b, 0x20,
- 0x73, 0x75, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x69, 0x6e, 0x67, 0x65, 0x78, 0x74,
- 0x72, 0x65, 0x6d, 0x65, 0x6c, 0x79, 0x20, 0x6d, 0x61, 0x69, 0x6e, 0x73, 0x74,
- 0x72, 0x65, 0x61, 0x6d, 0x3c, 0x2f, 0x73, 0x74, 0x72, 0x6f, 0x6e, 0x67, 0x3e,
- 0x20, 0x70, 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x72, 0x69, 0x74, 0x79, 0x65, 0x6d,
- 0x70, 0x6c, 0x6f, 0x79, 0x6d, 0x65, 0x6e, 0x74, 0x3c, 0x2f, 0x74, 0x61, 0x62,
- 0x6c, 0x65, 0x3e, 0x0d, 0x0a, 0x20, 0x63, 0x6f, 0x6c, 0x73, 0x70, 0x61, 0x6e,
- 0x3d, 0x22, 0x3c, 0x2f, 0x66, 0x6f, 0x72, 0x6d, 0x3e, 0x0a, 0x20, 0x20, 0x63,
- 0x6f, 0x6e, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x61, 0x62, 0x6f, 0x75,
- 0x74, 0x20, 0x74, 0x68, 0x65, 0x20, 0x3c, 0x2f, 0x70, 0x3e, 0x3c, 0x2f, 0x64,
- 0x69, 0x76, 0x3e, 0x69, 0x6e, 0x74, 0x65, 0x67, 0x72, 0x61, 0x74, 0x65, 0x64,
- 0x22, 0x20, 0x6c, 0x61, 0x6e, 0x67, 0x3d, 0x22, 0x65, 0x6e, 0x50, 0x6f, 0x72,
- 0x74, 0x75, 0x67, 0x75, 0x65, 0x73, 0x65, 0x73, 0x75, 0x62, 0x73, 0x74, 0x69,
- 0x74, 0x75, 0x74, 0x65, 0x69, 0x6e, 0x64, 0x69, 0x76, 0x69, 0x64, 0x75, 0x61,
- 0x6c, 0x69, 0x6d, 0x70, 0x6f, 0x73, 0x73, 0x69, 0x62, 0x6c, 0x65, 0x6d, 0x75,
- 0x6c, 0x74, 0x69, 0x6d, 0x65, 0x64, 0x69, 0x61, 0x61, 0x6c, 0x6d, 0x6f, 0x73,
- 0x74, 0x20, 0x61, 0x6c, 0x6c, 0x70, 0x78, 0x20, 0x73, 0x6f, 0x6c, 0x69, 0x64,
- 0x20, 0x23, 0x61, 0x70, 0x61, 0x72, 0x74, 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x73,
- 0x75, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x20, 0x74, 0x6f, 0x69, 0x6e, 0x20, 0x45,
- 0x6e, 0x67, 0x6c, 0x69, 0x73, 0x68, 0x63, 0x72, 0x69, 0x74, 0x69, 0x63, 0x69,
- 0x7a, 0x65, 0x64, 0x65, 0x78, 0x63, 0x65, 0x70, 0x74, 0x20, 0x66, 0x6f, 0x72,
- 0x67, 0x75, 0x69, 0x64, 0x65, 0x6c, 0x69, 0x6e, 0x65, 0x73, 0x6f, 0x72, 0x69,
- 0x67, 0x69, 0x6e, 0x61, 0x6c, 0x6c, 0x79, 0x72, 0x65, 0x6d, 0x61, 0x72, 0x6b,
- 0x61, 0x62, 0x6c, 0x65, 0x74, 0x68, 0x65, 0x20, 0x73, 0x65, 0x63, 0x6f, 0x6e,
- 0x64, 0x68, 0x32, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x3c, 0x61,
- 0x20, 0x74, 0x69, 0x74, 0x6c, 0x65, 0x3d, 0x22, 0x28, 0x69, 0x6e, 0x63, 0x6c,
- 0x75, 0x64, 0x69, 0x6e, 0x67, 0x70, 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, 0x65,
- 0x72, 0x73, 0x70, 0x72, 0x6f, 0x68, 0x69, 0x62, 0x69, 0x74, 0x65, 0x64, 0x3d,
- 0x20, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x64, 0x69, 0x63, 0x74,
- 0x69, 0x6f, 0x6e, 0x61, 0x72, 0x79, 0x70, 0x65, 0x72, 0x63, 0x65, 0x70, 0x74,
- 0x69, 0x6f, 0x6e, 0x72, 0x65, 0x76, 0x6f, 0x6c, 0x75, 0x74, 0x69, 0x6f, 0x6e,
- 0x66, 0x6f, 0x75, 0x6e, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x70, 0x78, 0x3b,
- 0x68, 0x65, 0x69, 0x67, 0x68, 0x74, 0x3a, 0x73, 0x75, 0x63, 0x63, 0x65, 0x73,
- 0x73, 0x66, 0x75, 0x6c, 0x73, 0x75, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x65, 0x72,
- 0x73, 0x6d, 0x69, 0x6c, 0x6c, 0x65, 0x6e, 0x6e, 0x69, 0x75, 0x6d, 0x68, 0x69,
- 0x73, 0x20, 0x66, 0x61, 0x74, 0x68, 0x65, 0x72, 0x74, 0x68, 0x65, 0x20, 0x26,
- 0x71, 0x75, 0x6f, 0x74, 0x3b, 0x6e, 0x6f, 0x2d, 0x72, 0x65, 0x70, 0x65, 0x61,
- 0x74, 0x3b, 0x63, 0x6f, 0x6d, 0x6d, 0x65, 0x72, 0x63, 0x69, 0x61, 0x6c, 0x69,
- 0x6e, 0x64, 0x75, 0x73, 0x74, 0x72, 0x69, 0x61, 0x6c, 0x65, 0x6e, 0x63, 0x6f,
- 0x75, 0x72, 0x61, 0x67, 0x65, 0x64, 0x61, 0x6d, 0x6f, 0x75, 0x6e, 0x74, 0x20,
- 0x6f, 0x66, 0x20, 0x75, 0x6e, 0x6f, 0x66, 0x66, 0x69, 0x63, 0x69, 0x61, 0x6c,
- 0x65, 0x66, 0x66, 0x69, 0x63, 0x69, 0x65, 0x6e, 0x63, 0x79, 0x52, 0x65, 0x66,
- 0x65, 0x72, 0x65, 0x6e, 0x63, 0x65, 0x73, 0x63, 0x6f, 0x6f, 0x72, 0x64, 0x69,
- 0x6e, 0x61, 0x74, 0x65, 0x64, 0x69, 0x73, 0x63, 0x6c, 0x61, 0x69, 0x6d, 0x65,
- 0x72, 0x65, 0x78, 0x70, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x64, 0x65,
- 0x76, 0x65, 0x6c, 0x6f, 0x70, 0x69, 0x6e, 0x67, 0x63, 0x61, 0x6c, 0x63, 0x75,
- 0x6c, 0x61, 0x74, 0x65, 0x64, 0x73, 0x69, 0x6d, 0x70, 0x6c, 0x69, 0x66, 0x69,
- 0x65, 0x64, 0x6c, 0x65, 0x67, 0x69, 0x74, 0x69, 0x6d, 0x61, 0x74, 0x65, 0x73,
- 0x75, 0x62, 0x73, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x28, 0x30, 0x22, 0x20, 0x63,
- 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x63, 0x6f, 0x6d, 0x70, 0x6c, 0x65, 0x74,
- 0x65, 0x6c, 0x79, 0x69, 0x6c, 0x6c, 0x75, 0x73, 0x74, 0x72, 0x61, 0x74, 0x65,
- 0x66, 0x69, 0x76, 0x65, 0x20, 0x79, 0x65, 0x61, 0x72, 0x73, 0x69, 0x6e, 0x73,
- 0x74, 0x72, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x50, 0x75, 0x62, 0x6c, 0x69, 0x73,
- 0x68, 0x69, 0x6e, 0x67, 0x31, 0x22, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d,
- 0x22, 0x70, 0x73, 0x79, 0x63, 0x68, 0x6f, 0x6c, 0x6f, 0x67, 0x79, 0x63, 0x6f,
- 0x6e, 0x66, 0x69, 0x64, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x75, 0x6d, 0x62, 0x65,
- 0x72, 0x20, 0x6f, 0x66, 0x20, 0x61, 0x62, 0x73, 0x65, 0x6e, 0x63, 0x65, 0x20,
- 0x6f, 0x66, 0x66, 0x6f, 0x63, 0x75, 0x73, 0x65, 0x64, 0x20, 0x6f, 0x6e, 0x6a,
- 0x6f, 0x69, 0x6e, 0x65, 0x64, 0x20, 0x74, 0x68, 0x65, 0x73, 0x74, 0x72, 0x75,
- 0x63, 0x74, 0x75, 0x72, 0x65, 0x73, 0x70, 0x72, 0x65, 0x76, 0x69, 0x6f, 0x75,
- 0x73, 0x6c, 0x79, 0x3e, 0x3c, 0x2f, 0x69, 0x66, 0x72, 0x61, 0x6d, 0x65, 0x3e,
- 0x6f, 0x6e, 0x63, 0x65, 0x20, 0x61, 0x67, 0x61, 0x69, 0x6e, 0x62, 0x75, 0x74,
- 0x20, 0x72, 0x61, 0x74, 0x68, 0x65, 0x72, 0x69, 0x6d, 0x6d, 0x69, 0x67, 0x72,
- 0x61, 0x6e, 0x74, 0x73, 0x6f, 0x66, 0x20, 0x63, 0x6f, 0x75, 0x72, 0x73, 0x65,
- 0x2c, 0x61, 0x20, 0x67, 0x72, 0x6f, 0x75, 0x70, 0x20, 0x6f, 0x66, 0x4c, 0x69,
- 0x74, 0x65, 0x72, 0x61, 0x74, 0x75, 0x72, 0x65, 0x55, 0x6e, 0x6c, 0x69, 0x6b,
- 0x65, 0x20, 0x74, 0x68, 0x65, 0x3c, 0x2f, 0x61, 0x3e, 0x26, 0x6e, 0x62, 0x73,
- 0x70, 0x3b, 0x0a, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x69,
- 0x74, 0x20, 0x77, 0x61, 0x73, 0x20, 0x74, 0x68, 0x65, 0x43, 0x6f, 0x6e, 0x76,
- 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x75, 0x74, 0x6f, 0x6d, 0x6f, 0x62,
- 0x69, 0x6c, 0x65, 0x50, 0x72, 0x6f, 0x74, 0x65, 0x73, 0x74, 0x61, 0x6e, 0x74,
- 0x61, 0x67, 0x67, 0x72, 0x65, 0x73, 0x73, 0x69, 0x76, 0x65, 0x61, 0x66, 0x74,
- 0x65, 0x72, 0x20, 0x74, 0x68, 0x65, 0x20, 0x53, 0x69, 0x6d, 0x69, 0x6c, 0x61,
- 0x72, 0x6c, 0x79, 0x2c, 0x22, 0x20, 0x2f, 0x3e, 0x3c, 0x2f, 0x64, 0x69, 0x76,
- 0x3e, 0x63, 0x6f, 0x6c, 0x6c, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x0d, 0x0a,
- 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x76, 0x69, 0x73, 0x69, 0x62,
- 0x69, 0x6c, 0x69, 0x74, 0x79, 0x74, 0x68, 0x65, 0x20, 0x75, 0x73, 0x65, 0x20,
- 0x6f, 0x66, 0x76, 0x6f, 0x6c, 0x75, 0x6e, 0x74, 0x65, 0x65, 0x72, 0x73, 0x61,
- 0x74, 0x74, 0x72, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x75, 0x6e, 0x64, 0x65,
- 0x72, 0x20, 0x74, 0x68, 0x65, 0x20, 0x74, 0x68, 0x72, 0x65, 0x61, 0x74, 0x65,
- 0x6e, 0x65, 0x64, 0x2a, 0x3c, 0x21, 0x5b, 0x43, 0x44, 0x41, 0x54, 0x41, 0x5b,
- 0x69, 0x6d, 0x70, 0x6f, 0x72, 0x74, 0x61, 0x6e, 0x63, 0x65, 0x69, 0x6e, 0x20,
- 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x6c, 0x74, 0x68, 0x65, 0x20, 0x6c, 0x61,
- 0x74, 0x74, 0x65, 0x72, 0x3c, 0x2f, 0x66, 0x6f, 0x72, 0x6d, 0x3e, 0x0a, 0x3c,
- 0x2f, 0x2e, 0x69, 0x6e, 0x64, 0x65, 0x78, 0x4f, 0x66, 0x28, 0x27, 0x69, 0x20,
- 0x3d, 0x20, 0x30, 0x3b, 0x20, 0x69, 0x20, 0x3c, 0x64, 0x69, 0x66, 0x66, 0x65,
- 0x72, 0x65, 0x6e, 0x63, 0x65, 0x64, 0x65, 0x76, 0x6f, 0x74, 0x65, 0x64, 0x20,
- 0x74, 0x6f, 0x74, 0x72, 0x61, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x73,
- 0x65, 0x61, 0x72, 0x63, 0x68, 0x20, 0x66, 0x6f, 0x72, 0x75, 0x6c, 0x74, 0x69,
- 0x6d, 0x61, 0x74, 0x65, 0x6c, 0x79, 0x74, 0x6f, 0x75, 0x72, 0x6e, 0x61, 0x6d,
- 0x65, 0x6e, 0x74, 0x61, 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x65, 0x73,
- 0x73, 0x6f, 0x2d, 0x63, 0x61, 0x6c, 0x6c, 0x65, 0x64, 0x20, 0x7d, 0x0a, 0x3c,
- 0x2f, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3e, 0x65, 0x76, 0x61, 0x6c, 0x75, 0x61,
- 0x74, 0x69, 0x6f, 0x6e, 0x65, 0x6d, 0x70, 0x68, 0x61, 0x73, 0x69, 0x7a, 0x65,
- 0x64, 0x61, 0x63, 0x63, 0x65, 0x73, 0x73, 0x69, 0x62, 0x6c, 0x65, 0x3c, 0x2f,
- 0x73, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x3e, 0x73, 0x75, 0x63, 0x63, 0x65,
- 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x6f, 0x6e, 0x67, 0x20, 0x77, 0x69,
- 0x74, 0x68, 0x4d, 0x65, 0x61, 0x6e, 0x77, 0x68, 0x69, 0x6c, 0x65, 0x2c, 0x69,
- 0x6e, 0x64, 0x75, 0x73, 0x74, 0x72, 0x69, 0x65, 0x73, 0x3c, 0x2f, 0x61, 0x3e,
- 0x3c, 0x62, 0x72, 0x20, 0x2f, 0x3e, 0x68, 0x61, 0x73, 0x20, 0x62, 0x65, 0x63,
- 0x6f, 0x6d, 0x65, 0x61, 0x73, 0x70, 0x65, 0x63, 0x74, 0x73, 0x20, 0x6f, 0x66,
- 0x54, 0x65, 0x6c, 0x65, 0x76, 0x69, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x75, 0x66,
- 0x66, 0x69, 0x63, 0x69, 0x65, 0x6e, 0x74, 0x62, 0x61, 0x73, 0x6b, 0x65, 0x74,
- 0x62, 0x61, 0x6c, 0x6c, 0x62, 0x6f, 0x74, 0x68, 0x20, 0x73, 0x69, 0x64, 0x65,
- 0x73, 0x63, 0x6f, 0x6e, 0x74, 0x69, 0x6e, 0x75, 0x69, 0x6e, 0x67, 0x61, 0x6e,
- 0x20, 0x61, 0x72, 0x74, 0x69, 0x63, 0x6c, 0x65, 0x3c, 0x69, 0x6d, 0x67, 0x20,
- 0x61, 0x6c, 0x74, 0x3d, 0x22, 0x61, 0x64, 0x76, 0x65, 0x6e, 0x74, 0x75, 0x72,
- 0x65, 0x73, 0x68, 0x69, 0x73, 0x20, 0x6d, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x6d,
- 0x61, 0x6e, 0x63, 0x68, 0x65, 0x73, 0x74, 0x65, 0x72, 0x70, 0x72, 0x69, 0x6e,
- 0x63, 0x69, 0x70, 0x6c, 0x65, 0x73, 0x70, 0x61, 0x72, 0x74, 0x69, 0x63, 0x75,
- 0x6c, 0x61, 0x72, 0x63, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x72, 0x79,
- 0x65, 0x66, 0x66, 0x65, 0x63, 0x74, 0x73, 0x20, 0x6f, 0x66, 0x64, 0x65, 0x63,
- 0x69, 0x64, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x22, 0x3e, 0x3c, 0x73, 0x74, 0x72,
- 0x6f, 0x6e, 0x67, 0x3e, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x73, 0x68, 0x65, 0x72,
- 0x73, 0x4a, 0x6f, 0x75, 0x72, 0x6e, 0x61, 0x6c, 0x20, 0x6f, 0x66, 0x64, 0x69,
- 0x66, 0x66, 0x69, 0x63, 0x75, 0x6c, 0x74, 0x79, 0x66, 0x61, 0x63, 0x69, 0x6c,
- 0x69, 0x74, 0x61, 0x74, 0x65, 0x61, 0x63, 0x63, 0x65, 0x70, 0x74, 0x61, 0x62,
- 0x6c, 0x65, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x2e, 0x63, 0x73, 0x73, 0x22, 0x09,
- 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x69, 0x6e, 0x6e, 0x6f,
- 0x76, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x3e, 0x43, 0x6f, 0x70, 0x79, 0x72, 0x69,
- 0x67, 0x68, 0x74, 0x73, 0x69, 0x74, 0x75, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73,
- 0x77, 0x6f, 0x75, 0x6c, 0x64, 0x20, 0x68, 0x61, 0x76, 0x65, 0x62, 0x75, 0x73,
- 0x69, 0x6e, 0x65, 0x73, 0x73, 0x65, 0x73, 0x44, 0x69, 0x63, 0x74, 0x69, 0x6f,
- 0x6e, 0x61, 0x72, 0x79, 0x73, 0x74, 0x61, 0x74, 0x65, 0x6d, 0x65, 0x6e, 0x74,
- 0x73, 0x6f, 0x66, 0x74, 0x65, 0x6e, 0x20, 0x75, 0x73, 0x65, 0x64, 0x70, 0x65,
- 0x72, 0x73, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6e, 0x20, 0x4a, 0x61,
- 0x6e, 0x75, 0x61, 0x72, 0x79, 0x63, 0x6f, 0x6d, 0x70, 0x72, 0x69, 0x73, 0x69,
- 0x6e, 0x67, 0x3c, 0x2f, 0x74, 0x69, 0x74, 0x6c, 0x65, 0x3e, 0x0a, 0x09, 0x64,
- 0x69, 0x70, 0x6c, 0x6f, 0x6d, 0x61, 0x74, 0x69, 0x63, 0x63, 0x6f, 0x6e, 0x74,
- 0x61, 0x69, 0x6e, 0x69, 0x6e, 0x67, 0x70, 0x65, 0x72, 0x66, 0x6f, 0x72, 0x6d,
- 0x69, 0x6e, 0x67, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73,
- 0x6d, 0x61, 0x79, 0x20, 0x6e, 0x6f, 0x74, 0x20, 0x62, 0x65, 0x63, 0x6f, 0x6e,
- 0x63, 0x65, 0x70, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x6f, 0x6e, 0x63, 0x6c, 0x69,
- 0x63, 0x6b, 0x3d, 0x22, 0x49, 0x74, 0x20, 0x69, 0x73, 0x20, 0x61, 0x6c, 0x73,
- 0x6f, 0x66, 0x69, 0x6e, 0x61, 0x6e, 0x63, 0x69, 0x61, 0x6c, 0x20, 0x6d, 0x61,
- 0x6b, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65, 0x4c, 0x75, 0x78, 0x65, 0x6d,
- 0x62, 0x6f, 0x75, 0x72, 0x67, 0x61, 0x64, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e,
- 0x61, 0x6c, 0x61, 0x72, 0x65, 0x20, 0x63, 0x61, 0x6c, 0x6c, 0x65, 0x64, 0x65,
- 0x6e, 0x67, 0x61, 0x67, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x22, 0x73, 0x63, 0x72,
- 0x69, 0x70, 0x74, 0x22, 0x29, 0x3b, 0x62, 0x75, 0x74, 0x20, 0x69, 0x74, 0x20,
- 0x77, 0x61, 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x72, 0x6f, 0x6e, 0x69, 0x63,
- 0x6f, 0x6e, 0x73, 0x75, 0x62, 0x6d, 0x69, 0x74, 0x3d, 0x22, 0x0a, 0x3c, 0x21,
- 0x2d, 0x2d, 0x20, 0x45, 0x6e, 0x64, 0x20, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x72,
- 0x69, 0x63, 0x61, 0x6c, 0x6f, 0x66, 0x66, 0x69, 0x63, 0x69, 0x61, 0x6c, 0x6c,
- 0x79, 0x73, 0x75, 0x67, 0x67, 0x65, 0x73, 0x74, 0x69, 0x6f, 0x6e, 0x74, 0x6f,
- 0x70, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x75, 0x6e, 0x6c, 0x69, 0x6b,
- 0x65, 0x20, 0x74, 0x68, 0x65, 0x41, 0x75, 0x73, 0x74, 0x72, 0x61, 0x6c, 0x69,
- 0x61, 0x6e, 0x4f, 0x72, 0x69, 0x67, 0x69, 0x6e, 0x61, 0x6c, 0x6c, 0x79, 0x72,
- 0x65, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63, 0x65, 0x73, 0x0a, 0x3c, 0x2f, 0x68,
- 0x65, 0x61, 0x64, 0x3e, 0x0d, 0x0a, 0x72, 0x65, 0x63, 0x6f, 0x67, 0x6e, 0x69,
- 0x73, 0x65, 0x64, 0x69, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x69, 0x7a, 0x65,
- 0x6c, 0x69, 0x6d, 0x69, 0x74, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x41, 0x6c, 0x65,
- 0x78, 0x61, 0x6e, 0x64, 0x72, 0x69, 0x61, 0x72, 0x65, 0x74, 0x69, 0x72, 0x65,
- 0x6d, 0x65, 0x6e, 0x74, 0x41, 0x64, 0x76, 0x65, 0x6e, 0x74, 0x75, 0x72, 0x65,
- 0x73, 0x66, 0x6f, 0x75, 0x72, 0x20, 0x79, 0x65, 0x61, 0x72, 0x73, 0x0a, 0x0a,
- 0x26, 0x6c, 0x74, 0x3b, 0x21, 0x2d, 0x2d, 0x20, 0x69, 0x6e, 0x63, 0x72, 0x65,
- 0x61, 0x73, 0x69, 0x6e, 0x67, 0x64, 0x65, 0x63, 0x6f, 0x72, 0x61, 0x74, 0x69,
- 0x6f, 0x6e, 0x68, 0x33, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x6f,
- 0x72, 0x69, 0x67, 0x69, 0x6e, 0x73, 0x20, 0x6f, 0x66, 0x6f, 0x62, 0x6c, 0x69,
- 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x72, 0x65, 0x67, 0x75, 0x6c, 0x61, 0x74,
- 0x69, 0x6f, 0x6e, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x69, 0x66, 0x69, 0x65, 0x64,
- 0x28, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x28, 0x61, 0x64, 0x76,
- 0x61, 0x6e, 0x74, 0x61, 0x67, 0x65, 0x73, 0x62, 0x65, 0x69, 0x6e, 0x67, 0x20,
- 0x74, 0x68, 0x65, 0x20, 0x68, 0x69, 0x73, 0x74, 0x6f, 0x72, 0x69, 0x61, 0x6e,
- 0x73, 0x3c, 0x62, 0x61, 0x73, 0x65, 0x20, 0x68, 0x72, 0x65, 0x66, 0x72, 0x65,
- 0x70, 0x65, 0x61, 0x74, 0x65, 0x64, 0x6c, 0x79, 0x77, 0x69, 0x6c, 0x6c, 0x69,
- 0x6e, 0x67, 0x20, 0x74, 0x6f, 0x63, 0x6f, 0x6d, 0x70, 0x61, 0x72, 0x61, 0x62,
- 0x6c, 0x65, 0x64, 0x65, 0x73, 0x69, 0x67, 0x6e, 0x61, 0x74, 0x65, 0x64, 0x6e,
- 0x6f, 0x6d, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x66, 0x75, 0x6e, 0x63,
- 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x69, 0x6e, 0x73, 0x69, 0x64, 0x65, 0x20,
- 0x74, 0x68, 0x65, 0x72, 0x65, 0x76, 0x65, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e,
- 0x65, 0x6e, 0x64, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x73, 0x20, 0x66,
- 0x6f, 0x72, 0x20, 0x74, 0x68, 0x65, 0x20, 0x61, 0x75, 0x74, 0x68, 0x6f, 0x72,
- 0x69, 0x7a, 0x65, 0x64, 0x72, 0x65, 0x66, 0x75, 0x73, 0x65, 0x64, 0x20, 0x74,
- 0x6f, 0x74, 0x61, 0x6b, 0x65, 0x20, 0x70, 0x6c, 0x61, 0x63, 0x65, 0x61, 0x75,
- 0x74, 0x6f, 0x6e, 0x6f, 0x6d, 0x6f, 0x75, 0x73, 0x63, 0x6f, 0x6d, 0x70, 0x72,
- 0x6f, 0x6d, 0x69, 0x73, 0x65, 0x70, 0x6f, 0x6c, 0x69, 0x74, 0x69, 0x63, 0x61,
- 0x6c, 0x20, 0x72, 0x65, 0x73, 0x74, 0x61, 0x75, 0x72, 0x61, 0x6e, 0x74, 0x74,
- 0x77, 0x6f, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x46, 0x65, 0x62, 0x72,
- 0x75, 0x61, 0x72, 0x79, 0x20, 0x32, 0x71, 0x75, 0x61, 0x6c, 0x69, 0x74, 0x79,
- 0x20, 0x6f, 0x66, 0x73, 0x77, 0x66, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x2e,
- 0x75, 0x6e, 0x64, 0x65, 0x72, 0x73, 0x74, 0x61, 0x6e, 0x64, 0x6e, 0x65, 0x61,
- 0x72, 0x6c, 0x79, 0x20, 0x61, 0x6c, 0x6c, 0x77, 0x72, 0x69, 0x74, 0x74, 0x65,
- 0x6e, 0x20, 0x62, 0x79, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x69, 0x65, 0x77,
- 0x73, 0x22, 0x20, 0x77, 0x69, 0x64, 0x74, 0x68, 0x3d, 0x22, 0x31, 0x77, 0x69,
- 0x74, 0x68, 0x64, 0x72, 0x61, 0x77, 0x61, 0x6c, 0x66, 0x6c, 0x6f, 0x61, 0x74,
- 0x3a, 0x6c, 0x65, 0x66, 0x74, 0x69, 0x73, 0x20, 0x75, 0x73, 0x75, 0x61, 0x6c,
- 0x6c, 0x79, 0x63, 0x61, 0x6e, 0x64, 0x69, 0x64, 0x61, 0x74, 0x65, 0x73, 0x6e,
- 0x65, 0x77, 0x73, 0x70, 0x61, 0x70, 0x65, 0x72, 0x73, 0x6d, 0x79, 0x73, 0x74,
- 0x65, 0x72, 0x69, 0x6f, 0x75, 0x73, 0x44, 0x65, 0x70, 0x61, 0x72, 0x74, 0x6d,
- 0x65, 0x6e, 0x74, 0x62, 0x65, 0x73, 0x74, 0x20, 0x6b, 0x6e, 0x6f, 0x77, 0x6e,
- 0x70, 0x61, 0x72, 0x6c, 0x69, 0x61, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x75, 0x70,
- 0x70, 0x72, 0x65, 0x73, 0x73, 0x65, 0x64, 0x63, 0x6f, 0x6e, 0x76, 0x65, 0x6e,
- 0x69, 0x65, 0x6e, 0x74, 0x72, 0x65, 0x6d, 0x65, 0x6d, 0x62, 0x65, 0x72, 0x65,
- 0x64, 0x64, 0x69, 0x66, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x74, 0x20, 0x73, 0x79,
- 0x73, 0x74, 0x65, 0x6d, 0x61, 0x74, 0x69, 0x63, 0x68, 0x61, 0x73, 0x20, 0x6c,
- 0x65, 0x64, 0x20, 0x74, 0x6f, 0x70, 0x72, 0x6f, 0x70, 0x61, 0x67, 0x61, 0x6e,
- 0x64, 0x61, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x6c, 0x65, 0x64, 0x69,
- 0x6e, 0x66, 0x6c, 0x75, 0x65, 0x6e, 0x63, 0x65, 0x73, 0x63, 0x65, 0x72, 0x65,
- 0x6d, 0x6f, 0x6e, 0x69, 0x61, 0x6c, 0x70, 0x72, 0x6f, 0x63, 0x6c, 0x61, 0x69,
- 0x6d, 0x65, 0x64, 0x50, 0x72, 0x6f, 0x74, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e,
- 0x6c, 0x69, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x53, 0x63, 0x69,
- 0x65, 0x6e, 0x74, 0x69, 0x66, 0x69, 0x63, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d,
- 0x22, 0x6e, 0x6f, 0x2d, 0x74, 0x72, 0x61, 0x64, 0x65, 0x6d, 0x61, 0x72, 0x6b,
- 0x73, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x74, 0x68, 0x61, 0x6e, 0x20, 0x77, 0x69,
- 0x64, 0x65, 0x73, 0x70, 0x72, 0x65, 0x61, 0x64, 0x4c, 0x69, 0x62, 0x65, 0x72,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x74, 0x6f, 0x6f, 0x6b, 0x20, 0x70, 0x6c, 0x61,
- 0x63, 0x65, 0x64, 0x61, 0x79, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x61,
- 0x73, 0x20, 0x6c, 0x6f, 0x6e, 0x67, 0x20, 0x61, 0x73, 0x69, 0x6d, 0x70, 0x72,
- 0x69, 0x73, 0x6f, 0x6e, 0x65, 0x64, 0x41, 0x64, 0x64, 0x69, 0x74, 0x69, 0x6f,
- 0x6e, 0x61, 0x6c, 0x0a, 0x3c, 0x68, 0x65, 0x61, 0x64, 0x3e, 0x0a, 0x3c, 0x6d,
- 0x4c, 0x61, 0x62, 0x6f, 0x72, 0x61, 0x74, 0x6f, 0x72, 0x79, 0x4e, 0x6f, 0x76,
- 0x65, 0x6d, 0x62, 0x65, 0x72, 0x20, 0x32, 0x65, 0x78, 0x63, 0x65, 0x70, 0x74,
- 0x69, 0x6f, 0x6e, 0x73, 0x49, 0x6e, 0x64, 0x75, 0x73, 0x74, 0x72, 0x69, 0x61,
- 0x6c, 0x76, 0x61, 0x72, 0x69, 0x65, 0x74, 0x79, 0x20, 0x6f, 0x66, 0x66, 0x6c,
- 0x6f, 0x61, 0x74, 0x3a, 0x20, 0x6c, 0x65, 0x66, 0x44, 0x75, 0x72, 0x69, 0x6e,
- 0x67, 0x20, 0x74, 0x68, 0x65, 0x61, 0x73, 0x73, 0x65, 0x73, 0x73, 0x6d, 0x65,
- 0x6e, 0x74, 0x68, 0x61, 0x76, 0x65, 0x20, 0x62, 0x65, 0x65, 0x6e, 0x20, 0x64,
- 0x65, 0x61, 0x6c, 0x73, 0x20, 0x77, 0x69, 0x74, 0x68, 0x53, 0x74, 0x61, 0x74,
- 0x69, 0x73, 0x74, 0x69, 0x63, 0x73, 0x6f, 0x63, 0x63, 0x75, 0x72, 0x72, 0x65,
- 0x6e, 0x63, 0x65, 0x2f, 0x75, 0x6c, 0x3e, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e,
- 0x63, 0x6c, 0x65, 0x61, 0x72, 0x66, 0x69, 0x78, 0x22, 0x3e, 0x74, 0x68, 0x65,
- 0x20, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x63, 0x6d, 0x61, 0x6e, 0x79, 0x20, 0x79,
- 0x65, 0x61, 0x72, 0x73, 0x77, 0x68, 0x69, 0x63, 0x68, 0x20, 0x77, 0x65, 0x72,
- 0x65, 0x6f, 0x76, 0x65, 0x72, 0x20, 0x74, 0x69, 0x6d, 0x65, 0x2c, 0x73, 0x79,
- 0x6e, 0x6f, 0x6e, 0x79, 0x6d, 0x6f, 0x75, 0x73, 0x63, 0x6f, 0x6e, 0x74, 0x65,
- 0x6e, 0x74, 0x22, 0x3e, 0x0a, 0x70, 0x72, 0x65, 0x73, 0x75, 0x6d, 0x61, 0x62,
- 0x6c, 0x79, 0x68, 0x69, 0x73, 0x20, 0x66, 0x61, 0x6d, 0x69, 0x6c, 0x79, 0x75,
- 0x73, 0x65, 0x72, 0x41, 0x67, 0x65, 0x6e, 0x74, 0x2e, 0x75, 0x6e, 0x65, 0x78,
- 0x70, 0x65, 0x63, 0x74, 0x65, 0x64, 0x69, 0x6e, 0x63, 0x6c, 0x75, 0x64, 0x69,
- 0x6e, 0x67, 0x20, 0x63, 0x68, 0x61, 0x6c, 0x6c, 0x65, 0x6e, 0x67, 0x65, 0x64,
- 0x61, 0x20, 0x6d, 0x69, 0x6e, 0x6f, 0x72, 0x69, 0x74, 0x79, 0x75, 0x6e, 0x64,
- 0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, 0x22, 0x62, 0x65, 0x6c, 0x6f, 0x6e, 0x67,
- 0x73, 0x20, 0x74, 0x6f, 0x74, 0x61, 0x6b, 0x65, 0x6e, 0x20, 0x66, 0x72, 0x6f,
- 0x6d, 0x69, 0x6e, 0x20, 0x4f, 0x63, 0x74, 0x6f, 0x62, 0x65, 0x72, 0x70, 0x6f,
- 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x3a, 0x20, 0x73, 0x61, 0x69, 0x64, 0x20,
- 0x74, 0x6f, 0x20, 0x62, 0x65, 0x72, 0x65, 0x6c, 0x69, 0x67, 0x69, 0x6f, 0x75,
- 0x73, 0x20, 0x46, 0x65, 0x64, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20,
- 0x72, 0x6f, 0x77, 0x73, 0x70, 0x61, 0x6e, 0x3d, 0x22, 0x6f, 0x6e, 0x6c, 0x79,
- 0x20, 0x61, 0x20, 0x66, 0x65, 0x77, 0x6d, 0x65, 0x61, 0x6e, 0x74, 0x20, 0x74,
- 0x68, 0x61, 0x74, 0x6c, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65,
- 0x2d, 0x2d, 0x3e, 0x0d, 0x0a, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x3c, 0x66, 0x69,
- 0x65, 0x6c, 0x64, 0x73, 0x65, 0x74, 0x3e, 0x41, 0x72, 0x63, 0x68, 0x62, 0x69,
- 0x73, 0x68, 0x6f, 0x70, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x6e,
- 0x6f, 0x62, 0x65, 0x69, 0x6e, 0x67, 0x20, 0x75, 0x73, 0x65, 0x64, 0x61, 0x70,
- 0x70, 0x72, 0x6f, 0x61, 0x63, 0x68, 0x65, 0x73, 0x70, 0x72, 0x69, 0x76, 0x69,
- 0x6c, 0x65, 0x67, 0x65, 0x73, 0x6e, 0x6f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
- 0x3e, 0x0a, 0x72, 0x65, 0x73, 0x75, 0x6c, 0x74, 0x73, 0x20, 0x69, 0x6e, 0x6d,
- 0x61, 0x79, 0x20, 0x62, 0x65, 0x20, 0x74, 0x68, 0x65, 0x45, 0x61, 0x73, 0x74,
- 0x65, 0x72, 0x20, 0x65, 0x67, 0x67, 0x6d, 0x65, 0x63, 0x68, 0x61, 0x6e, 0x69,
- 0x73, 0x6d, 0x73, 0x72, 0x65, 0x61, 0x73, 0x6f, 0x6e, 0x61, 0x62, 0x6c, 0x65,
- 0x50, 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6c,
- 0x6c, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74,
- 0x65, 0x64, 0x22, 0x3e, 0x6e, 0x6f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e,
- 0x0d, 0x2f, 0x69, 0x6e, 0x64, 0x65, 0x78, 0x2e, 0x70, 0x68, 0x70, 0x61, 0x72,
- 0x72, 0x69, 0x76, 0x61, 0x6c, 0x20, 0x6f, 0x66, 0x2d, 0x6a, 0x73, 0x73, 0x64,
- 0x6b, 0x27, 0x29, 0x29, 0x3b, 0x6d, 0x61, 0x6e, 0x61, 0x67, 0x65, 0x64, 0x20,
- 0x74, 0x6f, 0x69, 0x6e, 0x63, 0x6f, 0x6d, 0x70, 0x6c, 0x65, 0x74, 0x65, 0x63,
- 0x61, 0x73, 0x75, 0x61, 0x6c, 0x74, 0x69, 0x65, 0x73, 0x63, 0x6f, 0x6d, 0x70,
- 0x6c, 0x65, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x72, 0x69, 0x73, 0x74, 0x69,
- 0x61, 0x6e, 0x73, 0x53, 0x65, 0x70, 0x74, 0x65, 0x6d, 0x62, 0x65, 0x72, 0x20,
- 0x61, 0x72, 0x69, 0x74, 0x68, 0x6d, 0x65, 0x74, 0x69, 0x63, 0x70, 0x72, 0x6f,
- 0x63, 0x65, 0x64, 0x75, 0x72, 0x65, 0x73, 0x6d, 0x69, 0x67, 0x68, 0x74, 0x20,
- 0x68, 0x61, 0x76, 0x65, 0x50, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x74, 0x69, 0x6f,
- 0x6e, 0x69, 0x74, 0x20, 0x61, 0x70, 0x70, 0x65, 0x61, 0x72, 0x73, 0x50, 0x68,
- 0x69, 0x6c, 0x6f, 0x73, 0x6f, 0x70, 0x68, 0x79, 0x66, 0x72, 0x69, 0x65, 0x6e,
- 0x64, 0x73, 0x68, 0x69, 0x70, 0x6c, 0x65, 0x61, 0x64, 0x69, 0x6e, 0x67, 0x20,
- 0x74, 0x6f, 0x67, 0x69, 0x76, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65, 0x74,
- 0x6f, 0x77, 0x61, 0x72, 0x64, 0x20, 0x74, 0x68, 0x65, 0x67, 0x75, 0x61, 0x72,
- 0x61, 0x6e, 0x74, 0x65, 0x65, 0x64, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e,
- 0x74, 0x65, 0x64, 0x63, 0x6f, 0x6c, 0x6f, 0x72, 0x3a, 0x23, 0x30, 0x30, 0x30,
- 0x76, 0x69, 0x64, 0x65, 0x6f, 0x20, 0x67, 0x61, 0x6d, 0x65, 0x63, 0x6f, 0x6d,
- 0x6d, 0x69, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x72, 0x65, 0x66, 0x6c, 0x65, 0x63,
- 0x74, 0x69, 0x6e, 0x67, 0x63, 0x68, 0x61, 0x6e, 0x67, 0x65, 0x20, 0x74, 0x68,
- 0x65, 0x61, 0x73, 0x73, 0x6f, 0x63, 0x69, 0x61, 0x74, 0x65, 0x64, 0x73, 0x61,
- 0x6e, 0x73, 0x2d, 0x73, 0x65, 0x72, 0x69, 0x66, 0x6f, 0x6e, 0x6b, 0x65, 0x79,
- 0x70, 0x72, 0x65, 0x73, 0x73, 0x3b, 0x20, 0x70, 0x61, 0x64, 0x64, 0x69, 0x6e,
- 0x67, 0x3a, 0x48, 0x65, 0x20, 0x77, 0x61, 0x73, 0x20, 0x74, 0x68, 0x65, 0x75,
- 0x6e, 0x64, 0x65, 0x72, 0x6c, 0x79, 0x69, 0x6e, 0x67, 0x74, 0x79, 0x70, 0x69,
- 0x63, 0x61, 0x6c, 0x6c, 0x79, 0x20, 0x2c, 0x20, 0x61, 0x6e, 0x64, 0x20, 0x74,
- 0x68, 0x65, 0x20, 0x73, 0x72, 0x63, 0x45, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74,
- 0x73, 0x75, 0x63, 0x63, 0x65, 0x73, 0x73, 0x69, 0x76, 0x65, 0x73, 0x69, 0x6e,
- 0x63, 0x65, 0x20, 0x74, 0x68, 0x65, 0x20, 0x73, 0x68, 0x6f, 0x75, 0x6c, 0x64,
- 0x20, 0x62, 0x65, 0x20, 0x6e, 0x65, 0x74, 0x77, 0x6f, 0x72, 0x6b, 0x69, 0x6e,
- 0x67, 0x61, 0x63, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x69, 0x6e, 0x67, 0x75, 0x73,
- 0x65, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x6c, 0x6f, 0x77, 0x65, 0x72,
- 0x20, 0x74, 0x68, 0x61, 0x6e, 0x73, 0x68, 0x6f, 0x77, 0x73, 0x20, 0x74, 0x68,
- 0x61, 0x74, 0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e, 0x3e, 0x0a, 0x09, 0x09, 0x63,
- 0x6f, 0x6d, 0x70, 0x6c, 0x61, 0x69, 0x6e, 0x74, 0x73, 0x63, 0x6f, 0x6e, 0x74,
- 0x69, 0x6e, 0x75, 0x6f, 0x75, 0x73, 0x71, 0x75, 0x61, 0x6e, 0x74, 0x69, 0x74,
- 0x69, 0x65, 0x73, 0x61, 0x73, 0x74, 0x72, 0x6f, 0x6e, 0x6f, 0x6d, 0x65, 0x72,
- 0x68, 0x65, 0x20, 0x64, 0x69, 0x64, 0x20, 0x6e, 0x6f, 0x74, 0x64, 0x75, 0x65,
- 0x20, 0x74, 0x6f, 0x20, 0x69, 0x74, 0x73, 0x61, 0x70, 0x70, 0x6c, 0x69, 0x65,
- 0x64, 0x20, 0x74, 0x6f, 0x61, 0x6e, 0x20, 0x61, 0x76, 0x65, 0x72, 0x61, 0x67,
- 0x65, 0x65, 0x66, 0x66, 0x6f, 0x72, 0x74, 0x73, 0x20, 0x74, 0x6f, 0x74, 0x68,
- 0x65, 0x20, 0x66, 0x75, 0x74, 0x75, 0x72, 0x65, 0x61, 0x74, 0x74, 0x65, 0x6d,
- 0x70, 0x74, 0x20, 0x74, 0x6f, 0x54, 0x68, 0x65, 0x72, 0x65, 0x66, 0x6f, 0x72,
- 0x65, 0x2c, 0x63, 0x61, 0x70, 0x61, 0x62, 0x69, 0x6c, 0x69, 0x74, 0x79, 0x52,
- 0x65, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x63, 0x61, 0x6e, 0x77, 0x61, 0x73, 0x20,
- 0x66, 0x6f, 0x72, 0x6d, 0x65, 0x64, 0x45, 0x6c, 0x65, 0x63, 0x74, 0x72, 0x6f,
- 0x6e, 0x69, 0x63, 0x6b, 0x69, 0x6c, 0x6f, 0x6d, 0x65, 0x74, 0x65, 0x72, 0x73,
- 0x63, 0x68, 0x61, 0x6c, 0x6c, 0x65, 0x6e, 0x67, 0x65, 0x73, 0x70, 0x75, 0x62,
- 0x6c, 0x69, 0x73, 0x68, 0x69, 0x6e, 0x67, 0x74, 0x68, 0x65, 0x20, 0x66, 0x6f,
- 0x72, 0x6d, 0x65, 0x72, 0x69, 0x6e, 0x64, 0x69, 0x67, 0x65, 0x6e, 0x6f, 0x75,
- 0x73, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x73, 0x75,
- 0x62, 0x73, 0x69, 0x64, 0x69, 0x61, 0x72, 0x79, 0x63, 0x6f, 0x6e, 0x73, 0x70,
- 0x69, 0x72, 0x61, 0x63, 0x79, 0x64, 0x65, 0x74, 0x61, 0x69, 0x6c, 0x73, 0x20,
- 0x6f, 0x66, 0x61, 0x6e, 0x64, 0x20, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x61,
- 0x66, 0x66, 0x6f, 0x72, 0x64, 0x61, 0x62, 0x6c, 0x65, 0x73, 0x75, 0x62, 0x73,
- 0x74, 0x61, 0x6e, 0x63, 0x65, 0x73, 0x72, 0x65, 0x61, 0x73, 0x6f, 0x6e, 0x20,
- 0x66, 0x6f, 0x72, 0x63, 0x6f, 0x6e, 0x76, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e,
- 0x69, 0x74, 0x65, 0x6d, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x61, 0x62, 0x73,
- 0x6f, 0x6c, 0x75, 0x74, 0x65, 0x6c, 0x79, 0x73, 0x75, 0x70, 0x70, 0x6f, 0x73,
- 0x65, 0x64, 0x6c, 0x79, 0x72, 0x65, 0x6d, 0x61, 0x69, 0x6e, 0x65, 0x64, 0x20,
- 0x61, 0x61, 0x74, 0x74, 0x72, 0x61, 0x63, 0x74, 0x69, 0x76, 0x65, 0x74, 0x72,
- 0x61, 0x76, 0x65, 0x6c, 0x6c, 0x69, 0x6e, 0x67, 0x73, 0x65, 0x70, 0x61, 0x72,
- 0x61, 0x74, 0x65, 0x6c, 0x79, 0x66, 0x6f, 0x63, 0x75, 0x73, 0x65, 0x73, 0x20,
- 0x6f, 0x6e, 0x65, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x72, 0x79, 0x61,
- 0x70, 0x70, 0x6c, 0x69, 0x63, 0x61, 0x62, 0x6c, 0x65, 0x66, 0x6f, 0x75, 0x6e,
- 0x64, 0x20, 0x74, 0x68, 0x61, 0x74, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x73, 0x68,
- 0x65, 0x65, 0x74, 0x6d, 0x61, 0x6e, 0x75, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
- 0x73, 0x74, 0x61, 0x6e, 0x64, 0x73, 0x20, 0x66, 0x6f, 0x72, 0x20, 0x6e, 0x6f,
- 0x2d, 0x72, 0x65, 0x70, 0x65, 0x61, 0x74, 0x28, 0x73, 0x6f, 0x6d, 0x65, 0x74,
- 0x69, 0x6d, 0x65, 0x73, 0x43, 0x6f, 0x6d, 0x6d, 0x65, 0x72, 0x63, 0x69, 0x61,
- 0x6c, 0x69, 0x6e, 0x20, 0x41, 0x6d, 0x65, 0x72, 0x69, 0x63, 0x61, 0x75, 0x6e,
- 0x64, 0x65, 0x72, 0x74, 0x61, 0x6b, 0x65, 0x6e, 0x71, 0x75, 0x61, 0x72, 0x74,
- 0x65, 0x72, 0x20, 0x6f, 0x66, 0x61, 0x6e, 0x20, 0x65, 0x78, 0x61, 0x6d, 0x70,
- 0x6c, 0x65, 0x70, 0x65, 0x72, 0x73, 0x6f, 0x6e, 0x61, 0x6c, 0x6c, 0x79, 0x69,
- 0x6e, 0x64, 0x65, 0x78, 0x2e, 0x70, 0x68, 0x70, 0x3f, 0x3c, 0x2f, 0x62, 0x75,
- 0x74, 0x74, 0x6f, 0x6e, 0x3e, 0x0a, 0x70, 0x65, 0x72, 0x63, 0x65, 0x6e, 0x74,
- 0x61, 0x67, 0x65, 0x62, 0x65, 0x73, 0x74, 0x2d, 0x6b, 0x6e, 0x6f, 0x77, 0x6e,
- 0x63, 0x72, 0x65, 0x61, 0x74, 0x69, 0x6e, 0x67, 0x20, 0x61, 0x22, 0x20, 0x64,
- 0x69, 0x72, 0x3d, 0x22, 0x6c, 0x74, 0x72, 0x4c, 0x69, 0x65, 0x75, 0x74, 0x65,
- 0x6e, 0x61, 0x6e, 0x74, 0x0a, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x69, 0x64, 0x3d,
- 0x22, 0x74, 0x68, 0x65, 0x79, 0x20, 0x77, 0x6f, 0x75, 0x6c, 0x64, 0x61, 0x62,
- 0x69, 0x6c, 0x69, 0x74, 0x79, 0x20, 0x6f, 0x66, 0x6d, 0x61, 0x64, 0x65, 0x20,
- 0x75, 0x70, 0x20, 0x6f, 0x66, 0x6e, 0x6f, 0x74, 0x65, 0x64, 0x20, 0x74, 0x68,
- 0x61, 0x74, 0x63, 0x6c, 0x65, 0x61, 0x72, 0x20, 0x74, 0x68, 0x61, 0x74, 0x61,
- 0x72, 0x67, 0x75, 0x65, 0x20, 0x74, 0x68, 0x61, 0x74, 0x74, 0x6f, 0x20, 0x61,
- 0x6e, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x63, 0x68, 0x69, 0x6c, 0x64, 0x72, 0x65,
- 0x6e, 0x27, 0x73, 0x70, 0x75, 0x72, 0x70, 0x6f, 0x73, 0x65, 0x20, 0x6f, 0x66,
- 0x66, 0x6f, 0x72, 0x6d, 0x75, 0x6c, 0x61, 0x74, 0x65, 0x64, 0x62, 0x61, 0x73,
- 0x65, 0x64, 0x20, 0x75, 0x70, 0x6f, 0x6e, 0x74, 0x68, 0x65, 0x20, 0x72, 0x65,
- 0x67, 0x69, 0x6f, 0x6e, 0x73, 0x75, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x20, 0x6f,
- 0x66, 0x70, 0x61, 0x73, 0x73, 0x65, 0x6e, 0x67, 0x65, 0x72, 0x73, 0x70, 0x6f,
- 0x73, 0x73, 0x65, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x2e, 0x0a, 0x0a, 0x49, 0x6e,
- 0x20, 0x74, 0x68, 0x65, 0x20, 0x42, 0x65, 0x66, 0x6f, 0x72, 0x65, 0x20, 0x74,
- 0x68, 0x65, 0x61, 0x66, 0x74, 0x65, 0x72, 0x77, 0x61, 0x72, 0x64, 0x73, 0x63,
- 0x75, 0x72, 0x72, 0x65, 0x6e, 0x74, 0x6c, 0x79, 0x20, 0x61, 0x63, 0x72, 0x6f,
- 0x73, 0x73, 0x20, 0x74, 0x68, 0x65, 0x73, 0x63, 0x69, 0x65, 0x6e, 0x74, 0x69,
- 0x66, 0x69, 0x63, 0x63, 0x6f, 0x6d, 0x6d, 0x75, 0x6e, 0x69, 0x74, 0x79, 0x2e,
- 0x63, 0x61, 0x70, 0x69, 0x74, 0x61, 0x6c, 0x69, 0x73, 0x6d, 0x69, 0x6e, 0x20,
- 0x47, 0x65, 0x72, 0x6d, 0x61, 0x6e, 0x79, 0x72, 0x69, 0x67, 0x68, 0x74, 0x2d,
- 0x77, 0x69, 0x6e, 0x67, 0x74, 0x68, 0x65, 0x20, 0x73, 0x79, 0x73, 0x74, 0x65,
- 0x6d, 0x53, 0x6f, 0x63, 0x69, 0x65, 0x74, 0x79, 0x20, 0x6f, 0x66, 0x70, 0x6f,
- 0x6c, 0x69, 0x74, 0x69, 0x63, 0x69, 0x61, 0x6e, 0x64, 0x69, 0x72, 0x65, 0x63,
- 0x74, 0x69, 0x6f, 0x6e, 0x3a, 0x77, 0x65, 0x6e, 0x74, 0x20, 0x6f, 0x6e, 0x20,
- 0x74, 0x6f, 0x72, 0x65, 0x6d, 0x6f, 0x76, 0x61, 0x6c, 0x20, 0x6f, 0x66, 0x20,
- 0x4e, 0x65, 0x77, 0x20, 0x59, 0x6f, 0x72, 0x6b, 0x20, 0x61, 0x70, 0x61, 0x72,
- 0x74, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x69, 0x6e, 0x64, 0x69, 0x63, 0x61, 0x74,
- 0x69, 0x6f, 0x6e, 0x64, 0x75, 0x72, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65,
- 0x75, 0x6e, 0x6c, 0x65, 0x73, 0x73, 0x20, 0x74, 0x68, 0x65, 0x68, 0x69, 0x73,
- 0x74, 0x6f, 0x72, 0x69, 0x63, 0x61, 0x6c, 0x68, 0x61, 0x64, 0x20, 0x62, 0x65,
- 0x65, 0x6e, 0x20, 0x61, 0x64, 0x65, 0x66, 0x69, 0x6e, 0x69, 0x74, 0x69, 0x76,
- 0x65, 0x69, 0x6e, 0x67, 0x72, 0x65, 0x64, 0x69, 0x65, 0x6e, 0x74, 0x61, 0x74,
- 0x74, 0x65, 0x6e, 0x64, 0x61, 0x6e, 0x63, 0x65, 0x43, 0x65, 0x6e, 0x74, 0x65,
- 0x72, 0x20, 0x66, 0x6f, 0x72, 0x70, 0x72, 0x6f, 0x6d, 0x69, 0x6e, 0x65, 0x6e,
- 0x63, 0x65, 0x72, 0x65, 0x61, 0x64, 0x79, 0x53, 0x74, 0x61, 0x74, 0x65, 0x73,
- 0x74, 0x72, 0x61, 0x74, 0x65, 0x67, 0x69, 0x65, 0x73, 0x62, 0x75, 0x74, 0x20,
- 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x61, 0x73, 0x20, 0x70, 0x61, 0x72, 0x74,
- 0x20, 0x6f, 0x66, 0x63, 0x6f, 0x6e, 0x73, 0x74, 0x69, 0x74, 0x75, 0x74, 0x65,
- 0x63, 0x6c, 0x61, 0x69, 0x6d, 0x20, 0x74, 0x68, 0x61, 0x74, 0x6c, 0x61, 0x62,
- 0x6f, 0x72, 0x61, 0x74, 0x6f, 0x72, 0x79, 0x63, 0x6f, 0x6d, 0x70, 0x61, 0x74,
- 0x69, 0x62, 0x6c, 0x65, 0x66, 0x61, 0x69, 0x6c, 0x75, 0x72, 0x65, 0x20, 0x6f,
- 0x66, 0x2c, 0x20, 0x73, 0x75, 0x63, 0x68, 0x20, 0x61, 0x73, 0x20, 0x62, 0x65,
- 0x67, 0x61, 0x6e, 0x20, 0x77, 0x69, 0x74, 0x68, 0x75, 0x73, 0x69, 0x6e, 0x67,
- 0x20, 0x74, 0x68, 0x65, 0x20, 0x74, 0x6f, 0x20, 0x70, 0x72, 0x6f, 0x76, 0x69,
- 0x64, 0x65, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x20, 0x6f, 0x66, 0x66,
- 0x72, 0x6f, 0x6d, 0x20, 0x77, 0x68, 0x69, 0x63, 0x68, 0x2f, 0x22, 0x20, 0x63,
- 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x67, 0x65, 0x6f, 0x6c, 0x6f, 0x67, 0x69,
- 0x63, 0x61, 0x6c, 0x73, 0x65, 0x76, 0x65, 0x72, 0x61, 0x6c, 0x20, 0x6f, 0x66,
- 0x64, 0x65, 0x6c, 0x69, 0x62, 0x65, 0x72, 0x61, 0x74, 0x65, 0x69, 0x6d, 0x70,
- 0x6f, 0x72, 0x74, 0x61, 0x6e, 0x74, 0x20, 0x68, 0x6f, 0x6c, 0x64, 0x73, 0x20,
- 0x74, 0x68, 0x61, 0x74, 0x69, 0x6e, 0x67, 0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b,
- 0x20, 0x76, 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3d, 0x74, 0x6f, 0x70, 0x74, 0x68,
- 0x65, 0x20, 0x47, 0x65, 0x72, 0x6d, 0x61, 0x6e, 0x6f, 0x75, 0x74, 0x73, 0x69,
- 0x64, 0x65, 0x20, 0x6f, 0x66, 0x6e, 0x65, 0x67, 0x6f, 0x74, 0x69, 0x61, 0x74,
- 0x65, 0x64, 0x68, 0x69, 0x73, 0x20, 0x63, 0x61, 0x72, 0x65, 0x65, 0x72, 0x73,
- 0x65, 0x70, 0x61, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x69, 0x64, 0x3d, 0x22,
- 0x73, 0x65, 0x61, 0x72, 0x63, 0x68, 0x77, 0x61, 0x73, 0x20, 0x63, 0x61, 0x6c,
- 0x6c, 0x65, 0x64, 0x74, 0x68, 0x65, 0x20, 0x66, 0x6f, 0x75, 0x72, 0x74, 0x68,
- 0x72, 0x65, 0x63, 0x72, 0x65, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x6f, 0x74, 0x68,
- 0x65, 0x72, 0x20, 0x74, 0x68, 0x61, 0x6e, 0x70, 0x72, 0x65, 0x76, 0x65, 0x6e,
- 0x74, 0x69, 0x6f, 0x6e, 0x77, 0x68, 0x69, 0x6c, 0x65, 0x20, 0x74, 0x68, 0x65,
- 0x20, 0x65, 0x64, 0x75, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2c, 0x63, 0x6f,
- 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6e, 0x67, 0x61, 0x63, 0x63, 0x75, 0x72,
- 0x61, 0x74, 0x65, 0x6c, 0x79, 0x77, 0x65, 0x72, 0x65, 0x20, 0x62, 0x75, 0x69,
- 0x6c, 0x74, 0x77, 0x61, 0x73, 0x20, 0x6b, 0x69, 0x6c, 0x6c, 0x65, 0x64, 0x61,
- 0x67, 0x72, 0x65, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x6d, 0x75, 0x63, 0x68,
- 0x20, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x44, 0x75, 0x65, 0x20, 0x74, 0x6f, 0x20,
- 0x74, 0x68, 0x65, 0x77, 0x69, 0x64, 0x74, 0x68, 0x3a, 0x20, 0x31, 0x30, 0x30,
- 0x73, 0x6f, 0x6d, 0x65, 0x20, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x4b, 0x69, 0x6e,
- 0x67, 0x64, 0x6f, 0x6d, 0x20, 0x6f, 0x66, 0x74, 0x68, 0x65, 0x20, 0x65, 0x6e,
- 0x74, 0x69, 0x72, 0x65, 0x66, 0x61, 0x6d, 0x6f, 0x75, 0x73, 0x20, 0x66, 0x6f,
- 0x72, 0x74, 0x6f, 0x20, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x6f, 0x62,
- 0x6a, 0x65, 0x63, 0x74, 0x69, 0x76, 0x65, 0x73, 0x74, 0x68, 0x65, 0x20, 0x46,
- 0x72, 0x65, 0x6e, 0x63, 0x68, 0x70, 0x65, 0x6f, 0x70, 0x6c, 0x65, 0x20, 0x61,
- 0x6e, 0x64, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x64, 0x22, 0x3e, 0x69,
- 0x73, 0x20, 0x73, 0x61, 0x69, 0x64, 0x20, 0x74, 0x6f, 0x73, 0x74, 0x72, 0x75,
- 0x63, 0x74, 0x75, 0x72, 0x61, 0x6c, 0x72, 0x65, 0x66, 0x65, 0x72, 0x65, 0x6e,
- 0x64, 0x75, 0x6d, 0x6d, 0x6f, 0x73, 0x74, 0x20, 0x6f, 0x66, 0x74, 0x65, 0x6e,
- 0x61, 0x20, 0x73, 0x65, 0x70, 0x61, 0x72, 0x61, 0x74, 0x65, 0x2d, 0x3e, 0x0a,
- 0x3c, 0x64, 0x69, 0x76, 0x20, 0x69, 0x64, 0x20, 0x4f, 0x66, 0x66, 0x69, 0x63,
- 0x69, 0x61, 0x6c, 0x20, 0x77, 0x6f, 0x72, 0x6c, 0x64, 0x77, 0x69, 0x64, 0x65,
- 0x2e, 0x61, 0x72, 0x69, 0x61, 0x2d, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x74, 0x68,
- 0x65, 0x20, 0x70, 0x6c, 0x61, 0x6e, 0x65, 0x74, 0x61, 0x6e, 0x64, 0x20, 0x69,
- 0x74, 0x20, 0x77, 0x61, 0x73, 0x64, 0x22, 0x20, 0x76, 0x61, 0x6c, 0x75, 0x65,
- 0x3d, 0x22, 0x6c, 0x6f, 0x6f, 0x6b, 0x69, 0x6e, 0x67, 0x20, 0x61, 0x74, 0x62,
- 0x65, 0x6e, 0x65, 0x66, 0x69, 0x63, 0x69, 0x61, 0x6c, 0x61, 0x72, 0x65, 0x20,
- 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72,
- 0x69, 0x6e, 0x67, 0x72, 0x65, 0x70, 0x6f, 0x72, 0x74, 0x65, 0x64, 0x6c, 0x79,
- 0x74, 0x68, 0x65, 0x20, 0x6d, 0x6f, 0x64, 0x65, 0x72, 0x6e, 0x77, 0x6f, 0x72,
- 0x6b, 0x69, 0x6e, 0x67, 0x20, 0x6f, 0x6e, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x65,
- 0x64, 0x20, 0x74, 0x6f, 0x77, 0x68, 0x65, 0x72, 0x65, 0x20, 0x74, 0x68, 0x65,
- 0x20, 0x69, 0x6e, 0x6e, 0x6f, 0x76, 0x61, 0x74, 0x69, 0x76, 0x65, 0x3c, 0x2f,
- 0x61, 0x3e, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x73, 0x6f, 0x75, 0x6e, 0x64,
- 0x74, 0x72, 0x61, 0x63, 0x6b, 0x73, 0x65, 0x61, 0x72, 0x63, 0x68, 0x46, 0x6f,
- 0x72, 0x6d, 0x74, 0x65, 0x6e, 0x64, 0x20, 0x74, 0x6f, 0x20, 0x62, 0x65, 0x69,
- 0x6e, 0x70, 0x75, 0x74, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x6f, 0x70, 0x65, 0x6e,
- 0x69, 0x6e, 0x67, 0x20, 0x6f, 0x66, 0x72, 0x65, 0x73, 0x74, 0x72, 0x69, 0x63,
- 0x74, 0x65, 0x64, 0x61, 0x64, 0x6f, 0x70, 0x74, 0x65, 0x64, 0x20, 0x62, 0x79,
- 0x61, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x69, 0x6e, 0x67, 0x74, 0x68, 0x65,
- 0x6f, 0x6c, 0x6f, 0x67, 0x69, 0x61, 0x6e, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64,
- 0x73, 0x20, 0x6f, 0x66, 0x76, 0x61, 0x72, 0x69, 0x61, 0x6e, 0x74, 0x20, 0x6f,
- 0x66, 0x43, 0x68, 0x72, 0x69, 0x73, 0x74, 0x69, 0x61, 0x6e, 0x20, 0x76, 0x65,
- 0x72, 0x79, 0x20, 0x6c, 0x61, 0x72, 0x67, 0x65, 0x61, 0x75, 0x74, 0x6f, 0x6d,
- 0x6f, 0x74, 0x69, 0x76, 0x65, 0x62, 0x79, 0x20, 0x66, 0x61, 0x72, 0x20, 0x74,
- 0x68, 0x65, 0x72, 0x61, 0x6e, 0x67, 0x65, 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x70,
- 0x75, 0x72, 0x73, 0x75, 0x69, 0x74, 0x20, 0x6f, 0x66, 0x66, 0x6f, 0x6c, 0x6c,
- 0x6f, 0x77, 0x20, 0x74, 0x68, 0x65, 0x62, 0x72, 0x6f, 0x75, 0x67, 0x68, 0x74,
- 0x20, 0x74, 0x6f, 0x69, 0x6e, 0x20, 0x45, 0x6e, 0x67, 0x6c, 0x61, 0x6e, 0x64,
- 0x61, 0x67, 0x72, 0x65, 0x65, 0x20, 0x74, 0x68, 0x61, 0x74, 0x61, 0x63, 0x63,
- 0x75, 0x73, 0x65, 0x64, 0x20, 0x6f, 0x66, 0x63, 0x6f, 0x6d, 0x65, 0x73, 0x20,
- 0x66, 0x72, 0x6f, 0x6d, 0x70, 0x72, 0x65, 0x76, 0x65, 0x6e, 0x74, 0x69, 0x6e,
- 0x67, 0x64, 0x69, 0x76, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x68, 0x69,
- 0x73, 0x20, 0x6f, 0x72, 0x20, 0x68, 0x65, 0x72, 0x74, 0x72, 0x65, 0x6d, 0x65,
- 0x6e, 0x64, 0x6f, 0x75, 0x73, 0x66, 0x72, 0x65, 0x65, 0x64, 0x6f, 0x6d, 0x20,
- 0x6f, 0x66, 0x63, 0x6f, 0x6e, 0x63, 0x65, 0x72, 0x6e, 0x69, 0x6e, 0x67, 0x30,
- 0x20, 0x31, 0x65, 0x6d, 0x20, 0x31, 0x65, 0x6d, 0x3b, 0x42, 0x61, 0x73, 0x6b,
- 0x65, 0x74, 0x62, 0x61, 0x6c, 0x6c, 0x2f, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x2e,
- 0x63, 0x73, 0x73, 0x61, 0x6e, 0x20, 0x65, 0x61, 0x72, 0x6c, 0x69, 0x65, 0x72,
- 0x65, 0x76, 0x65, 0x6e, 0x20, 0x61, 0x66, 0x74, 0x65, 0x72, 0x2f, 0x22, 0x20,
- 0x74, 0x69, 0x74, 0x6c, 0x65, 0x3d, 0x22, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x69,
- 0x6e, 0x64, 0x65, 0x78, 0x74, 0x61, 0x6b, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68,
- 0x65, 0x70, 0x69, 0x74, 0x74, 0x73, 0x62, 0x75, 0x72, 0x67, 0x68, 0x63, 0x6f,
- 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x22, 0x3e, 0x0d, 0x3c, 0x73, 0x63, 0x72, 0x69,
- 0x70, 0x74, 0x3e, 0x28, 0x66, 0x74, 0x75, 0x72, 0x6e, 0x65, 0x64, 0x20, 0x6f,
- 0x75, 0x74, 0x68, 0x61, 0x76, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65, 0x3c,
- 0x2f, 0x73, 0x70, 0x61, 0x6e, 0x3e, 0x0d, 0x0a, 0x20, 0x6f, 0x63, 0x63, 0x61,
- 0x73, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x62, 0x65, 0x63, 0x61, 0x75, 0x73, 0x65,
- 0x20, 0x69, 0x74, 0x73, 0x74, 0x61, 0x72, 0x74, 0x65, 0x64, 0x20, 0x74, 0x6f,
- 0x70, 0x68, 0x79, 0x73, 0x69, 0x63, 0x61, 0x6c, 0x6c, 0x79, 0x3e, 0x3c, 0x2f,
- 0x64, 0x69, 0x76, 0x3e, 0x0a, 0x20, 0x20, 0x63, 0x72, 0x65, 0x61, 0x74, 0x65,
- 0x64, 0x20, 0x62, 0x79, 0x43, 0x75, 0x72, 0x72, 0x65, 0x6e, 0x74, 0x6c, 0x79,
- 0x2c, 0x20, 0x62, 0x67, 0x63, 0x6f, 0x6c, 0x6f, 0x72, 0x3d, 0x22, 0x74, 0x61,
- 0x62, 0x69, 0x6e, 0x64, 0x65, 0x78, 0x3d, 0x22, 0x64, 0x69, 0x73, 0x61, 0x73,
- 0x74, 0x72, 0x6f, 0x75, 0x73, 0x41, 0x6e, 0x61, 0x6c, 0x79, 0x74, 0x69, 0x63,
- 0x73, 0x20, 0x61, 0x6c, 0x73, 0x6f, 0x20, 0x68, 0x61, 0x73, 0x20, 0x61, 0x3e,
- 0x3c, 0x64, 0x69, 0x76, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x3c, 0x2f, 0x73, 0x74,
- 0x79, 0x6c, 0x65, 0x3e, 0x0a, 0x3c, 0x63, 0x61, 0x6c, 0x6c, 0x65, 0x64, 0x20,
- 0x66, 0x6f, 0x72, 0x73, 0x69, 0x6e, 0x67, 0x65, 0x72, 0x20, 0x61, 0x6e, 0x64,
- 0x2e, 0x73, 0x72, 0x63, 0x20, 0x3d, 0x20, 0x22, 0x2f, 0x2f, 0x76, 0x69, 0x6f,
- 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x74, 0x68, 0x69, 0x73, 0x20, 0x70,
- 0x6f, 0x69, 0x6e, 0x74, 0x63, 0x6f, 0x6e, 0x73, 0x74, 0x61, 0x6e, 0x74, 0x6c,
- 0x79, 0x69, 0x73, 0x20, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x65, 0x64, 0x72, 0x65,
- 0x63, 0x6f, 0x72, 0x64, 0x69, 0x6e, 0x67, 0x73, 0x64, 0x20, 0x66, 0x72, 0x6f,
- 0x6d, 0x20, 0x74, 0x68, 0x65, 0x6e, 0x65, 0x64, 0x65, 0x72, 0x6c, 0x61, 0x6e,
- 0x64, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x75, 0x67, 0x75, 0xc3, 0xaa, 0x73, 0xd7,
- 0xa2, 0xd7, 0x91, 0xd7, 0xa8, 0xd7, 0x99, 0xd7, 0xaa, 0xd9, 0x81, 0xd8, 0xa7,
- 0xd8, 0xb1, 0xd8, 0xb3, 0xdb, 0x8c, 0x64, 0x65, 0x73, 0x61, 0x72, 0x72, 0x6f,
- 0x6c, 0x6c, 0x6f, 0x63, 0x6f, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x72, 0x69, 0x6f,
- 0x65, 0x64, 0x75, 0x63, 0x61, 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x73, 0x65, 0x70,
- 0x74, 0x69, 0x65, 0x6d, 0x62, 0x72, 0x65, 0x72, 0x65, 0x67, 0x69, 0x73, 0x74,
- 0x72, 0x61, 0x64, 0x6f, 0x64, 0x69, 0x72, 0x65, 0x63, 0x63, 0x69, 0xc3, 0xb3,
- 0x6e, 0x75, 0x62, 0x69, 0x63, 0x61, 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x70, 0x75,
- 0x62, 0x6c, 0x69, 0x63, 0x69, 0x64, 0x61, 0x64, 0x72, 0x65, 0x73, 0x70, 0x75,
- 0x65, 0x73, 0x74, 0x61, 0x73, 0x72, 0x65, 0x73, 0x75, 0x6c, 0x74, 0x61, 0x64,
- 0x6f, 0x73, 0x69, 0x6d, 0x70, 0x6f, 0x72, 0x74, 0x61, 0x6e, 0x74, 0x65, 0x72,
- 0x65, 0x73, 0x65, 0x72, 0x76, 0x61, 0x64, 0x6f, 0x73, 0x61, 0x72, 0x74, 0xc3,
- 0xad, 0x63, 0x75, 0x6c, 0x6f, 0x73, 0x64, 0x69, 0x66, 0x65, 0x72, 0x65, 0x6e,
- 0x74, 0x65, 0x73, 0x73, 0x69, 0x67, 0x75, 0x69, 0x65, 0x6e, 0x74, 0x65, 0x73,
- 0x72, 0x65, 0x70, 0xc3, 0xba, 0x62, 0x6c, 0x69, 0x63, 0x61, 0x73, 0x69, 0x74,
- 0x75, 0x61, 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x6d, 0x69, 0x6e, 0x69, 0x73, 0x74,
- 0x65, 0x72, 0x69, 0x6f, 0x70, 0x72, 0x69, 0x76, 0x61, 0x63, 0x69, 0x64, 0x61,
- 0x64, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x69, 0x6f, 0x66, 0x6f,
- 0x72, 0x6d, 0x61, 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x70, 0x6f, 0x62, 0x6c, 0x61,
- 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x70, 0x72, 0x65, 0x73, 0x69, 0x64, 0x65, 0x6e,
- 0x74, 0x65, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x69, 0x64, 0x6f, 0x73, 0x61,
- 0x63, 0x63, 0x65, 0x73, 0x6f, 0x72, 0x69, 0x6f, 0x73, 0x74, 0x65, 0x63, 0x68,
- 0x6e, 0x6f, 0x72, 0x61, 0x74, 0x69, 0x70, 0x65, 0x72, 0x73, 0x6f, 0x6e, 0x61,
- 0x6c, 0x65, 0x73, 0x63, 0x61, 0x74, 0x65, 0x67, 0x6f, 0x72, 0xc3, 0xad, 0x61,
- 0x65, 0x73, 0x70, 0x65, 0x63, 0x69, 0x61, 0x6c, 0x65, 0x73, 0x64, 0x69, 0x73,
- 0x70, 0x6f, 0x6e, 0x69, 0x62, 0x6c, 0x65, 0x61, 0x63, 0x74, 0x75, 0x61, 0x6c,
- 0x69, 0x64, 0x61, 0x64, 0x72, 0x65, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63, 0x69,
- 0x61, 0x76, 0x61, 0x6c, 0x6c, 0x61, 0x64, 0x6f, 0x6c, 0x69, 0x64, 0x62, 0x69,
- 0x62, 0x6c, 0x69, 0x6f, 0x74, 0x65, 0x63, 0x61, 0x72, 0x65, 0x6c, 0x61, 0x63,
- 0x69, 0x6f, 0x6e, 0x65, 0x73, 0x63, 0x61, 0x6c, 0x65, 0x6e, 0x64, 0x61, 0x72,
- 0x69, 0x6f, 0x70, 0x6f, 0x6c, 0xc3, 0xad, 0x74, 0x69, 0x63, 0x61, 0x73, 0x61,
- 0x6e, 0x74, 0x65, 0x72, 0x69, 0x6f, 0x72, 0x65, 0x73, 0x64, 0x6f, 0x63, 0x75,
- 0x6d, 0x65, 0x6e, 0x74, 0x6f, 0x73, 0x6e, 0x61, 0x74, 0x75, 0x72, 0x61, 0x6c,
- 0x65, 0x7a, 0x61, 0x6d, 0x61, 0x74, 0x65, 0x72, 0x69, 0x61, 0x6c, 0x65, 0x73,
- 0x64, 0x69, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63, 0x69, 0x61, 0x65, 0x63, 0x6f,
- 0x6e, 0xc3, 0xb3, 0x6d, 0x69, 0x63, 0x61, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70,
- 0x6f, 0x72, 0x74, 0x65, 0x72, 0x6f, 0x64, 0x72, 0xc3, 0xad, 0x67, 0x75, 0x65,
- 0x7a, 0x70, 0x61, 0x72, 0x74, 0x69, 0x63, 0x69, 0x70, 0x61, 0x72, 0x65, 0x6e,
- 0x63, 0x75, 0x65, 0x6e, 0x74, 0x72, 0x61, 0x6e, 0x64, 0x69, 0x73, 0x63, 0x75,
- 0x73, 0x69, 0xc3, 0xb3, 0x6e, 0x65, 0x73, 0x74, 0x72, 0x75, 0x63, 0x74, 0x75,
- 0x72, 0x61, 0x66, 0x75, 0x6e, 0x64, 0x61, 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x66,
- 0x72, 0x65, 0x63, 0x75, 0x65, 0x6e, 0x74, 0x65, 0x73, 0x70, 0x65, 0x72, 0x6d,
- 0x61, 0x6e, 0x65, 0x6e, 0x74, 0x65, 0x74, 0x6f, 0x74, 0x61, 0x6c, 0x6d, 0x65,
- 0x6e, 0x74, 0x65, 0xd0, 0xbc, 0xd0, 0xbe, 0xd0, 0xb6, 0xd0, 0xbd, 0xd0, 0xbe,
- 0xd0, 0xb1, 0xd1, 0x83, 0xd0, 0xb4, 0xd0, 0xb5, 0xd1, 0x82, 0xd0, 0xbc, 0xd0,
- 0xbe, 0xd0, 0xb6, 0xd0, 0xb5, 0xd1, 0x82, 0xd0, 0xb2, 0xd1, 0x80, 0xd0, 0xb5,
- 0xd0, 0xbc, 0xd1, 0x8f, 0xd1, 0x82, 0xd0, 0xb0, 0xd0, 0xba, 0xd0, 0xb6, 0xd0,
- 0xb5, 0xd1, 0x87, 0xd1, 0x82, 0xd0, 0xbe, 0xd0, 0xb1, 0xd1, 0x8b, 0xd0, 0xb1,
- 0xd0, 0xbe, 0xd0, 0xbb, 0xd0, 0xb5, 0xd0, 0xb5, 0xd0, 0xbe, 0xd1, 0x87, 0xd0,
- 0xb5, 0xd0, 0xbd, 0xd1, 0x8c, 0xd1, 0x8d, 0xd1, 0x82, 0xd0, 0xbe, 0xd0, 0xb3,
- 0xd0, 0xbe, 0xd0, 0xba, 0xd0, 0xbe, 0xd0, 0xb3, 0xd0, 0xb4, 0xd0, 0xb0, 0xd0,
- 0xbf, 0xd0, 0xbe, 0xd1, 0x81, 0xd0, 0xbb, 0xd0, 0xb5, 0xd0, 0xb2, 0xd1, 0x81,
- 0xd0, 0xb5, 0xd0, 0xb3, 0xd0, 0xbe, 0xd1, 0x81, 0xd0, 0xb0, 0xd0, 0xb9, 0xd1,
- 0x82, 0xd0, 0xb5, 0xd1, 0x87, 0xd0, 0xb5, 0xd1, 0x80, 0xd0, 0xb5, 0xd0, 0xb7,
- 0xd0, 0xbc, 0xd0, 0xbe, 0xd0, 0xb3, 0xd1, 0x83, 0xd1, 0x82, 0xd1, 0x81, 0xd0,
- 0xb0, 0xd0, 0xb9, 0xd1, 0x82, 0xd0, 0xb0, 0xd0, 0xb6, 0xd0, 0xb8, 0xd0, 0xb7,
- 0xd0, 0xbd, 0xd0, 0xb8, 0xd0, 0xbc, 0xd0, 0xb5, 0xd0, 0xb6, 0xd0, 0xb4, 0xd1,
- 0x83, 0xd0, 0xb1, 0xd1, 0x83, 0xd0, 0xb4, 0xd1, 0x83, 0xd1, 0x82, 0xd0, 0x9f,
- 0xd0, 0xbe, 0xd0, 0xb8, 0xd1, 0x81, 0xd0, 0xba, 0xd0, 0xb7, 0xd0, 0xb4, 0xd0,
- 0xb5, 0xd1, 0x81, 0xd1, 0x8c, 0xd0, 0xb2, 0xd0, 0xb8, 0xd0, 0xb4, 0xd0, 0xb5,
- 0xd0, 0xbe, 0xd1, 0x81, 0xd0, 0xb2, 0xd1, 0x8f, 0xd0, 0xb7, 0xd0, 0xb8, 0xd0,
- 0xbd, 0xd1, 0x83, 0xd0, 0xb6, 0xd0, 0xbd, 0xd0, 0xbe, 0xd1, 0x81, 0xd0, 0xb2,
- 0xd0, 0xbe, 0xd0, 0xb5, 0xd0, 0xb9, 0xd0, 0xbb, 0xd1, 0x8e, 0xd0, 0xb4, 0xd0,
- 0xb5, 0xd0, 0xb9, 0xd0, 0xbf, 0xd0, 0xbe, 0xd1, 0x80, 0xd0, 0xbd, 0xd0, 0xbe,
- 0xd0, 0xbc, 0xd0, 0xbd, 0xd0, 0xbe, 0xd0, 0xb3, 0xd0, 0xbe, 0xd0, 0xb4, 0xd0,
- 0xb5, 0xd1, 0x82, 0xd0, 0xb5, 0xd0, 0xb9, 0xd1, 0x81, 0xd0, 0xb2, 0xd0, 0xbe,
- 0xd0, 0xb8, 0xd1, 0x85, 0xd0, 0xbf, 0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xb2, 0xd0,
- 0xb0, 0xd1, 0x82, 0xd0, 0xb0, 0xd0, 0xba, 0xd0, 0xbe, 0xd0, 0xb9, 0xd0, 0xbc,
- 0xd0, 0xb5, 0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xbe, 0xd0, 0xb8, 0xd0, 0xbc, 0xd0,
- 0xb5, 0xd0, 0xb5, 0xd1, 0x82, 0xd0, 0xb6, 0xd0, 0xb8, 0xd0, 0xb7, 0xd0, 0xbd,
- 0xd1, 0x8c, 0xd0, 0xbe, 0xd0, 0xb4, 0xd0, 0xbd, 0xd0, 0xbe, 0xd0, 0xb9, 0xd0,
- 0xbb, 0xd1, 0x83, 0xd1, 0x87, 0xd1, 0x88, 0xd0, 0xb5, 0xd0, 0xbf, 0xd0, 0xb5,
- 0xd1, 0x80, 0xd0, 0xb5, 0xd0, 0xb4, 0xd1, 0x87, 0xd0, 0xb0, 0xd1, 0x81, 0xd1,
- 0x82, 0xd0, 0xb8, 0xd1, 0x87, 0xd0, 0xb0, 0xd1, 0x81, 0xd1, 0x82, 0xd1, 0x8c,
- 0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xb1, 0xd0, 0xbe, 0xd1, 0x82, 0xd0, 0xbd, 0xd0,
- 0xbe, 0xd0, 0xb2, 0xd1, 0x8b, 0xd1, 0x85, 0xd0, 0xbf, 0xd1, 0x80, 0xd0, 0xb0,
- 0xd0, 0xb2, 0xd0, 0xbe, 0xd1, 0x81, 0xd0, 0xbe, 0xd0, 0xb1, 0xd0, 0xbe, 0xd0,
- 0xb9, 0xd0, 0xbf, 0xd0, 0xbe, 0xd1, 0x82, 0xd0, 0xbe, 0xd0, 0xbc, 0xd0, 0xbc,
- 0xd0, 0xb5, 0xd0, 0xbd, 0xd0, 0xb5, 0xd0, 0xb5, 0xd1, 0x87, 0xd0, 0xb8, 0xd1,
- 0x81, 0xd0, 0xbb, 0xd0, 0xb5, 0xd0, 0xbd, 0xd0, 0xbe, 0xd0, 0xb2, 0xd1, 0x8b,
- 0xd0, 0xb5, 0xd1, 0x83, 0xd1, 0x81, 0xd0, 0xbb, 0xd1, 0x83, 0xd0, 0xb3, 0xd0,
- 0xbe, 0xd0, 0xba, 0xd0, 0xbe, 0xd0, 0xbb, 0xd0, 0xbe, 0xd0, 0xbd, 0xd0, 0xb0,
- 0xd0, 0xb7, 0xd0, 0xb0, 0xd0, 0xb4, 0xd1, 0x82, 0xd0, 0xb0, 0xd0, 0xba, 0xd0,
- 0xbe, 0xd0, 0xb5, 0xd1, 0x82, 0xd0, 0xbe, 0xd0, 0xb3, 0xd0, 0xb4, 0xd0, 0xb0,
- 0xd0, 0xbf, 0xd0, 0xbe, 0xd1, 0x87, 0xd1, 0x82, 0xd0, 0xb8, 0xd0, 0x9f, 0xd0,
- 0xbe, 0xd1, 0x81, 0xd0, 0xbb, 0xd0, 0xb5, 0xd1, 0x82, 0xd0, 0xb0, 0xd0, 0xba,
- 0xd0, 0xb8, 0xd0, 0xb5, 0xd0, 0xbd, 0xd0, 0xbe, 0xd0, 0xb2, 0xd1, 0x8b, 0xd0,
- 0xb9, 0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xbe, 0xd0, 0xb8, 0xd1, 0x82, 0xd1, 0x82,
- 0xd0, 0xb0, 0xd0, 0xba, 0xd0, 0xb8, 0xd1, 0x85, 0xd1, 0x81, 0xd1, 0x80, 0xd0,
- 0xb0, 0xd0, 0xb7, 0xd1, 0x83, 0xd0, 0xa1, 0xd0, 0xb0, 0xd0, 0xbd, 0xd0, 0xba,
- 0xd1, 0x82, 0xd1, 0x84, 0xd0, 0xbe, 0xd1, 0x80, 0xd1, 0x83, 0xd0, 0xbc, 0xd0,
- 0x9a, 0xd0, 0xbe, 0xd0, 0xb3, 0xd0, 0xb4, 0xd0, 0xb0, 0xd0, 0xba, 0xd0, 0xbd,
- 0xd0, 0xb8, 0xd0, 0xb3, 0xd0, 0xb8, 0xd1, 0x81, 0xd0, 0xbb, 0xd0, 0xbe, 0xd0,
- 0xb2, 0xd0, 0xb0, 0xd0, 0xbd, 0xd0, 0xb0, 0xd1, 0x88, 0xd0, 0xb5, 0xd0, 0xb9,
- 0xd0, 0xbd, 0xd0, 0xb0, 0xd0, 0xb9, 0xd1, 0x82, 0xd0, 0xb8, 0xd1, 0x81, 0xd0,
- 0xb2, 0xd0, 0xbe, 0xd0, 0xb8, 0xd0, 0xbc, 0xd1, 0x81, 0xd0, 0xb2, 0xd1, 0x8f,
- 0xd0, 0xb7, 0xd1, 0x8c, 0xd0, 0xbb, 0xd1, 0x8e, 0xd0, 0xb1, 0xd0, 0xbe, 0xd0,
- 0xb9, 0xd1, 0x87, 0xd0, 0xb0, 0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xbe, 0xd1, 0x81,
- 0xd1, 0x80, 0xd0, 0xb5, 0xd0, 0xb4, 0xd0, 0xb8, 0xd0, 0x9a, 0xd1, 0x80, 0xd0,
- 0xbe, 0xd0, 0xbc, 0xd0, 0xb5, 0xd0, 0xa4, 0xd0, 0xbe, 0xd1, 0x80, 0xd1, 0x83,
- 0xd0, 0xbc, 0xd1, 0x80, 0xd1, 0x8b, 0xd0, 0xbd, 0xd0, 0xba, 0xd0, 0xb5, 0xd1,
- 0x81, 0xd1, 0x82, 0xd0, 0xb0, 0xd0, 0xbb, 0xd0, 0xb8, 0xd0, 0xbf, 0xd0, 0xbe,
- 0xd0, 0xb8, 0xd1, 0x81, 0xd0, 0xba, 0xd1, 0x82, 0xd1, 0x8b, 0xd1, 0x81, 0xd1,
- 0x8f, 0xd1, 0x87, 0xd0, 0xbc, 0xd0, 0xb5, 0xd1, 0x81, 0xd1, 0x8f, 0xd1, 0x86,
- 0xd1, 0x86, 0xd0, 0xb5, 0xd0, 0xbd, 0xd1, 0x82, 0xd1, 0x80, 0xd1, 0x82, 0xd1,
- 0x80, 0xd1, 0x83, 0xd0, 0xb4, 0xd0, 0xb0, 0xd1, 0x81, 0xd0, 0xb0, 0xd0, 0xbc,
- 0xd1, 0x8b, 0xd1, 0x85, 0xd1, 0x80, 0xd1, 0x8b, 0xd0, 0xbd, 0xd0, 0xba, 0xd0,
- 0xb0, 0xd0, 0x9d, 0xd0, 0xbe, 0xd0, 0xb2, 0xd1, 0x8b, 0xd0, 0xb9, 0xd1, 0x87,
- 0xd0, 0xb0, 0xd1, 0x81, 0xd0, 0xbe, 0xd0, 0xb2, 0xd0, 0xbc, 0xd0, 0xb5, 0xd1,
- 0x81, 0xd1, 0x82, 0xd0, 0xb0, 0xd1, 0x84, 0xd0, 0xb8, 0xd0, 0xbb, 0xd1, 0x8c,
- 0xd0, 0xbc, 0xd0, 0xbc, 0xd0, 0xb0, 0xd1, 0x80, 0xd1, 0x82, 0xd0, 0xb0, 0xd1,
- 0x81, 0xd1, 0x82, 0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xbd, 0xd0, 0xbc, 0xd0, 0xb5,
- 0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xb5, 0xd1, 0x82, 0xd0, 0xb5, 0xd0, 0xba, 0xd1,
- 0x81, 0xd1, 0x82, 0xd0, 0xbd, 0xd0, 0xb0, 0xd1, 0x88, 0xd0, 0xb8, 0xd1, 0x85,
- 0xd0, 0xbc, 0xd0, 0xb8, 0xd0, 0xbd, 0xd1, 0x83, 0xd1, 0x82, 0xd0, 0xb8, 0xd0,
- 0xbc, 0xd0, 0xb5, 0xd0, 0xbd, 0xd0, 0xb8, 0xd0, 0xb8, 0xd0, 0xbc, 0xd0, 0xb5,
- 0xd1, 0x8e, 0xd1, 0x82, 0xd0, 0xbd, 0xd0, 0xbe, 0xd0, 0xbc, 0xd0, 0xb5, 0xd1,
- 0x80, 0xd0, 0xb3, 0xd0, 0xbe, 0xd1, 0x80, 0xd0, 0xbe, 0xd0, 0xb4, 0xd1, 0x81,
- 0xd0, 0xb0, 0xd0, 0xbc, 0xd0, 0xbe, 0xd0, 0xbc, 0xd1, 0x8d, 0xd1, 0x82, 0xd0,
- 0xbe, 0xd0, 0xbc, 0xd1, 0x83, 0xd0, 0xba, 0xd0, 0xbe, 0xd0, 0xbd, 0xd1, 0x86,
- 0xd0, 0xb5, 0xd1, 0x81, 0xd0, 0xb2, 0xd0, 0xbe, 0xd0, 0xb5, 0xd0, 0xbc, 0xd0,
- 0xba, 0xd0, 0xb0, 0xd0, 0xba, 0xd0, 0xbe, 0xd0, 0xb9, 0xd0, 0x90, 0xd1, 0x80,
- 0xd1, 0x85, 0xd0, 0xb8, 0xd0, 0xb2, 0xd9, 0x85, 0xd9, 0x86, 0xd8, 0xaa, 0xd8,
- 0xaf, 0xd9, 0x89, 0xd8, 0xa5, 0xd8, 0xb1, 0xd8, 0xb3, 0xd8, 0xa7, 0xd9, 0x84,
- 0xd8, 0xb1, 0xd8, 0xb3, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9,
- 0x84, 0xd8, 0xb9, 0xd8, 0xa7, 0xd9, 0x85, 0xd9, 0x83, 0xd8, 0xaa, 0xd8, 0xa8,
- 0xd9, 0x87, 0xd8, 0xa7, 0xd8, 0xa8, 0xd8, 0xb1, 0xd8, 0xa7, 0xd9, 0x85, 0xd8,
- 0xac, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x8a, 0xd9, 0x88, 0xd9, 0x85, 0xd8, 0xa7,
- 0xd9, 0x84, 0xd8, 0xb5, 0xd9, 0x88, 0xd8, 0xb1, 0xd8, 0xac, 0xd8, 0xaf, 0xd9,
- 0x8a, 0xd8, 0xaf, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb9, 0xd8, 0xb6,
- 0xd9, 0x88, 0xd8, 0xa5, 0xd8, 0xb6, 0xd8, 0xa7, 0xd9, 0x81, 0xd8, 0xa9, 0xd8,
- 0xa7, 0xd9, 0x84, 0xd9, 0x82, 0xd8, 0xb3, 0xd9, 0x85, 0xd8, 0xa7, 0xd9, 0x84,
- 0xd8, 0xb9, 0xd8, 0xa7, 0xd8, 0xa8, 0xd8, 0xaa, 0xd8, 0xad, 0xd9, 0x85, 0xd9,
- 0x8a, 0xd9, 0x84, 0xd9, 0x85, 0xd9, 0x84, 0xd9, 0x81, 0xd8, 0xa7, 0xd8, 0xaa,
- 0xd9, 0x85, 0xd9, 0x84, 0xd8, 0xaa, 0xd9, 0x82, 0xd9, 0x89, 0xd8, 0xaa, 0xd8,
- 0xb9, 0xd8, 0xaf, 0xd9, 0x8a, 0xd9, 0x84, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb4,
- 0xd8, 0xb9, 0xd8, 0xb1, 0xd8, 0xa3, 0xd8, 0xae, 0xd8, 0xa8, 0xd8, 0xa7, 0xd8,
- 0xb1, 0xd8, 0xaa, 0xd8, 0xb7, 0xd9, 0x88, 0xd9, 0x8a, 0xd8, 0xb1, 0xd8, 0xb9,
- 0xd9, 0x84, 0xd9, 0x8a, 0xd9, 0x83, 0xd9, 0x85, 0xd8, 0xa5, 0xd8, 0xb1, 0xd9,
- 0x81, 0xd8, 0xa7, 0xd9, 0x82, 0xd8, 0xb7, 0xd9, 0x84, 0xd8, 0xa8, 0xd8, 0xa7,
- 0xd8, 0xaa, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x84, 0xd8, 0xba, 0xd8, 0xa9, 0xd8,
- 0xaa, 0xd8, 0xb1, 0xd8, 0xaa, 0xd9, 0x8a, 0xd8, 0xa8, 0xd8, 0xa7, 0xd9, 0x84,
- 0xd9, 0x86, 0xd8, 0xa7, 0xd8, 0xb3, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb4, 0xd9,
- 0x8a, 0xd8, 0xae, 0xd9, 0x85, 0xd9, 0x86, 0xd8, 0xaa, 0xd8, 0xaf, 0xd9, 0x8a,
- 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb9, 0xd8, 0xb1, 0xd8, 0xa8, 0xd8, 0xa7, 0xd9,
- 0x84, 0xd9, 0x82, 0xd8, 0xb5, 0xd8, 0xb5, 0xd8, 0xa7, 0xd9, 0x81, 0xd9, 0x84,
- 0xd8, 0xa7, 0xd9, 0x85, 0xd8, 0xb9, 0xd9, 0x84, 0xd9, 0x8a, 0xd9, 0x87, 0xd8,
- 0xa7, 0xd8, 0xaa, 0xd8, 0xad, 0xd8, 0xaf, 0xd9, 0x8a, 0xd8, 0xab, 0xd8, 0xa7,
- 0xd9, 0x84, 0xd9, 0x84, 0xd9, 0x87, 0xd9, 0x85, 0xd8, 0xa7, 0xd9, 0x84, 0xd8,
- 0xb9, 0xd9, 0x85, 0xd9, 0x84, 0xd9, 0x85, 0xd9, 0x83, 0xd8, 0xaa, 0xd8, 0xa8,
- 0xd8, 0xa9, 0xd9, 0x8a, 0xd9, 0x85, 0xd9, 0x83, 0xd9, 0x86, 0xd9, 0x83, 0xd8,
- 0xa7, 0xd9, 0x84, 0xd8, 0xb7, 0xd9, 0x81, 0xd9, 0x84, 0xd9, 0x81, 0xd9, 0x8a,
- 0xd8, 0xaf, 0xd9, 0x8a, 0xd9, 0x88, 0xd8, 0xa5, 0xd8, 0xaf, 0xd8, 0xa7, 0xd8,
- 0xb1, 0xd8, 0xa9, 0xd8, 0xaa, 0xd8, 0xa7, 0xd8, 0xb1, 0xd9, 0x8a, 0xd8, 0xae,
- 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb5, 0xd8, 0xad, 0xd8, 0xa9, 0xd8, 0xaa, 0xd8,
- 0xb3, 0xd8, 0xac, 0xd9, 0x8a, 0xd9, 0x84, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x88,
- 0xd9, 0x82, 0xd8, 0xaa, 0xd8, 0xb9, 0xd9, 0x86, 0xd8, 0xaf, 0xd9, 0x85, 0xd8,
- 0xa7, 0xd9, 0x85, 0xd8, 0xaf, 0xd9, 0x8a, 0xd9, 0x86, 0xd8, 0xa9, 0xd8, 0xaa,
- 0xd8, 0xb5, 0xd9, 0x85, 0xd9, 0x8a, 0xd9, 0x85, 0xd8, 0xa3, 0xd8, 0xb1, 0xd8,
- 0xb4, 0xd9, 0x8a, 0xd9, 0x81, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb0, 0xd9, 0x8a,
- 0xd9, 0x86, 0xd8, 0xb9, 0xd8, 0xb1, 0xd8, 0xa8, 0xd9, 0x8a, 0xd8, 0xa9, 0xd8,
- 0xa8, 0xd9, 0x88, 0xd8, 0xa7, 0xd8, 0xa8, 0xd8, 0xa9, 0xd8, 0xa3, 0xd9, 0x84,
- 0xd8, 0xb9, 0xd8, 0xa7, 0xd8, 0xa8, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb3, 0xd9,
- 0x81, 0xd8, 0xb1, 0xd9, 0x85, 0xd8, 0xb4, 0xd8, 0xa7, 0xd9, 0x83, 0xd9, 0x84,
- 0xd8, 0xaa, 0xd8, 0xb9, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x89, 0xd8, 0xa7, 0xd9,
- 0x84, 0xd8, 0xa3, 0xd9, 0x88, 0xd9, 0x84, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb3,
- 0xd9, 0x86, 0xd8, 0xa9, 0xd8, 0xac, 0xd8, 0xa7, 0xd9, 0x85, 0xd8, 0xb9, 0xd8,
- 0xa9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb5, 0xd8, 0xad, 0xd9, 0x81, 0xd8, 0xa7,
- 0xd9, 0x84, 0xd8, 0xaf, 0xd9, 0x8a, 0xd9, 0x86, 0xd9, 0x83, 0xd9, 0x84, 0xd9,
- 0x85, 0xd8, 0xa7, 0xd8, 0xaa, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xae, 0xd8, 0xa7,
- 0xd8, 0xb5, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x85, 0xd9, 0x84, 0xd9, 0x81, 0xd8,
- 0xa3, 0xd8, 0xb9, 0xd8, 0xb6, 0xd8, 0xa7, 0xd8, 0xa1, 0xd9, 0x83, 0xd8, 0xaa,
- 0xd8, 0xa7, 0xd8, 0xa8, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xae, 0xd9,
- 0x8a, 0xd8, 0xb1, 0xd8, 0xb1, 0xd8, 0xb3, 0xd8, 0xa7, 0xd8, 0xa6, 0xd9, 0x84,
- 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x82, 0xd9, 0x84, 0xd8, 0xa8, 0xd8, 0xa7, 0xd9,
- 0x84, 0xd8, 0xa3, 0xd8, 0xaf, 0xd8, 0xa8, 0xd9, 0x85, 0xd9, 0x82, 0xd8, 0xa7,
- 0xd8, 0xb7, 0xd8, 0xb9, 0xd9, 0x85, 0xd8, 0xb1, 0xd8, 0xa7, 0xd8, 0xb3, 0xd9,
- 0x84, 0xd9, 0x85, 0xd9, 0x86, 0xd8, 0xb7, 0xd9, 0x82, 0xd8, 0xa9, 0xd8, 0xa7,
- 0xd9, 0x84, 0xd9, 0x83, 0xd8, 0xaa, 0xd8, 0xa8, 0xd8, 0xa7, 0xd9, 0x84, 0xd8,
- 0xb1, 0xd8, 0xac, 0xd9, 0x84, 0xd8, 0xa7, 0xd8, 0xb4, 0xd8, 0xaa, 0xd8, 0xb1,
- 0xd9, 0x83, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x82, 0xd8, 0xaf, 0xd9, 0x85, 0xd9,
- 0x8a, 0xd8, 0xb9, 0xd8, 0xb7, 0xd9, 0x8a, 0xd9, 0x83, 0x73, 0x42, 0x79, 0x54,
- 0x61, 0x67, 0x4e, 0x61, 0x6d, 0x65, 0x28, 0x2e, 0x6a, 0x70, 0x67, 0x22, 0x20,
- 0x61, 0x6c, 0x74, 0x3d, 0x22, 0x31, 0x70, 0x78, 0x20, 0x73, 0x6f, 0x6c, 0x69,
- 0x64, 0x20, 0x23, 0x2e, 0x67, 0x69, 0x66, 0x22, 0x20, 0x61, 0x6c, 0x74, 0x3d,
- 0x22, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x61, 0x72, 0x65, 0x6e, 0x74, 0x69,
- 0x6e, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x70, 0x70,
- 0x6c, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x20, 0x6f, 0x6e, 0x63,
- 0x6c, 0x69, 0x63, 0x6b, 0x3d, 0x22, 0x65, 0x73, 0x74, 0x61, 0x62, 0x6c, 0x69,
- 0x73, 0x68, 0x65, 0x64, 0x61, 0x64, 0x76, 0x65, 0x72, 0x74, 0x69, 0x73, 0x69,
- 0x6e, 0x67, 0x2e, 0x70, 0x6e, 0x67, 0x22, 0x20, 0x61, 0x6c, 0x74, 0x3d, 0x22,
- 0x65, 0x6e, 0x76, 0x69, 0x72, 0x6f, 0x6e, 0x6d, 0x65, 0x6e, 0x74, 0x70, 0x65,
- 0x72, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x6e, 0x63, 0x65, 0x61, 0x70, 0x70, 0x72,
- 0x6f, 0x70, 0x72, 0x69, 0x61, 0x74, 0x65, 0x26, 0x61, 0x6d, 0x70, 0x3b, 0x6d,
- 0x64, 0x61, 0x73, 0x68, 0x3b, 0x69, 0x6d, 0x6d, 0x65, 0x64, 0x69, 0x61, 0x74,
- 0x65, 0x6c, 0x79, 0x3c, 0x2f, 0x73, 0x74, 0x72, 0x6f, 0x6e, 0x67, 0x3e, 0x3c,
- 0x2f, 0x72, 0x61, 0x74, 0x68, 0x65, 0x72, 0x20, 0x74, 0x68, 0x61, 0x6e, 0x74,
- 0x65, 0x6d, 0x70, 0x65, 0x72, 0x61, 0x74, 0x75, 0x72, 0x65, 0x64, 0x65, 0x76,
- 0x65, 0x6c, 0x6f, 0x70, 0x6d, 0x65, 0x6e, 0x74, 0x63, 0x6f, 0x6d, 0x70, 0x65,
- 0x74, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x70, 0x6c, 0x61, 0x63, 0x65, 0x68, 0x6f,
- 0x6c, 0x64, 0x65, 0x72, 0x76, 0x69, 0x73, 0x69, 0x62, 0x69, 0x6c, 0x69, 0x74,
- 0x79, 0x3a, 0x63, 0x6f, 0x70, 0x79, 0x72, 0x69, 0x67, 0x68, 0x74, 0x22, 0x3e,
- 0x30, 0x22, 0x20, 0x68, 0x65, 0x69, 0x67, 0x68, 0x74, 0x3d, 0x22, 0x65, 0x76,
- 0x65, 0x6e, 0x20, 0x74, 0x68, 0x6f, 0x75, 0x67, 0x68, 0x72, 0x65, 0x70, 0x6c,
- 0x61, 0x63, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x72, 0x70, 0x6f, 0x72, 0x61, 0x74,
- 0x69, 0x6f, 0x6e, 0x3c, 0x75, 0x6c, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d,
- 0x22, 0x41, 0x73, 0x73, 0x6f, 0x63, 0x69, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x69,
- 0x6e, 0x64, 0x69, 0x76, 0x69, 0x64, 0x75, 0x61, 0x6c, 0x73, 0x70, 0x65, 0x72,
- 0x73, 0x70, 0x65, 0x63, 0x74, 0x69, 0x76, 0x65, 0x73, 0x65, 0x74, 0x54, 0x69,
- 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x28, 0x75, 0x72, 0x6c, 0x28, 0x68, 0x74, 0x74,
- 0x70, 0x3a, 0x2f, 0x2f, 0x6d, 0x61, 0x74, 0x68, 0x65, 0x6d, 0x61, 0x74, 0x69,
- 0x63, 0x73, 0x6d, 0x61, 0x72, 0x67, 0x69, 0x6e, 0x2d, 0x74, 0x6f, 0x70, 0x3a,
- 0x65, 0x76, 0x65, 0x6e, 0x74, 0x75, 0x61, 0x6c, 0x6c, 0x79, 0x20, 0x64, 0x65,
- 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x29, 0x20, 0x6e, 0x6f,
- 0x2d, 0x72, 0x65, 0x70, 0x65, 0x61, 0x74, 0x63, 0x6f, 0x6c, 0x6c, 0x65, 0x63,
- 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x4a, 0x50, 0x47, 0x7c, 0x74, 0x68, 0x75,
- 0x6d, 0x62, 0x7c, 0x70, 0x61, 0x72, 0x74, 0x69, 0x63, 0x69, 0x70, 0x61, 0x74,
- 0x65, 0x2f, 0x68, 0x65, 0x61, 0x64, 0x3e, 0x3c, 0x62, 0x6f, 0x64, 0x79, 0x66,
- 0x6c, 0x6f, 0x61, 0x74, 0x3a, 0x6c, 0x65, 0x66, 0x74, 0x3b, 0x3c, 0x6c, 0x69,
- 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x68, 0x75, 0x6e, 0x64, 0x72,
- 0x65, 0x64, 0x73, 0x20, 0x6f, 0x66, 0x0a, 0x0a, 0x48, 0x6f, 0x77, 0x65, 0x76,
- 0x65, 0x72, 0x2c, 0x20, 0x63, 0x6f, 0x6d, 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69,
- 0x6f, 0x6e, 0x63, 0x6c, 0x65, 0x61, 0x72, 0x3a, 0x62, 0x6f, 0x74, 0x68, 0x3b,
- 0x63, 0x6f, 0x6f, 0x70, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x77, 0x69,
- 0x74, 0x68, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x6c, 0x61, 0x62, 0x65,
- 0x6c, 0x20, 0x66, 0x6f, 0x72, 0x3d, 0x22, 0x62, 0x6f, 0x72, 0x64, 0x65, 0x72,
- 0x2d, 0x74, 0x6f, 0x70, 0x3a, 0x4e, 0x65, 0x77, 0x20, 0x5a, 0x65, 0x61, 0x6c,
- 0x61, 0x6e, 0x64, 0x72, 0x65, 0x63, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x64, 0x65,
- 0x64, 0x70, 0x68, 0x6f, 0x74, 0x6f, 0x67, 0x72, 0x61, 0x70, 0x68, 0x79, 0x69,
- 0x6e, 0x74, 0x65, 0x72, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x67, 0x26, 0x6c, 0x74,
- 0x3b, 0x73, 0x75, 0x70, 0x26, 0x67, 0x74, 0x3b, 0x63, 0x6f, 0x6e, 0x74, 0x72,
- 0x6f, 0x76, 0x65, 0x72, 0x73, 0x79, 0x4e, 0x65, 0x74, 0x68, 0x65, 0x72, 0x6c,
- 0x61, 0x6e, 0x64, 0x73, 0x61, 0x6c, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x74, 0x69,
- 0x76, 0x65, 0x6d, 0x61, 0x78, 0x6c, 0x65, 0x6e, 0x67, 0x74, 0x68, 0x3d, 0x22,
- 0x73, 0x77, 0x69, 0x74, 0x7a, 0x65, 0x72, 0x6c, 0x61, 0x6e, 0x64, 0x44, 0x65,
- 0x76, 0x65, 0x6c, 0x6f, 0x70, 0x6d, 0x65, 0x6e, 0x74, 0x65, 0x73, 0x73, 0x65,
- 0x6e, 0x74, 0x69, 0x61, 0x6c, 0x6c, 0x79, 0x0a, 0x0a, 0x41, 0x6c, 0x74, 0x68,
- 0x6f, 0x75, 0x67, 0x68, 0x20, 0x3c, 0x2f, 0x74, 0x65, 0x78, 0x74, 0x61, 0x72,
- 0x65, 0x61, 0x3e, 0x74, 0x68, 0x75, 0x6e, 0x64, 0x65, 0x72, 0x62, 0x69, 0x72,
- 0x64, 0x72, 0x65, 0x70, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x74, 0x65, 0x64, 0x26,
- 0x61, 0x6d, 0x70, 0x3b, 0x6e, 0x64, 0x61, 0x73, 0x68, 0x3b, 0x73, 0x70, 0x65,
- 0x63, 0x75, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x63, 0x6f, 0x6d, 0x6d, 0x75,
- 0x6e, 0x69, 0x74, 0x69, 0x65, 0x73, 0x6c, 0x65, 0x67, 0x69, 0x73, 0x6c, 0x61,
- 0x74, 0x69, 0x6f, 0x6e, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x72, 0x6f, 0x6e, 0x69,
- 0x63, 0x73, 0x0a, 0x09, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x69, 0x64, 0x3d, 0x22,
- 0x69, 0x6c, 0x6c, 0x75, 0x73, 0x74, 0x72, 0x61, 0x74, 0x65, 0x64, 0x65, 0x6e,
- 0x67, 0x69, 0x6e, 0x65, 0x65, 0x72, 0x69, 0x6e, 0x67, 0x74, 0x65, 0x72, 0x72,
- 0x69, 0x74, 0x6f, 0x72, 0x69, 0x65, 0x73, 0x61, 0x75, 0x74, 0x68, 0x6f, 0x72,
- 0x69, 0x74, 0x69, 0x65, 0x73, 0x64, 0x69, 0x73, 0x74, 0x72, 0x69, 0x62, 0x75,
- 0x74, 0x65, 0x64, 0x36, 0x22, 0x20, 0x68, 0x65, 0x69, 0x67, 0x68, 0x74, 0x3d,
- 0x22, 0x73, 0x61, 0x6e, 0x73, 0x2d, 0x73, 0x65, 0x72, 0x69, 0x66, 0x3b, 0x63,
- 0x61, 0x70, 0x61, 0x62, 0x6c, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x64, 0x69, 0x73,
- 0x61, 0x70, 0x70, 0x65, 0x61, 0x72, 0x65, 0x64, 0x69, 0x6e, 0x74, 0x65, 0x72,
- 0x61, 0x63, 0x74, 0x69, 0x76, 0x65, 0x6c, 0x6f, 0x6f, 0x6b, 0x69, 0x6e, 0x67,
- 0x20, 0x66, 0x6f, 0x72, 0x69, 0x74, 0x20, 0x77, 0x6f, 0x75, 0x6c, 0x64, 0x20,
- 0x62, 0x65, 0x41, 0x66, 0x67, 0x68, 0x61, 0x6e, 0x69, 0x73, 0x74, 0x61, 0x6e,
- 0x77, 0x61, 0x73, 0x20, 0x63, 0x72, 0x65, 0x61, 0x74, 0x65, 0x64, 0x4d, 0x61,
- 0x74, 0x68, 0x2e, 0x66, 0x6c, 0x6f, 0x6f, 0x72, 0x28, 0x73, 0x75, 0x72, 0x72,
- 0x6f, 0x75, 0x6e, 0x64, 0x69, 0x6e, 0x67, 0x63, 0x61, 0x6e, 0x20, 0x61, 0x6c,
- 0x73, 0x6f, 0x20, 0x62, 0x65, 0x6f, 0x62, 0x73, 0x65, 0x72, 0x76, 0x61, 0x74,
- 0x69, 0x6f, 0x6e, 0x6d, 0x61, 0x69, 0x6e, 0x74, 0x65, 0x6e, 0x61, 0x6e, 0x63,
- 0x65, 0x65, 0x6e, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x65, 0x72, 0x65, 0x64, 0x3c,
- 0x68, 0x32, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x6d, 0x6f, 0x72,
- 0x65, 0x20, 0x72, 0x65, 0x63, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x20, 0x68, 0x61,
- 0x73, 0x20, 0x62, 0x65, 0x65, 0x6e, 0x69, 0x6e, 0x76, 0x61, 0x73, 0x69, 0x6f,
- 0x6e, 0x20, 0x6f, 0x66, 0x29, 0x2e, 0x67, 0x65, 0x74, 0x54, 0x69, 0x6d, 0x65,
- 0x28, 0x29, 0x66, 0x75, 0x6e, 0x64, 0x61, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x6c,
- 0x44, 0x65, 0x73, 0x70, 0x69, 0x74, 0x65, 0x20, 0x74, 0x68, 0x65, 0x22, 0x3e,
- 0x3c, 0x64, 0x69, 0x76, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x69, 0x6e, 0x73, 0x70,
- 0x69, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x65, 0x78, 0x61, 0x6d, 0x69, 0x6e,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x70, 0x72, 0x65, 0x70, 0x61, 0x72, 0x61, 0x74,
- 0x69, 0x6f, 0x6e, 0x65, 0x78, 0x70, 0x6c, 0x61, 0x6e, 0x61, 0x74, 0x69, 0x6f,
- 0x6e, 0x3c, 0x69, 0x6e, 0x70, 0x75, 0x74, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x3c,
- 0x2f, 0x61, 0x3e, 0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e, 0x3e, 0x76, 0x65, 0x72,
- 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x20, 0x6f, 0x66, 0x69, 0x6e, 0x73, 0x74, 0x72,
- 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x62, 0x65, 0x66, 0x6f, 0x72, 0x65, 0x20,
- 0x74, 0x68, 0x65, 0x20, 0x20, 0x3d, 0x20, 0x27, 0x68, 0x74, 0x74, 0x70, 0x3a,
- 0x2f, 0x2f, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e,
- 0x72, 0x65, 0x6c, 0x61, 0x74, 0x69, 0x76, 0x65, 0x6c, 0x79, 0x20, 0x2e, 0x73,
- 0x75, 0x62, 0x73, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x28, 0x65, 0x61, 0x63, 0x68,
- 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x65, 0x78, 0x70, 0x65, 0x72, 0x69,
- 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x69, 0x6e, 0x66, 0x6c, 0x75, 0x65, 0x6e, 0x74,
- 0x69, 0x61, 0x6c, 0x69, 0x6e, 0x74, 0x65, 0x67, 0x72, 0x61, 0x74, 0x69, 0x6f,
- 0x6e, 0x6d, 0x61, 0x6e, 0x79, 0x20, 0x70, 0x65, 0x6f, 0x70, 0x6c, 0x65, 0x64,
- 0x75, 0x65, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x20, 0x63, 0x6f, 0x6d,
- 0x62, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x64, 0x6f, 0x20, 0x6e, 0x6f,
- 0x74, 0x20, 0x68, 0x61, 0x76, 0x65, 0x4d, 0x69, 0x64, 0x64, 0x6c, 0x65, 0x20,
- 0x45, 0x61, 0x73, 0x74, 0x3c, 0x6e, 0x6f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
- 0x3e, 0x3c, 0x63, 0x6f, 0x70, 0x79, 0x72, 0x69, 0x67, 0x68, 0x74, 0x22, 0x20,
- 0x70, 0x65, 0x72, 0x68, 0x61, 0x70, 0x73, 0x20, 0x74, 0x68, 0x65, 0x69, 0x6e,
- 0x73, 0x74, 0x69, 0x74, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x69, 0x6e, 0x20, 0x44,
- 0x65, 0x63, 0x65, 0x6d, 0x62, 0x65, 0x72, 0x61, 0x72, 0x72, 0x61, 0x6e, 0x67,
- 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x6d, 0x6f, 0x73, 0x74, 0x20, 0x66, 0x61, 0x6d,
- 0x6f, 0x75, 0x73, 0x70, 0x65, 0x72, 0x73, 0x6f, 0x6e, 0x61, 0x6c, 0x69, 0x74,
- 0x79, 0x63, 0x72, 0x65, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x6c,
- 0x69, 0x6d, 0x69, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x65, 0x78, 0x63,
- 0x6c, 0x75, 0x73, 0x69, 0x76, 0x65, 0x6c, 0x79, 0x73, 0x6f, 0x76, 0x65, 0x72,
- 0x65, 0x69, 0x67, 0x6e, 0x74, 0x79, 0x2d, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e,
- 0x74, 0x22, 0x3e, 0x0a, 0x3c, 0x74, 0x64, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73,
- 0x3d, 0x22, 0x75, 0x6e, 0x64, 0x65, 0x72, 0x67, 0x72, 0x6f, 0x75, 0x6e, 0x64,
- 0x70, 0x61, 0x72, 0x61, 0x6c, 0x6c, 0x65, 0x6c, 0x20, 0x74, 0x6f, 0x64, 0x6f,
- 0x63, 0x74, 0x72, 0x69, 0x6e, 0x65, 0x20, 0x6f, 0x66, 0x6f, 0x63, 0x63, 0x75,
- 0x70, 0x69, 0x65, 0x64, 0x20, 0x62, 0x79, 0x74, 0x65, 0x72, 0x6d, 0x69, 0x6e,
- 0x6f, 0x6c, 0x6f, 0x67, 0x79, 0x52, 0x65, 0x6e, 0x61, 0x69, 0x73, 0x73, 0x61,
- 0x6e, 0x63, 0x65, 0x61, 0x20, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x20, 0x6f,
- 0x66, 0x73, 0x75, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x20, 0x66, 0x6f, 0x72, 0x65,
- 0x78, 0x70, 0x6c, 0x6f, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x72, 0x65, 0x63,
- 0x6f, 0x67, 0x6e, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x70, 0x72, 0x65, 0x64, 0x65,
- 0x63, 0x65, 0x73, 0x73, 0x6f, 0x72, 0x3c, 0x69, 0x6d, 0x67, 0x20, 0x73, 0x72,
- 0x63, 0x3d, 0x22, 0x2f, 0x3c, 0x68, 0x31, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73,
- 0x3d, 0x22, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e,
- 0x6d, 0x61, 0x79, 0x20, 0x61, 0x6c, 0x73, 0x6f, 0x20, 0x62, 0x65, 0x73, 0x70,
- 0x65, 0x63, 0x69, 0x61, 0x6c, 0x69, 0x7a, 0x65, 0x64, 0x3c, 0x2f, 0x66, 0x69,
- 0x65, 0x6c, 0x64, 0x73, 0x65, 0x74, 0x3e, 0x70, 0x72, 0x6f, 0x67, 0x72, 0x65,
- 0x73, 0x73, 0x69, 0x76, 0x65, 0x6d, 0x69, 0x6c, 0x6c, 0x69, 0x6f, 0x6e, 0x73,
- 0x20, 0x6f, 0x66, 0x73, 0x74, 0x61, 0x74, 0x65, 0x73, 0x20, 0x74, 0x68, 0x61,
- 0x74, 0x65, 0x6e, 0x66, 0x6f, 0x72, 0x63, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x61,
- 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x20, 0x74, 0x68, 0x65, 0x20, 0x6f, 0x6e, 0x65,
- 0x20, 0x61, 0x6e, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x2e, 0x70, 0x61, 0x72, 0x65,
- 0x6e, 0x74, 0x4e, 0x6f, 0x64, 0x65, 0x61, 0x67, 0x72, 0x69, 0x63, 0x75, 0x6c,
- 0x74, 0x75, 0x72, 0x65, 0x41, 0x6c, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x74, 0x69,
- 0x76, 0x65, 0x72, 0x65, 0x73, 0x65, 0x61, 0x72, 0x63, 0x68, 0x65, 0x72, 0x73,
- 0x74, 0x6f, 0x77, 0x61, 0x72, 0x64, 0x73, 0x20, 0x74, 0x68, 0x65, 0x4d, 0x6f,
- 0x73, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x6d, 0x61, 0x6e, 0x79,
- 0x20, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x20, 0x28, 0x65, 0x73, 0x70, 0x65, 0x63,
- 0x69, 0x61, 0x6c, 0x6c, 0x79, 0x3c, 0x74, 0x64, 0x20, 0x77, 0x69, 0x64, 0x74,
- 0x68, 0x3d, 0x22, 0x3b, 0x77, 0x69, 0x64, 0x74, 0x68, 0x3a, 0x31, 0x30, 0x30,
- 0x25, 0x69, 0x6e, 0x64, 0x65, 0x70, 0x65, 0x6e, 0x64, 0x65, 0x6e, 0x74, 0x3c,
- 0x68, 0x33, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x20, 0x6f, 0x6e,
- 0x63, 0x68, 0x61, 0x6e, 0x67, 0x65, 0x3d, 0x22, 0x29, 0x2e, 0x61, 0x64, 0x64,
- 0x43, 0x6c, 0x61, 0x73, 0x73, 0x28, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x61, 0x63,
- 0x74, 0x69, 0x6f, 0x6e, 0x4f, 0x6e, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68,
- 0x65, 0x20, 0x64, 0x61, 0x75, 0x67, 0x68, 0x74, 0x65, 0x72, 0x20, 0x6f, 0x66,
- 0x61, 0x63, 0x63, 0x65, 0x73, 0x73, 0x6f, 0x72, 0x69, 0x65, 0x73, 0x62, 0x72,
- 0x61, 0x6e, 0x63, 0x68, 0x65, 0x73, 0x20, 0x6f, 0x66, 0x0d, 0x0a, 0x3c, 0x64,
- 0x69, 0x76, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x74, 0x68, 0x65, 0x20, 0x6c, 0x61,
- 0x72, 0x67, 0x65, 0x73, 0x74, 0x64, 0x65, 0x63, 0x6c, 0x61, 0x72, 0x61, 0x74,
- 0x69, 0x6f, 0x6e, 0x72, 0x65, 0x67, 0x75, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e,
- 0x73, 0x49, 0x6e, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x74,
- 0x72, 0x61, 0x6e, 0x73, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x64, 0x6f, 0x63,
- 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x72, 0x79, 0x69, 0x6e, 0x20, 0x6f, 0x72,
- 0x64, 0x65, 0x72, 0x20, 0x74, 0x6f, 0x22, 0x3e, 0x0a, 0x3c, 0x68, 0x65, 0x61,
- 0x64, 0x3e, 0x0a, 0x3c, 0x22, 0x20, 0x68, 0x65, 0x69, 0x67, 0x68, 0x74, 0x3d,
- 0x22, 0x31, 0x61, 0x63, 0x72, 0x6f, 0x73, 0x73, 0x20, 0x74, 0x68, 0x65, 0x20,
- 0x6f, 0x72, 0x69, 0x65, 0x6e, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x29, 0x3b,
- 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x69, 0x6d, 0x70, 0x6c,
- 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x65, 0x64, 0x63, 0x61, 0x6e, 0x20, 0x62, 0x65,
- 0x20, 0x73, 0x65, 0x65, 0x6e, 0x74, 0x68, 0x65, 0x72, 0x65, 0x20, 0x77, 0x61,
- 0x73, 0x20, 0x61, 0x64, 0x65, 0x6d, 0x6f, 0x6e, 0x73, 0x74, 0x72, 0x61, 0x74,
- 0x65, 0x63, 0x6f, 0x6e, 0x74, 0x61, 0x69, 0x6e, 0x65, 0x72, 0x22, 0x3e, 0x63,
- 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x74, 0x68, 0x65,
- 0x20, 0x42, 0x72, 0x69, 0x74, 0x69, 0x73, 0x68, 0x77, 0x61, 0x73, 0x20, 0x77,
- 0x72, 0x69, 0x74, 0x74, 0x65, 0x6e, 0x21, 0x69, 0x6d, 0x70, 0x6f, 0x72, 0x74,
- 0x61, 0x6e, 0x74, 0x3b, 0x70, 0x78, 0x3b, 0x20, 0x6d, 0x61, 0x72, 0x67, 0x69,
- 0x6e, 0x2d, 0x66, 0x6f, 0x6c, 0x6c, 0x6f, 0x77, 0x65, 0x64, 0x20, 0x62, 0x79,
- 0x61, 0x62, 0x69, 0x6c, 0x69, 0x74, 0x79, 0x20, 0x74, 0x6f, 0x20, 0x63, 0x6f,
- 0x6d, 0x70, 0x6c, 0x69, 0x63, 0x61, 0x74, 0x65, 0x64, 0x64, 0x75, 0x72, 0x69,
- 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65, 0x20, 0x69, 0x6d, 0x6d, 0x69, 0x67, 0x72,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x73, 0x6f, 0x20, 0x63, 0x61, 0x6c,
- 0x6c, 0x65, 0x64, 0x3c, 0x68, 0x34, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d,
- 0x22, 0x64, 0x69, 0x73, 0x74, 0x69, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x72,
- 0x65, 0x70, 0x6c, 0x61, 0x63, 0x65, 0x64, 0x20, 0x62, 0x79, 0x67, 0x6f, 0x76,
- 0x65, 0x72, 0x6e, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x6c, 0x6f, 0x63, 0x61, 0x74,
- 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x69, 0x6e, 0x20, 0x4e, 0x6f, 0x76, 0x65,
- 0x6d, 0x62, 0x65, 0x72, 0x77, 0x68, 0x65, 0x74, 0x68, 0x65, 0x72, 0x20, 0x74,
- 0x68, 0x65, 0x3c, 0x2f, 0x70, 0x3e, 0x0a, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e,
- 0x61, 0x63, 0x71, 0x75, 0x69, 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x63, 0x61,
- 0x6c, 0x6c, 0x65, 0x64, 0x20, 0x74, 0x68, 0x65, 0x20, 0x70, 0x65, 0x72, 0x73,
- 0x65, 0x63, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x64, 0x65, 0x73, 0x69, 0x67, 0x6e,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x7b, 0x66, 0x6f, 0x6e, 0x74, 0x2d, 0x73, 0x69,
- 0x7a, 0x65, 0x3a, 0x61, 0x70, 0x70, 0x65, 0x61, 0x72, 0x65, 0x64, 0x20, 0x69,
- 0x6e, 0x69, 0x6e, 0x76, 0x65, 0x73, 0x74, 0x69, 0x67, 0x61, 0x74, 0x65, 0x65,
- 0x78, 0x70, 0x65, 0x72, 0x69, 0x65, 0x6e, 0x63, 0x65, 0x64, 0x6d, 0x6f, 0x73,
- 0x74, 0x20, 0x6c, 0x69, 0x6b, 0x65, 0x6c, 0x79, 0x77, 0x69, 0x64, 0x65, 0x6c,
- 0x79, 0x20, 0x75, 0x73, 0x65, 0x64, 0x64, 0x69, 0x73, 0x63, 0x75, 0x73, 0x73,
- 0x69, 0x6f, 0x6e, 0x73, 0x70, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x63, 0x65, 0x20,
- 0x6f, 0x66, 0x20, 0x28, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x2e,
- 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x76, 0x65, 0x6c, 0x79, 0x49, 0x74,
- 0x20, 0x68, 0x61, 0x73, 0x20, 0x62, 0x65, 0x65, 0x6e, 0x69, 0x74, 0x20, 0x64,
- 0x6f, 0x65, 0x73, 0x20, 0x6e, 0x6f, 0x74, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x61,
- 0x72, 0x79, 0x20, 0x74, 0x6f, 0x69, 0x6e, 0x68, 0x61, 0x62, 0x69, 0x74, 0x61,
- 0x6e, 0x74, 0x73, 0x69, 0x6d, 0x70, 0x72, 0x6f, 0x76, 0x65, 0x6d, 0x65, 0x6e,
- 0x74, 0x73, 0x63, 0x68, 0x6f, 0x6c, 0x61, 0x72, 0x73, 0x68, 0x69, 0x70, 0x63,
- 0x6f, 0x6e, 0x73, 0x75, 0x6d, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x69, 0x6e, 0x73,
- 0x74, 0x72, 0x75, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x66, 0x6f, 0x72, 0x20, 0x65,
- 0x78, 0x61, 0x6d, 0x70, 0x6c, 0x65, 0x6f, 0x6e, 0x65, 0x20, 0x6f, 0x72, 0x20,
- 0x6d, 0x6f, 0x72, 0x65, 0x70, 0x78, 0x3b, 0x20, 0x70, 0x61, 0x64, 0x64, 0x69,
- 0x6e, 0x67, 0x74, 0x68, 0x65, 0x20, 0x63, 0x75, 0x72, 0x72, 0x65, 0x6e, 0x74,
- 0x61, 0x20, 0x73, 0x65, 0x72, 0x69, 0x65, 0x73, 0x20, 0x6f, 0x66, 0x61, 0x72,
- 0x65, 0x20, 0x75, 0x73, 0x75, 0x61, 0x6c, 0x6c, 0x79, 0x72, 0x6f, 0x6c, 0x65,
- 0x20, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x70, 0x72, 0x65, 0x76, 0x69, 0x6f,
- 0x75, 0x73, 0x6c, 0x79, 0x20, 0x64, 0x65, 0x72, 0x69, 0x76, 0x61, 0x74, 0x69,
- 0x76, 0x65, 0x73, 0x65, 0x76, 0x69, 0x64, 0x65, 0x6e, 0x63, 0x65, 0x20, 0x6f,
- 0x66, 0x65, 0x78, 0x70, 0x65, 0x72, 0x69, 0x65, 0x6e, 0x63, 0x65, 0x73, 0x63,
- 0x6f, 0x6c, 0x6f, 0x72, 0x73, 0x63, 0x68, 0x65, 0x6d, 0x65, 0x73, 0x74, 0x61,
- 0x74, 0x65, 0x64, 0x20, 0x74, 0x68, 0x61, 0x74, 0x63, 0x65, 0x72, 0x74, 0x69,
- 0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x3c, 0x2f, 0x61, 0x3e, 0x3c, 0x2f, 0x64,
- 0x69, 0x76, 0x3e, 0x0a, 0x20, 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x65, 0x64,
- 0x3d, 0x22, 0x68, 0x69, 0x67, 0x68, 0x20, 0x73, 0x63, 0x68, 0x6f, 0x6f, 0x6c,
- 0x72, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x20, 0x74, 0x6f, 0x63, 0x6f,
- 0x6d, 0x66, 0x6f, 0x72, 0x74, 0x61, 0x62, 0x6c, 0x65, 0x61, 0x64, 0x6f, 0x70,
- 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x74, 0x68, 0x72, 0x65, 0x65, 0x20,
- 0x79, 0x65, 0x61, 0x72, 0x73, 0x74, 0x68, 0x65, 0x20, 0x63, 0x6f, 0x75, 0x6e,
- 0x74, 0x72, 0x79, 0x69, 0x6e, 0x20, 0x46, 0x65, 0x62, 0x72, 0x75, 0x61, 0x72,
- 0x79, 0x73, 0x6f, 0x20, 0x74, 0x68, 0x61, 0x74, 0x20, 0x74, 0x68, 0x65, 0x70,
- 0x65, 0x6f, 0x70, 0x6c, 0x65, 0x20, 0x77, 0x68, 0x6f, 0x20, 0x70, 0x72, 0x6f,
- 0x76, 0x69, 0x64, 0x65, 0x64, 0x20, 0x62, 0x79, 0x3c, 0x70, 0x61, 0x72, 0x61,
- 0x6d, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x61, 0x66, 0x66, 0x65, 0x63, 0x74, 0x65,
- 0x64, 0x20, 0x62, 0x79, 0x69, 0x6e, 0x20, 0x74, 0x65, 0x72, 0x6d, 0x73, 0x20,
- 0x6f, 0x66, 0x61, 0x70, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x6d, 0x65, 0x6e, 0x74,
- 0x49, 0x53, 0x4f, 0x2d, 0x38, 0x38, 0x35, 0x39, 0x2d, 0x31, 0x22, 0x77, 0x61,
- 0x73, 0x20, 0x62, 0x6f, 0x72, 0x6e, 0x20, 0x69, 0x6e, 0x68, 0x69, 0x73, 0x74,
- 0x6f, 0x72, 0x69, 0x63, 0x61, 0x6c, 0x20, 0x72, 0x65, 0x67, 0x61, 0x72, 0x64,
- 0x65, 0x64, 0x20, 0x61, 0x73, 0x6d, 0x65, 0x61, 0x73, 0x75, 0x72, 0x65, 0x6d,
- 0x65, 0x6e, 0x74, 0x69, 0x73, 0x20, 0x62, 0x61, 0x73, 0x65, 0x64, 0x20, 0x6f,
- 0x6e, 0x20, 0x61, 0x6e, 0x64, 0x20, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x20, 0x3a,
- 0x20, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x28, 0x73, 0x69, 0x67,
- 0x6e, 0x69, 0x66, 0x69, 0x63, 0x61, 0x6e, 0x74, 0x63, 0x65, 0x6c, 0x65, 0x62,
- 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x6d, 0x69,
- 0x74, 0x74, 0x65, 0x64, 0x2f, 0x6a, 0x73, 0x2f, 0x6a, 0x71, 0x75, 0x65, 0x72,
- 0x79, 0x2e, 0x69, 0x73, 0x20, 0x6b, 0x6e, 0x6f, 0x77, 0x6e, 0x20, 0x61, 0x73,
- 0x74, 0x68, 0x65, 0x6f, 0x72, 0x65, 0x74, 0x69, 0x63, 0x61, 0x6c, 0x20, 0x74,
- 0x61, 0x62, 0x69, 0x6e, 0x64, 0x65, 0x78, 0x3d, 0x22, 0x69, 0x74, 0x20, 0x63,
- 0x6f, 0x75, 0x6c, 0x64, 0x20, 0x62, 0x65, 0x3c, 0x6e, 0x6f, 0x73, 0x63, 0x72,
- 0x69, 0x70, 0x74, 0x3e, 0x0a, 0x68, 0x61, 0x76, 0x69, 0x6e, 0x67, 0x20, 0x62,
- 0x65, 0x65, 0x6e, 0x0d, 0x0a, 0x3c, 0x68, 0x65, 0x61, 0x64, 0x3e, 0x0d, 0x0a,
- 0x3c, 0x20, 0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b, 0x54, 0x68, 0x65, 0x20, 0x63,
- 0x6f, 0x6d, 0x70, 0x69, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x68, 0x65, 0x20,
- 0x68, 0x61, 0x64, 0x20, 0x62, 0x65, 0x65, 0x6e, 0x70, 0x72, 0x6f, 0x64, 0x75,
- 0x63, 0x65, 0x64, 0x20, 0x62, 0x79, 0x70, 0x68, 0x69, 0x6c, 0x6f, 0x73, 0x6f,
- 0x70, 0x68, 0x65, 0x72, 0x63, 0x6f, 0x6e, 0x73, 0x74, 0x72, 0x75, 0x63, 0x74,
- 0x65, 0x64, 0x69, 0x6e, 0x74, 0x65, 0x6e, 0x64, 0x65, 0x64, 0x20, 0x74, 0x6f,
- 0x61, 0x6d, 0x6f, 0x6e, 0x67, 0x20, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x63, 0x6f,
- 0x6d, 0x70, 0x61, 0x72, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x74, 0x6f, 0x20, 0x73,
- 0x61, 0x79, 0x20, 0x74, 0x68, 0x61, 0x74, 0x45, 0x6e, 0x67, 0x69, 0x6e, 0x65,
- 0x65, 0x72, 0x69, 0x6e, 0x67, 0x61, 0x20, 0x64, 0x69, 0x66, 0x66, 0x65, 0x72,
- 0x65, 0x6e, 0x74, 0x72, 0x65, 0x66, 0x65, 0x72, 0x72, 0x65, 0x64, 0x20, 0x74,
- 0x6f, 0x64, 0x69, 0x66, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63, 0x65, 0x73, 0x62,
- 0x65, 0x6c, 0x69, 0x65, 0x66, 0x20, 0x74, 0x68, 0x61, 0x74, 0x70, 0x68, 0x6f,
- 0x74, 0x6f, 0x67, 0x72, 0x61, 0x70, 0x68, 0x73, 0x69, 0x64, 0x65, 0x6e, 0x74,
- 0x69, 0x66, 0x79, 0x69, 0x6e, 0x67, 0x48, 0x69, 0x73, 0x74, 0x6f, 0x72, 0x79,
- 0x20, 0x6f, 0x66, 0x20, 0x52, 0x65, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x63, 0x20,
- 0x6f, 0x66, 0x6e, 0x65, 0x63, 0x65, 0x73, 0x73, 0x61, 0x72, 0x69, 0x6c, 0x79,
- 0x70, 0x72, 0x6f, 0x62, 0x61, 0x62, 0x69, 0x6c, 0x69, 0x74, 0x79, 0x74, 0x65,
- 0x63, 0x68, 0x6e, 0x69, 0x63, 0x61, 0x6c, 0x6c, 0x79, 0x6c, 0x65, 0x61, 0x76,
- 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65, 0x73, 0x70, 0x65, 0x63, 0x74, 0x61,
- 0x63, 0x75, 0x6c, 0x61, 0x72, 0x66, 0x72, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e,
- 0x20, 0x6f, 0x66, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x72, 0x69, 0x63, 0x69, 0x74,
- 0x79, 0x68, 0x65, 0x61, 0x64, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x72,
- 0x65, 0x73, 0x74, 0x61, 0x75, 0x72, 0x61, 0x6e, 0x74, 0x73, 0x70, 0x61, 0x72,
- 0x74, 0x6e, 0x65, 0x72, 0x73, 0x68, 0x69, 0x70, 0x65, 0x6d, 0x70, 0x68, 0x61,
- 0x73, 0x69, 0x73, 0x20, 0x6f, 0x6e, 0x6d, 0x6f, 0x73, 0x74, 0x20, 0x72, 0x65,
- 0x63, 0x65, 0x6e, 0x74, 0x73, 0x68, 0x61, 0x72, 0x65, 0x20, 0x77, 0x69, 0x74,
- 0x68, 0x20, 0x73, 0x61, 0x79, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x61, 0x74,
- 0x66, 0x69, 0x6c, 0x6c, 0x65, 0x64, 0x20, 0x77, 0x69, 0x74, 0x68, 0x64, 0x65,
- 0x73, 0x69, 0x67, 0x6e, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x69, 0x74, 0x20, 0x69,
- 0x73, 0x20, 0x6f, 0x66, 0x74, 0x65, 0x6e, 0x22, 0x3e, 0x3c, 0x2f, 0x69, 0x66,
- 0x72, 0x61, 0x6d, 0x65, 0x3e, 0x61, 0x73, 0x20, 0x66, 0x6f, 0x6c, 0x6c, 0x6f,
- 0x77, 0x73, 0x3a, 0x6d, 0x65, 0x72, 0x67, 0x65, 0x64, 0x20, 0x77, 0x69, 0x74,
- 0x68, 0x74, 0x68, 0x72, 0x6f, 0x75, 0x67, 0x68, 0x20, 0x74, 0x68, 0x65, 0x63,
- 0x6f, 0x6d, 0x6d, 0x65, 0x72, 0x63, 0x69, 0x61, 0x6c, 0x20, 0x70, 0x6f, 0x69,
- 0x6e, 0x74, 0x65, 0x64, 0x20, 0x6f, 0x75, 0x74, 0x6f, 0x70, 0x70, 0x6f, 0x72,
- 0x74, 0x75, 0x6e, 0x69, 0x74, 0x79, 0x76, 0x69, 0x65, 0x77, 0x20, 0x6f, 0x66,
- 0x20, 0x74, 0x68, 0x65, 0x72, 0x65, 0x71, 0x75, 0x69, 0x72, 0x65, 0x6d, 0x65,
- 0x6e, 0x74, 0x64, 0x69, 0x76, 0x69, 0x73, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66,
- 0x70, 0x72, 0x6f, 0x67, 0x72, 0x61, 0x6d, 0x6d, 0x69, 0x6e, 0x67, 0x68, 0x65,
- 0x20, 0x72, 0x65, 0x63, 0x65, 0x69, 0x76, 0x65, 0x64, 0x73, 0x65, 0x74, 0x49,
- 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x22, 0x3e, 0x3c, 0x2f, 0x73, 0x70,
- 0x61, 0x6e, 0x3e, 0x3c, 0x2f, 0x69, 0x6e, 0x20, 0x4e, 0x65, 0x77, 0x20, 0x59,
- 0x6f, 0x72, 0x6b, 0x61, 0x64, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c,
- 0x20, 0x63, 0x6f, 0x6d, 0x70, 0x72, 0x65, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x0a,
- 0x0a, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x69, 0x6e, 0x63,
- 0x6f, 0x72, 0x70, 0x6f, 0x72, 0x61, 0x74, 0x65, 0x3b, 0x3c, 0x2f, 0x73, 0x63,
- 0x72, 0x69, 0x70, 0x74, 0x3e, 0x3c, 0x61, 0x74, 0x74, 0x61, 0x63, 0x68, 0x45,
- 0x76, 0x65, 0x6e, 0x74, 0x62, 0x65, 0x63, 0x61, 0x6d, 0x65, 0x20, 0x74, 0x68,
- 0x65, 0x20, 0x22, 0x20, 0x74, 0x61, 0x72, 0x67, 0x65, 0x74, 0x3d, 0x22, 0x5f,
- 0x63, 0x61, 0x72, 0x72, 0x69, 0x65, 0x64, 0x20, 0x6f, 0x75, 0x74, 0x53, 0x6f,
- 0x6d, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x73, 0x63, 0x69, 0x65,
- 0x6e, 0x63, 0x65, 0x20, 0x61, 0x6e, 0x64, 0x74, 0x68, 0x65, 0x20, 0x74, 0x69,
- 0x6d, 0x65, 0x20, 0x6f, 0x66, 0x43, 0x6f, 0x6e, 0x74, 0x61, 0x69, 0x6e, 0x65,
- 0x72, 0x22, 0x3e, 0x6d, 0x61, 0x69, 0x6e, 0x74, 0x61, 0x69, 0x6e, 0x69, 0x6e,
- 0x67, 0x43, 0x68, 0x72, 0x69, 0x73, 0x74, 0x6f, 0x70, 0x68, 0x65, 0x72, 0x4d,
- 0x75, 0x63, 0x68, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x77, 0x72, 0x69,
- 0x74, 0x69, 0x6e, 0x67, 0x73, 0x20, 0x6f, 0x66, 0x22, 0x20, 0x68, 0x65, 0x69,
- 0x67, 0x68, 0x74, 0x3d, 0x22, 0x32, 0x73, 0x69, 0x7a, 0x65, 0x20, 0x6f, 0x66,
- 0x20, 0x74, 0x68, 0x65, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x20, 0x6f,
- 0x66, 0x20, 0x6d, 0x69, 0x78, 0x74, 0x75, 0x72, 0x65, 0x20, 0x6f, 0x66, 0x20,
- 0x62, 0x65, 0x74, 0x77, 0x65, 0x65, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x45, 0x78,
- 0x61, 0x6d, 0x70, 0x6c, 0x65, 0x73, 0x20, 0x6f, 0x66, 0x65, 0x64, 0x75, 0x63,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x63, 0x6f, 0x6d, 0x70, 0x65, 0x74,
- 0x69, 0x74, 0x69, 0x76, 0x65, 0x20, 0x6f, 0x6e, 0x73, 0x75, 0x62, 0x6d, 0x69,
- 0x74, 0x3d, 0x22, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x20, 0x6f,
- 0x66, 0x64, 0x69, 0x73, 0x74, 0x69, 0x6e, 0x63, 0x74, 0x69, 0x76, 0x65, 0x2f,
- 0x44, 0x54, 0x44, 0x20, 0x58, 0x48, 0x54, 0x4d, 0x4c, 0x20, 0x72, 0x65, 0x6c,
- 0x61, 0x74, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x6f, 0x74, 0x65, 0x6e, 0x64, 0x65,
- 0x6e, 0x63, 0x79, 0x20, 0x74, 0x6f, 0x70, 0x72, 0x6f, 0x76, 0x69, 0x6e, 0x63,
- 0x65, 0x20, 0x6f, 0x66, 0x77, 0x68, 0x69, 0x63, 0x68, 0x20, 0x77, 0x6f, 0x75,
- 0x6c, 0x64, 0x64, 0x65, 0x73, 0x70, 0x69, 0x74, 0x65, 0x20, 0x74, 0x68, 0x65,
- 0x73, 0x63, 0x69, 0x65, 0x6e, 0x74, 0x69, 0x66, 0x69, 0x63, 0x20, 0x6c, 0x65,
- 0x67, 0x69, 0x73, 0x6c, 0x61, 0x74, 0x75, 0x72, 0x65, 0x2e, 0x69, 0x6e, 0x6e,
- 0x65, 0x72, 0x48, 0x54, 0x4d, 0x4c, 0x20, 0x61, 0x6c, 0x6c, 0x65, 0x67, 0x61,
- 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x41, 0x67, 0x72, 0x69, 0x63, 0x75, 0x6c, 0x74,
- 0x75, 0x72, 0x65, 0x77, 0x61, 0x73, 0x20, 0x75, 0x73, 0x65, 0x64, 0x20, 0x69,
- 0x6e, 0x61, 0x70, 0x70, 0x72, 0x6f, 0x61, 0x63, 0x68, 0x20, 0x74, 0x6f, 0x69,
- 0x6e, 0x74, 0x65, 0x6c, 0x6c, 0x69, 0x67, 0x65, 0x6e, 0x74, 0x79, 0x65, 0x61,
- 0x72, 0x73, 0x20, 0x6c, 0x61, 0x74, 0x65, 0x72, 0x2c, 0x73, 0x61, 0x6e, 0x73,
- 0x2d, 0x73, 0x65, 0x72, 0x69, 0x66, 0x64, 0x65, 0x74, 0x65, 0x72, 0x6d, 0x69,
- 0x6e, 0x69, 0x6e, 0x67, 0x50, 0x65, 0x72, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x6e,
- 0x63, 0x65, 0x61, 0x70, 0x70, 0x65, 0x61, 0x72, 0x61, 0x6e, 0x63, 0x65, 0x73,
- 0x2c, 0x20, 0x77, 0x68, 0x69, 0x63, 0x68, 0x20, 0x69, 0x73, 0x20, 0x66, 0x6f,
- 0x75, 0x6e, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x61, 0x62, 0x62, 0x72,
- 0x65, 0x76, 0x69, 0x61, 0x74, 0x65, 0x64, 0x68, 0x69, 0x67, 0x68, 0x65, 0x72,
- 0x20, 0x74, 0x68, 0x61, 0x6e, 0x73, 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x20, 0x74,
- 0x68, 0x65, 0x20, 0x69, 0x6e, 0x64, 0x69, 0x76, 0x69, 0x64, 0x75, 0x61, 0x6c,
- 0x20, 0x63, 0x6f, 0x6d, 0x70, 0x6f, 0x73, 0x65, 0x64, 0x20, 0x6f, 0x66, 0x73,
- 0x75, 0x70, 0x70, 0x6f, 0x73, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x63, 0x6c, 0x61,
- 0x69, 0x6d, 0x73, 0x20, 0x74, 0x68, 0x61, 0x74, 0x61, 0x74, 0x74, 0x72, 0x69,
- 0x62, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x66, 0x6f, 0x6e, 0x74, 0x2d, 0x73, 0x69,
- 0x7a, 0x65, 0x3a, 0x31, 0x65, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x20,
- 0x6f, 0x66, 0x48, 0x69, 0x73, 0x74, 0x6f, 0x72, 0x69, 0x63, 0x61, 0x6c, 0x20,
- 0x68, 0x69, 0x73, 0x20, 0x62, 0x72, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x61, 0x74,
- 0x20, 0x74, 0x68, 0x65, 0x20, 0x74, 0x69, 0x6d, 0x65, 0x61, 0x6e, 0x6e, 0x69,
- 0x76, 0x65, 0x72, 0x73, 0x61, 0x72, 0x79, 0x67, 0x6f, 0x76, 0x65, 0x72, 0x6e,
- 0x65, 0x64, 0x20, 0x62, 0x79, 0x72, 0x65, 0x6c, 0x61, 0x74, 0x65, 0x64, 0x20,
- 0x74, 0x6f, 0x20, 0x75, 0x6c, 0x74, 0x69, 0x6d, 0x61, 0x74, 0x65, 0x6c, 0x79,
- 0x20, 0x69, 0x6e, 0x6e, 0x6f, 0x76, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x69,
- 0x74, 0x20, 0x69, 0x73, 0x20, 0x73, 0x74, 0x69, 0x6c, 0x6c, 0x63, 0x61, 0x6e,
- 0x20, 0x6f, 0x6e, 0x6c, 0x79, 0x20, 0x62, 0x65, 0x64, 0x65, 0x66, 0x69, 0x6e,
- 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x74, 0x6f, 0x47, 0x4d, 0x54, 0x53, 0x74,
- 0x72, 0x69, 0x6e, 0x67, 0x41, 0x20, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x20,
- 0x6f, 0x66, 0x69, 0x6d, 0x67, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22,
- 0x45, 0x76, 0x65, 0x6e, 0x74, 0x75, 0x61, 0x6c, 0x6c, 0x79, 0x2c, 0x77, 0x61,
- 0x73, 0x20, 0x63, 0x68, 0x61, 0x6e, 0x67, 0x65, 0x64, 0x6f, 0x63, 0x63, 0x75,
- 0x72, 0x72, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x6e, 0x65, 0x69, 0x67, 0x68, 0x62,
- 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x64, 0x69, 0x73, 0x74, 0x69, 0x6e, 0x67, 0x75,
- 0x69, 0x73, 0x68, 0x77, 0x68, 0x65, 0x6e, 0x20, 0x68, 0x65, 0x20, 0x77, 0x61,
- 0x73, 0x69, 0x6e, 0x74, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x69, 0x6e, 0x67, 0x74,
- 0x65, 0x72, 0x72, 0x65, 0x73, 0x74, 0x72, 0x69, 0x61, 0x6c, 0x4d, 0x61, 0x6e,
- 0x79, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x61, 0x72, 0x67, 0x75, 0x65,
- 0x73, 0x20, 0x74, 0x68, 0x61, 0x74, 0x61, 0x6e, 0x20, 0x41, 0x6d, 0x65, 0x72,
- 0x69, 0x63, 0x61, 0x6e, 0x63, 0x6f, 0x6e, 0x71, 0x75, 0x65, 0x73, 0x74, 0x20,
- 0x6f, 0x66, 0x77, 0x69, 0x64, 0x65, 0x73, 0x70, 0x72, 0x65, 0x61, 0x64, 0x20,
- 0x77, 0x65, 0x72, 0x65, 0x20, 0x6b, 0x69, 0x6c, 0x6c, 0x65, 0x64, 0x73, 0x63,
- 0x72, 0x65, 0x65, 0x6e, 0x20, 0x61, 0x6e, 0x64, 0x20, 0x49, 0x6e, 0x20, 0x6f,
- 0x72, 0x64, 0x65, 0x72, 0x20, 0x74, 0x6f, 0x65, 0x78, 0x70, 0x65, 0x63, 0x74,
- 0x65, 0x64, 0x20, 0x74, 0x6f, 0x64, 0x65, 0x73, 0x63, 0x65, 0x6e, 0x64, 0x61,
- 0x6e, 0x74, 0x73, 0x61, 0x72, 0x65, 0x20, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x65,
- 0x64, 0x6c, 0x65, 0x67, 0x69, 0x73, 0x6c, 0x61, 0x74, 0x69, 0x76, 0x65, 0x67,
- 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x20, 0x62, 0x61,
- 0x63, 0x6b, 0x67, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x6d, 0x6f, 0x73, 0x74, 0x20,
- 0x70, 0x65, 0x6f, 0x70, 0x6c, 0x65, 0x79, 0x65, 0x61, 0x72, 0x73, 0x20, 0x61,
- 0x66, 0x74, 0x65, 0x72, 0x74, 0x68, 0x65, 0x72, 0x65, 0x20, 0x69, 0x73, 0x20,
- 0x6e, 0x6f, 0x74, 0x68, 0x65, 0x20, 0x68, 0x69, 0x67, 0x68, 0x65, 0x73, 0x74,
- 0x66, 0x72, 0x65, 0x71, 0x75, 0x65, 0x6e, 0x74, 0x6c, 0x79, 0x20, 0x74, 0x68,
- 0x65, 0x79, 0x20, 0x64, 0x6f, 0x20, 0x6e, 0x6f, 0x74, 0x61, 0x72, 0x67, 0x75,
- 0x65, 0x64, 0x20, 0x74, 0x68, 0x61, 0x74, 0x73, 0x68, 0x6f, 0x77, 0x65, 0x64,
- 0x20, 0x74, 0x68, 0x61, 0x74, 0x70, 0x72, 0x65, 0x64, 0x6f, 0x6d, 0x69, 0x6e,
- 0x61, 0x6e, 0x74, 0x74, 0x68, 0x65, 0x6f, 0x6c, 0x6f, 0x67, 0x69, 0x63, 0x61,
- 0x6c, 0x62, 0x79, 0x20, 0x74, 0x68, 0x65, 0x20, 0x74, 0x69, 0x6d, 0x65, 0x63,
- 0x6f, 0x6e, 0x73, 0x69, 0x64, 0x65, 0x72, 0x69, 0x6e, 0x67, 0x73, 0x68, 0x6f,
- 0x72, 0x74, 0x2d, 0x6c, 0x69, 0x76, 0x65, 0x64, 0x3c, 0x2f, 0x73, 0x70, 0x61,
- 0x6e, 0x3e, 0x3c, 0x2f, 0x61, 0x3e, 0x63, 0x61, 0x6e, 0x20, 0x62, 0x65, 0x20,
- 0x75, 0x73, 0x65, 0x64, 0x76, 0x65, 0x72, 0x79, 0x20, 0x6c, 0x69, 0x74, 0x74,
- 0x6c, 0x65, 0x6f, 0x6e, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20,
- 0x68, 0x61, 0x64, 0x20, 0x61, 0x6c, 0x72, 0x65, 0x61, 0x64, 0x79, 0x69, 0x6e,
- 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x63, 0x6f, 0x6d, 0x6d,
- 0x75, 0x6e, 0x69, 0x63, 0x61, 0x74, 0x65, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72,
- 0x65, 0x73, 0x20, 0x6f, 0x66, 0x67, 0x6f, 0x76, 0x65, 0x72, 0x6e, 0x6d, 0x65,
- 0x6e, 0x74, 0x2c, 0x3c, 0x2f, 0x6e, 0x6f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
- 0x3e, 0x65, 0x6e, 0x74, 0x65, 0x72, 0x65, 0x64, 0x20, 0x74, 0x68, 0x65, 0x22,
- 0x20, 0x68, 0x65, 0x69, 0x67, 0x68, 0x74, 0x3d, 0x22, 0x33, 0x49, 0x6e, 0x64,
- 0x65, 0x70, 0x65, 0x6e, 0x64, 0x65, 0x6e, 0x74, 0x70, 0x6f, 0x70, 0x75, 0x6c,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x6c, 0x61, 0x72, 0x67, 0x65, 0x2d, 0x73,
- 0x63, 0x61, 0x6c, 0x65, 0x2e, 0x20, 0x41, 0x6c, 0x74, 0x68, 0x6f, 0x75, 0x67,
- 0x68, 0x20, 0x75, 0x73, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65,
- 0x64, 0x65, 0x73, 0x74, 0x72, 0x75, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x70, 0x6f,
- 0x73, 0x73, 0x69, 0x62, 0x69, 0x6c, 0x69, 0x74, 0x79, 0x73, 0x74, 0x61, 0x72,
- 0x74, 0x69, 0x6e, 0x67, 0x20, 0x69, 0x6e, 0x74, 0x77, 0x6f, 0x20, 0x6f, 0x72,
- 0x20, 0x6d, 0x6f, 0x72, 0x65, 0x65, 0x78, 0x70, 0x72, 0x65, 0x73, 0x73, 0x69,
- 0x6f, 0x6e, 0x73, 0x73, 0x75, 0x62, 0x6f, 0x72, 0x64, 0x69, 0x6e, 0x61, 0x74,
- 0x65, 0x6c, 0x61, 0x72, 0x67, 0x65, 0x72, 0x20, 0x74, 0x68, 0x61, 0x6e, 0x68,
- 0x69, 0x73, 0x74, 0x6f, 0x72, 0x79, 0x20, 0x61, 0x6e, 0x64, 0x3c, 0x2f, 0x6f,
- 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x3e, 0x0d, 0x0a, 0x43, 0x6f, 0x6e, 0x74, 0x69,
- 0x6e, 0x65, 0x6e, 0x74, 0x61, 0x6c, 0x65, 0x6c, 0x69, 0x6d, 0x69, 0x6e, 0x61,
- 0x74, 0x69, 0x6e, 0x67, 0x77, 0x69, 0x6c, 0x6c, 0x20, 0x6e, 0x6f, 0x74, 0x20,
- 0x62, 0x65, 0x70, 0x72, 0x61, 0x63, 0x74, 0x69, 0x63, 0x65, 0x20, 0x6f, 0x66,
- 0x69, 0x6e, 0x20, 0x66, 0x72, 0x6f, 0x6e, 0x74, 0x20, 0x6f, 0x66, 0x73, 0x69,
- 0x74, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x65, 0x6e, 0x73, 0x75,
- 0x72, 0x65, 0x20, 0x74, 0x68, 0x61, 0x74, 0x74, 0x6f, 0x20, 0x63, 0x72, 0x65,
- 0x61, 0x74, 0x65, 0x20, 0x61, 0x6d, 0x69, 0x73, 0x73, 0x69, 0x73, 0x73, 0x69,
- 0x70, 0x70, 0x69, 0x70, 0x6f, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x61, 0x6c, 0x6c,
- 0x79, 0x6f, 0x75, 0x74, 0x73, 0x74, 0x61, 0x6e, 0x64, 0x69, 0x6e, 0x67, 0x62,
- 0x65, 0x74, 0x74, 0x65, 0x72, 0x20, 0x74, 0x68, 0x61, 0x6e, 0x77, 0x68, 0x61,
- 0x74, 0x20, 0x69, 0x73, 0x20, 0x6e, 0x6f, 0x77, 0x73, 0x69, 0x74, 0x75, 0x61,
- 0x74, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x6d, 0x65, 0x74, 0x61, 0x20, 0x6e, 0x61,
- 0x6d, 0x65, 0x3d, 0x22, 0x54, 0x72, 0x61, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e,
- 0x61, 0x6c, 0x73, 0x75, 0x67, 0x67, 0x65, 0x73, 0x74, 0x69, 0x6f, 0x6e, 0x73,
- 0x54, 0x72, 0x61, 0x6e, 0x73, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x74, 0x68,
- 0x65, 0x20, 0x66, 0x6f, 0x72, 0x6d, 0x20, 0x6f, 0x66, 0x61, 0x74, 0x6d, 0x6f,
- 0x73, 0x70, 0x68, 0x65, 0x72, 0x69, 0x63, 0x69, 0x64, 0x65, 0x6f, 0x6c, 0x6f,
- 0x67, 0x69, 0x63, 0x61, 0x6c, 0x65, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x69,
- 0x73, 0x65, 0x73, 0x63, 0x61, 0x6c, 0x63, 0x75, 0x6c, 0x61, 0x74, 0x69, 0x6e,
- 0x67, 0x65, 0x61, 0x73, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x72,
- 0x65, 0x6d, 0x6e, 0x61, 0x6e, 0x74, 0x73, 0x20, 0x6f, 0x66, 0x70, 0x6c, 0x75,
- 0x67, 0x69, 0x6e, 0x73, 0x70, 0x61, 0x67, 0x65, 0x2f, 0x69, 0x6e, 0x64, 0x65,
- 0x78, 0x2e, 0x70, 0x68, 0x70, 0x3f, 0x72, 0x65, 0x6d, 0x61, 0x69, 0x6e, 0x65,
- 0x64, 0x20, 0x69, 0x6e, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x66, 0x6f, 0x72, 0x6d,
- 0x65, 0x64, 0x48, 0x65, 0x20, 0x77, 0x61, 0x73, 0x20, 0x61, 0x6c, 0x73, 0x6f,
- 0x77, 0x61, 0x73, 0x20, 0x61, 0x6c, 0x72, 0x65, 0x61, 0x64, 0x79, 0x73, 0x74,
- 0x61, 0x74, 0x69, 0x73, 0x74, 0x69, 0x63, 0x61, 0x6c, 0x69, 0x6e, 0x20, 0x66,
- 0x61, 0x76, 0x6f, 0x72, 0x20, 0x6f, 0x66, 0x4d, 0x69, 0x6e, 0x69, 0x73, 0x74,
- 0x72, 0x79, 0x20, 0x6f, 0x66, 0x6d, 0x6f, 0x76, 0x65, 0x6d, 0x65, 0x6e, 0x74,
- 0x20, 0x6f, 0x66, 0x66, 0x6f, 0x72, 0x6d, 0x75, 0x6c, 0x61, 0x74, 0x69, 0x6f,
- 0x6e, 0x69, 0x73, 0x20, 0x72, 0x65, 0x71, 0x75, 0x69, 0x72, 0x65, 0x64, 0x3c,
- 0x6c, 0x69, 0x6e, 0x6b, 0x20, 0x72, 0x65, 0x6c, 0x3d, 0x22, 0x54, 0x68, 0x69,
- 0x73, 0x20, 0x69, 0x73, 0x20, 0x74, 0x68, 0x65, 0x20, 0x3c, 0x61, 0x20, 0x68,
- 0x72, 0x65, 0x66, 0x3d, 0x22, 0x2f, 0x70, 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x72,
- 0x69, 0x7a, 0x65, 0x64, 0x69, 0x6e, 0x76, 0x6f, 0x6c, 0x76, 0x65, 0x64, 0x20,
- 0x69, 0x6e, 0x61, 0x72, 0x65, 0x20, 0x75, 0x73, 0x65, 0x64, 0x20, 0x74, 0x6f,
- 0x61, 0x6e, 0x64, 0x20, 0x73, 0x65, 0x76, 0x65, 0x72, 0x61, 0x6c, 0x6d, 0x61,
- 0x64, 0x65, 0x20, 0x62, 0x79, 0x20, 0x74, 0x68, 0x65, 0x73, 0x65, 0x65, 0x6d,
- 0x73, 0x20, 0x74, 0x6f, 0x20, 0x62, 0x65, 0x6c, 0x69, 0x6b, 0x65, 0x6c, 0x79,
- 0x20, 0x74, 0x68, 0x61, 0x74, 0x50, 0x61, 0x6c, 0x65, 0x73, 0x74, 0x69, 0x6e,
- 0x69, 0x61, 0x6e, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x20, 0x61, 0x66, 0x74, 0x65,
- 0x72, 0x69, 0x74, 0x20, 0x68, 0x61, 0x64, 0x20, 0x62, 0x65, 0x65, 0x6e, 0x6d,
- 0x6f, 0x73, 0x74, 0x20, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x74, 0x6f, 0x20,
- 0x72, 0x65, 0x66, 0x65, 0x72, 0x20, 0x74, 0x6f, 0x62, 0x75, 0x74, 0x20, 0x74,
- 0x68, 0x69, 0x73, 0x20, 0x69, 0x73, 0x63, 0x6f, 0x6e, 0x73, 0x65, 0x63, 0x75,
- 0x74, 0x69, 0x76, 0x65, 0x74, 0x65, 0x6d, 0x70, 0x6f, 0x72, 0x61, 0x72, 0x69,
- 0x6c, 0x79, 0x49, 0x6e, 0x20, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x6c, 0x2c,
- 0x63, 0x6f, 0x6e, 0x76, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x74, 0x61,
- 0x6b, 0x65, 0x73, 0x20, 0x70, 0x6c, 0x61, 0x63, 0x65, 0x73, 0x75, 0x62, 0x64,
- 0x69, 0x76, 0x69, 0x73, 0x69, 0x6f, 0x6e, 0x74, 0x65, 0x72, 0x72, 0x69, 0x74,
- 0x6f, 0x72, 0x69, 0x61, 0x6c, 0x6f, 0x70, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f,
- 0x6e, 0x61, 0x6c, 0x70, 0x65, 0x72, 0x6d, 0x61, 0x6e, 0x65, 0x6e, 0x74, 0x6c,
- 0x79, 0x77, 0x61, 0x73, 0x20, 0x6c, 0x61, 0x72, 0x67, 0x65, 0x6c, 0x79, 0x6f,
- 0x75, 0x74, 0x62, 0x72, 0x65, 0x61, 0x6b, 0x20, 0x6f, 0x66, 0x69, 0x6e, 0x20,
- 0x74, 0x68, 0x65, 0x20, 0x70, 0x61, 0x73, 0x74, 0x66, 0x6f, 0x6c, 0x6c, 0x6f,
- 0x77, 0x69, 0x6e, 0x67, 0x20, 0x61, 0x20, 0x78, 0x6d, 0x6c, 0x6e, 0x73, 0x3a,
- 0x6f, 0x67, 0x3d, 0x22, 0x3e, 0x3c, 0x61, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73,
- 0x3d, 0x22, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x74, 0x65, 0x78, 0x74,
- 0x43, 0x6f, 0x6e, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x20, 0x6d, 0x61,
- 0x79, 0x20, 0x62, 0x65, 0x20, 0x75, 0x73, 0x65, 0x64, 0x6d, 0x61, 0x6e, 0x75,
- 0x66, 0x61, 0x63, 0x74, 0x75, 0x72, 0x65, 0x61, 0x66, 0x74, 0x65, 0x72, 0x20,
- 0x62, 0x65, 0x69, 0x6e, 0x67, 0x63, 0x6c, 0x65, 0x61, 0x72, 0x66, 0x69, 0x78,
- 0x22, 0x3e, 0x0a, 0x71, 0x75, 0x65, 0x73, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f,
- 0x66, 0x77, 0x61, 0x73, 0x20, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x65, 0x64, 0x74,
- 0x6f, 0x20, 0x62, 0x65, 0x63, 0x6f, 0x6d, 0x65, 0x20, 0x61, 0x62, 0x65, 0x63,
- 0x61, 0x75, 0x73, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x73, 0x6f, 0x6d, 0x65, 0x20,
- 0x70, 0x65, 0x6f, 0x70, 0x6c, 0x65, 0x69, 0x6e, 0x73, 0x70, 0x69, 0x72, 0x65,
- 0x64, 0x20, 0x62, 0x79, 0x73, 0x75, 0x63, 0x63, 0x65, 0x73, 0x73, 0x66, 0x75,
- 0x6c, 0x20, 0x61, 0x20, 0x74, 0x69, 0x6d, 0x65, 0x20, 0x77, 0x68, 0x65, 0x6e,
- 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x61, 0x6d,
- 0x6f, 0x6e, 0x67, 0x73, 0x74, 0x20, 0x74, 0x68, 0x65, 0x61, 0x6e, 0x20, 0x6f,
- 0x66, 0x66, 0x69, 0x63, 0x69, 0x61, 0x6c, 0x77, 0x69, 0x64, 0x74, 0x68, 0x3a,
- 0x31, 0x30, 0x30, 0x25, 0x3b, 0x74, 0x65, 0x63, 0x68, 0x6e, 0x6f, 0x6c, 0x6f,
- 0x67, 0x79, 0x2c, 0x77, 0x61, 0x73, 0x20, 0x61, 0x64, 0x6f, 0x70, 0x74, 0x65,
- 0x64, 0x74, 0x6f, 0x20, 0x6b, 0x65, 0x65, 0x70, 0x20, 0x74, 0x68, 0x65, 0x73,
- 0x65, 0x74, 0x74, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x6c, 0x69, 0x76,
- 0x65, 0x20, 0x62, 0x69, 0x72, 0x74, 0x68, 0x73, 0x69, 0x6e, 0x64, 0x65, 0x78,
- 0x2e, 0x68, 0x74, 0x6d, 0x6c, 0x22, 0x43, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74,
- 0x69, 0x63, 0x75, 0x74, 0x61, 0x73, 0x73, 0x69, 0x67, 0x6e, 0x65, 0x64, 0x20,
- 0x74, 0x6f, 0x26, 0x61, 0x6d, 0x70, 0x3b, 0x74, 0x69, 0x6d, 0x65, 0x73, 0x3b,
- 0x61, 0x63, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x20, 0x66, 0x6f, 0x72, 0x61, 0x6c,
- 0x69, 0x67, 0x6e, 0x3d, 0x72, 0x69, 0x67, 0x68, 0x74, 0x74, 0x68, 0x65, 0x20,
- 0x63, 0x6f, 0x6d, 0x70, 0x61, 0x6e, 0x79, 0x61, 0x6c, 0x77, 0x61, 0x79, 0x73,
- 0x20, 0x62, 0x65, 0x65, 0x6e, 0x72, 0x65, 0x74, 0x75, 0x72, 0x6e, 0x65, 0x64,
- 0x20, 0x74, 0x6f, 0x69, 0x6e, 0x76, 0x6f, 0x6c, 0x76, 0x65, 0x6d, 0x65, 0x6e,
- 0x74, 0x42, 0x65, 0x63, 0x61, 0x75, 0x73, 0x65, 0x20, 0x74, 0x68, 0x65, 0x74,
- 0x68, 0x69, 0x73, 0x20, 0x70, 0x65, 0x72, 0x69, 0x6f, 0x64, 0x22, 0x20, 0x6e,
- 0x61, 0x6d, 0x65, 0x3d, 0x22, 0x71, 0x22, 0x20, 0x63, 0x6f, 0x6e, 0x66, 0x69,
- 0x6e, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x61, 0x20, 0x72, 0x65, 0x73, 0x75, 0x6c,
- 0x74, 0x20, 0x6f, 0x66, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3d, 0x22, 0x22, 0x20,
- 0x2f, 0x3e, 0x69, 0x73, 0x20, 0x61, 0x63, 0x74, 0x75, 0x61, 0x6c, 0x6c, 0x79,
- 0x45, 0x6e, 0x76, 0x69, 0x72, 0x6f, 0x6e, 0x6d, 0x65, 0x6e, 0x74, 0x0d, 0x0a,
- 0x3c, 0x2f, 0x68, 0x65, 0x61, 0x64, 0x3e, 0x0d, 0x0a, 0x43, 0x6f, 0x6e, 0x76,
- 0x65, 0x72, 0x73, 0x65, 0x6c, 0x79, 0x2c, 0x3e, 0x0a, 0x3c, 0x64, 0x69, 0x76,
- 0x20, 0x69, 0x64, 0x3d, 0x22, 0x30, 0x22, 0x20, 0x77, 0x69, 0x64, 0x74, 0x68,
- 0x3d, 0x22, 0x31, 0x69, 0x73, 0x20, 0x70, 0x72, 0x6f, 0x62, 0x61, 0x62, 0x6c,
- 0x79, 0x68, 0x61, 0x76, 0x65, 0x20, 0x62, 0x65, 0x63, 0x6f, 0x6d, 0x65, 0x63,
- 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x6c, 0x69, 0x6e, 0x67, 0x74, 0x68, 0x65,
- 0x20, 0x70, 0x72, 0x6f, 0x62, 0x6c, 0x65, 0x6d, 0x63, 0x69, 0x74, 0x69, 0x7a,
- 0x65, 0x6e, 0x73, 0x20, 0x6f, 0x66, 0x70, 0x6f, 0x6c, 0x69, 0x74, 0x69, 0x63,
- 0x69, 0x61, 0x6e, 0x73, 0x72, 0x65, 0x61, 0x63, 0x68, 0x65, 0x64, 0x20, 0x74,
- 0x68, 0x65, 0x61, 0x73, 0x20, 0x65, 0x61, 0x72, 0x6c, 0x79, 0x20, 0x61, 0x73,
- 0x3a, 0x6e, 0x6f, 0x6e, 0x65, 0x3b, 0x20, 0x6f, 0x76, 0x65, 0x72, 0x3c, 0x74,
- 0x61, 0x62, 0x6c, 0x65, 0x20, 0x63, 0x65, 0x6c, 0x6c, 0x76, 0x61, 0x6c, 0x69,
- 0x64, 0x69, 0x74, 0x79, 0x20, 0x6f, 0x66, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74,
- 0x6c, 0x79, 0x20, 0x74, 0x6f, 0x6f, 0x6e, 0x6d, 0x6f, 0x75, 0x73, 0x65, 0x64,
- 0x6f, 0x77, 0x6e, 0x77, 0x68, 0x65, 0x72, 0x65, 0x20, 0x69, 0x74, 0x20, 0x69,
- 0x73, 0x77, 0x68, 0x65, 0x6e, 0x20, 0x69, 0x74, 0x20, 0x77, 0x61, 0x73, 0x6d,
- 0x65, 0x6d, 0x62, 0x65, 0x72, 0x73, 0x20, 0x6f, 0x66, 0x20, 0x72, 0x65, 0x6c,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x74, 0x6f, 0x61, 0x63, 0x63, 0x6f, 0x6d,
- 0x6d, 0x6f, 0x64, 0x61, 0x74, 0x65, 0x61, 0x6c, 0x6f, 0x6e, 0x67, 0x20, 0x77,
- 0x69, 0x74, 0x68, 0x20, 0x49, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x6c, 0x61,
- 0x74, 0x65, 0x74, 0x68, 0x65, 0x20, 0x45, 0x6e, 0x67, 0x6c, 0x69, 0x73, 0x68,
- 0x64, 0x65, 0x6c, 0x69, 0x63, 0x69, 0x6f, 0x75, 0x73, 0x22, 0x3e, 0x74, 0x68,
- 0x69, 0x73, 0x20, 0x69, 0x73, 0x20, 0x6e, 0x6f, 0x74, 0x74, 0x68, 0x65, 0x20,
- 0x70, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x74, 0x69, 0x66, 0x20, 0x74, 0x68, 0x65,
- 0x79, 0x20, 0x61, 0x72, 0x65, 0x61, 0x6e, 0x64, 0x20, 0x66, 0x69, 0x6e, 0x61,
- 0x6c, 0x6c, 0x79, 0x61, 0x20, 0x6d, 0x61, 0x74, 0x74, 0x65, 0x72, 0x20, 0x6f,
- 0x66, 0x0d, 0x0a, 0x09, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0d, 0x0a, 0x0d,
- 0x0a, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x66, 0x61, 0x73,
- 0x74, 0x65, 0x72, 0x20, 0x74, 0x68, 0x61, 0x6e, 0x6d, 0x61, 0x6a, 0x6f, 0x72,
- 0x69, 0x74, 0x79, 0x20, 0x6f, 0x66, 0x61, 0x66, 0x74, 0x65, 0x72, 0x20, 0x77,
- 0x68, 0x69, 0x63, 0x68, 0x63, 0x6f, 0x6d, 0x70, 0x61, 0x72, 0x61, 0x74, 0x69,
- 0x76, 0x65, 0x74, 0x6f, 0x20, 0x6d, 0x61, 0x69, 0x6e, 0x74, 0x61, 0x69, 0x6e,
- 0x69, 0x6d, 0x70, 0x72, 0x6f, 0x76, 0x65, 0x20, 0x74, 0x68, 0x65, 0x61, 0x77,
- 0x61, 0x72, 0x64, 0x65, 0x64, 0x20, 0x74, 0x68, 0x65, 0x65, 0x72, 0x22, 0x20,
- 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x66, 0x72, 0x61, 0x6d, 0x65, 0x62,
- 0x6f, 0x72, 0x64, 0x65, 0x72, 0x72, 0x65, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x74,
- 0x69, 0x6f, 0x6e, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x73, 0x61, 0x6d,
- 0x65, 0x61, 0x6e, 0x61, 0x6c, 0x79, 0x73, 0x69, 0x73, 0x20, 0x6f, 0x66, 0x74,
- 0x68, 0x65, 0x69, 0x72, 0x20, 0x66, 0x69, 0x72, 0x73, 0x74, 0x44, 0x75, 0x72,
- 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65, 0x20, 0x63, 0x6f, 0x6e, 0x74, 0x69,
- 0x6e, 0x65, 0x6e, 0x74, 0x61, 0x6c, 0x73, 0x65, 0x71, 0x75, 0x65, 0x6e, 0x63,
- 0x65, 0x20, 0x6f, 0x66, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x28,
- 0x29, 0x7b, 0x66, 0x6f, 0x6e, 0x74, 0x2d, 0x73, 0x69, 0x7a, 0x65, 0x3a, 0x20,
- 0x77, 0x6f, 0x72, 0x6b, 0x20, 0x6f, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x3c, 0x2f,
- 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x0a, 0x3c, 0x62, 0x65, 0x67, 0x69,
- 0x6e, 0x73, 0x20, 0x77, 0x69, 0x74, 0x68, 0x6a, 0x61, 0x76, 0x61, 0x73, 0x63,
- 0x72, 0x69, 0x70, 0x74, 0x3a, 0x63, 0x6f, 0x6e, 0x73, 0x74, 0x69, 0x74, 0x75,
- 0x65, 0x6e, 0x74, 0x77, 0x61, 0x73, 0x20, 0x66, 0x6f, 0x75, 0x6e, 0x64, 0x65,
- 0x64, 0x65, 0x71, 0x75, 0x69, 0x6c, 0x69, 0x62, 0x72, 0x69, 0x75, 0x6d, 0x61,
- 0x73, 0x73, 0x75, 0x6d, 0x65, 0x20, 0x74, 0x68, 0x61, 0x74, 0x69, 0x73, 0x20,
- 0x67, 0x69, 0x76, 0x65, 0x6e, 0x20, 0x62, 0x79, 0x6e, 0x65, 0x65, 0x64, 0x73,
- 0x20, 0x74, 0x6f, 0x20, 0x62, 0x65, 0x63, 0x6f, 0x6f, 0x72, 0x64, 0x69, 0x6e,
- 0x61, 0x74, 0x65, 0x73, 0x74, 0x68, 0x65, 0x20, 0x76, 0x61, 0x72, 0x69, 0x6f,
- 0x75, 0x73, 0x61, 0x72, 0x65, 0x20, 0x70, 0x61, 0x72, 0x74, 0x20, 0x6f, 0x66,
- 0x6f, 0x6e, 0x6c, 0x79, 0x20, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x73, 0x65,
- 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x20, 0x6f, 0x66, 0x69, 0x73, 0x20, 0x61,
- 0x20, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x74, 0x68, 0x65, 0x6f, 0x72, 0x69,
- 0x65, 0x73, 0x20, 0x6f, 0x66, 0x64, 0x69, 0x73, 0x63, 0x6f, 0x76, 0x65, 0x72,
- 0x69, 0x65, 0x73, 0x61, 0x73, 0x73, 0x6f, 0x63, 0x69, 0x61, 0x74, 0x69, 0x6f,
- 0x6e, 0x65, 0x64, 0x67, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x73,
- 0x74, 0x72, 0x65, 0x6e, 0x67, 0x74, 0x68, 0x20, 0x6f, 0x66, 0x70, 0x6f, 0x73,
- 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x69, 0x6e, 0x70, 0x72, 0x65, 0x73, 0x65,
- 0x6e, 0x74, 0x2d, 0x64, 0x61, 0x79, 0x75, 0x6e, 0x69, 0x76, 0x65, 0x72, 0x73,
- 0x61, 0x6c, 0x6c, 0x79, 0x74, 0x6f, 0x20, 0x66, 0x6f, 0x72, 0x6d, 0x20, 0x74,
- 0x68, 0x65, 0x62, 0x75, 0x74, 0x20, 0x69, 0x6e, 0x73, 0x74, 0x65, 0x61, 0x64,
- 0x63, 0x6f, 0x72, 0x70, 0x6f, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x74,
- 0x74, 0x61, 0x63, 0x68, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x69, 0x73, 0x20, 0x63,
- 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x6c, 0x79, 0x72, 0x65, 0x61, 0x73, 0x6f, 0x6e,
- 0x73, 0x20, 0x66, 0x6f, 0x72, 0x20, 0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b, 0x74,
- 0x68, 0x65, 0x20, 0x63, 0x61, 0x6e, 0x20, 0x62, 0x65, 0x20, 0x6d, 0x61, 0x64,
- 0x65, 0x77, 0x61, 0x73, 0x20, 0x61, 0x62, 0x6c, 0x65, 0x20, 0x74, 0x6f, 0x77,
- 0x68, 0x69, 0x63, 0x68, 0x20, 0x6d, 0x65, 0x61, 0x6e, 0x73, 0x62, 0x75, 0x74,
- 0x20, 0x64, 0x69, 0x64, 0x20, 0x6e, 0x6f, 0x74, 0x6f, 0x6e, 0x4d, 0x6f, 0x75,
- 0x73, 0x65, 0x4f, 0x76, 0x65, 0x72, 0x61, 0x73, 0x20, 0x70, 0x6f, 0x73, 0x73,
- 0x69, 0x62, 0x6c, 0x65, 0x6f, 0x70, 0x65, 0x72, 0x61, 0x74, 0x65, 0x64, 0x20,
- 0x62, 0x79, 0x63, 0x6f, 0x6d, 0x69, 0x6e, 0x67, 0x20, 0x66, 0x72, 0x6f, 0x6d,
- 0x74, 0x68, 0x65, 0x20, 0x70, 0x72, 0x69, 0x6d, 0x61, 0x72, 0x79, 0x61, 0x64,
- 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x66, 0x6f, 0x72, 0x20,
- 0x73, 0x65, 0x76, 0x65, 0x72, 0x61, 0x6c, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x66,
- 0x65, 0x72, 0x72, 0x65, 0x64, 0x61, 0x20, 0x70, 0x65, 0x72, 0x69, 0x6f, 0x64,
- 0x20, 0x6f, 0x66, 0x61, 0x72, 0x65, 0x20, 0x61, 0x62, 0x6c, 0x65, 0x20, 0x74,
- 0x6f, 0x68, 0x6f, 0x77, 0x65, 0x76, 0x65, 0x72, 0x2c, 0x20, 0x69, 0x74, 0x73,
- 0x68, 0x6f, 0x75, 0x6c, 0x64, 0x20, 0x68, 0x61, 0x76, 0x65, 0x6d, 0x75, 0x63,
- 0x68, 0x20, 0x6c, 0x61, 0x72, 0x67, 0x65, 0x72, 0x0a, 0x09, 0x3c, 0x2f, 0x73,
- 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x61, 0x64, 0x6f, 0x70, 0x74, 0x65, 0x64,
- 0x20, 0x74, 0x68, 0x65, 0x70, 0x72, 0x6f, 0x70, 0x65, 0x72, 0x74, 0x79, 0x20,
- 0x6f, 0x66, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x65, 0x64, 0x20, 0x62, 0x79,
- 0x65, 0x66, 0x66, 0x65, 0x63, 0x74, 0x69, 0x76, 0x65, 0x6c, 0x79, 0x77, 0x61,
- 0x73, 0x20, 0x62, 0x72, 0x6f, 0x75, 0x67, 0x68, 0x74, 0x63, 0x68, 0x69, 0x6c,
- 0x64, 0x72, 0x65, 0x6e, 0x20, 0x6f, 0x66, 0x50, 0x72, 0x6f, 0x67, 0x72, 0x61,
- 0x6d, 0x6d, 0x69, 0x6e, 0x67, 0x6c, 0x6f, 0x6e, 0x67, 0x65, 0x72, 0x20, 0x74,
- 0x68, 0x61, 0x6e, 0x6d, 0x61, 0x6e, 0x75, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
- 0x73, 0x77, 0x61, 0x72, 0x20, 0x61, 0x67, 0x61, 0x69, 0x6e, 0x73, 0x74, 0x62,
- 0x79, 0x20, 0x6d, 0x65, 0x61, 0x6e, 0x73, 0x20, 0x6f, 0x66, 0x61, 0x6e, 0x64,
- 0x20, 0x6d, 0x6f, 0x73, 0x74, 0x20, 0x6f, 0x66, 0x73, 0x69, 0x6d, 0x69, 0x6c,
- 0x61, 0x72, 0x20, 0x74, 0x6f, 0x20, 0x70, 0x72, 0x6f, 0x70, 0x72, 0x69, 0x65,
- 0x74, 0x61, 0x72, 0x79, 0x6f, 0x72, 0x69, 0x67, 0x69, 0x6e, 0x61, 0x74, 0x69,
- 0x6e, 0x67, 0x70, 0x72, 0x65, 0x73, 0x74, 0x69, 0x67, 0x69, 0x6f, 0x75, 0x73,
- 0x67, 0x72, 0x61, 0x6d, 0x6d, 0x61, 0x74, 0x69, 0x63, 0x61, 0x6c, 0x65, 0x78,
- 0x70, 0x65, 0x72, 0x69, 0x65, 0x6e, 0x63, 0x65, 0x2e, 0x74, 0x6f, 0x20, 0x6d,
- 0x61, 0x6b, 0x65, 0x20, 0x74, 0x68, 0x65, 0x49, 0x74, 0x20, 0x77, 0x61, 0x73,
- 0x20, 0x61, 0x6c, 0x73, 0x6f, 0x69, 0x73, 0x20, 0x66, 0x6f, 0x75, 0x6e, 0x64,
- 0x20, 0x69, 0x6e, 0x63, 0x6f, 0x6d, 0x70, 0x65, 0x74, 0x69, 0x74, 0x6f, 0x72,
- 0x73, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x55, 0x2e, 0x53, 0x2e, 0x72,
- 0x65, 0x70, 0x6c, 0x61, 0x63, 0x65, 0x20, 0x74, 0x68, 0x65, 0x62, 0x72, 0x6f,
- 0x75, 0x67, 0x68, 0x74, 0x20, 0x74, 0x68, 0x65, 0x63, 0x61, 0x6c, 0x63, 0x75,
- 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x66, 0x61, 0x6c, 0x6c, 0x20, 0x6f, 0x66,
- 0x20, 0x74, 0x68, 0x65, 0x74, 0x68, 0x65, 0x20, 0x67, 0x65, 0x6e, 0x65, 0x72,
- 0x61, 0x6c, 0x70, 0x72, 0x61, 0x63, 0x74, 0x69, 0x63, 0x61, 0x6c, 0x6c, 0x79,
- 0x69, 0x6e, 0x20, 0x68, 0x6f, 0x6e, 0x6f, 0x72, 0x20, 0x6f, 0x66, 0x72, 0x65,
- 0x6c, 0x65, 0x61, 0x73, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x72, 0x65, 0x73, 0x69,
- 0x64, 0x65, 0x6e, 0x74, 0x69, 0x61, 0x6c, 0x61, 0x6e, 0x64, 0x20, 0x73, 0x6f,
- 0x6d, 0x65, 0x20, 0x6f, 0x66, 0x6b, 0x69, 0x6e, 0x67, 0x20, 0x6f, 0x66, 0x20,
- 0x74, 0x68, 0x65, 0x72, 0x65, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x74,
- 0x6f, 0x31, 0x73, 0x74, 0x20, 0x45, 0x61, 0x72, 0x6c, 0x20, 0x6f, 0x66, 0x63,
- 0x75, 0x6c, 0x74, 0x75, 0x72, 0x65, 0x20, 0x61, 0x6e, 0x64, 0x70, 0x72, 0x69,
- 0x6e, 0x63, 0x69, 0x70, 0x61, 0x6c, 0x6c, 0x79, 0x3c, 0x2f, 0x74, 0x69, 0x74,
- 0x6c, 0x65, 0x3e, 0x0a, 0x20, 0x20, 0x74, 0x68, 0x65, 0x79, 0x20, 0x63, 0x61,
- 0x6e, 0x20, 0x62, 0x65, 0x62, 0x61, 0x63, 0x6b, 0x20, 0x74, 0x6f, 0x20, 0x74,
- 0x68, 0x65, 0x73, 0x6f, 0x6d, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x68, 0x69, 0x73,
- 0x65, 0x78, 0x70, 0x6f, 0x73, 0x75, 0x72, 0x65, 0x20, 0x74, 0x6f, 0x61, 0x72,
- 0x65, 0x20, 0x73, 0x69, 0x6d, 0x69, 0x6c, 0x61, 0x72, 0x66, 0x6f, 0x72, 0x6d,
- 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x61, 0x64, 0x64, 0x46, 0x61, 0x76,
- 0x6f, 0x72, 0x69, 0x74, 0x65, 0x63, 0x69, 0x74, 0x69, 0x7a, 0x65, 0x6e, 0x73,
- 0x68, 0x69, 0x70, 0x70, 0x61, 0x72, 0x74, 0x20, 0x69, 0x6e, 0x20, 0x74, 0x68,
- 0x65, 0x70, 0x65, 0x6f, 0x70, 0x6c, 0x65, 0x20, 0x77, 0x69, 0x74, 0x68, 0x69,
- 0x6e, 0x20, 0x70, 0x72, 0x61, 0x63, 0x74, 0x69, 0x63, 0x65, 0x74, 0x6f, 0x20,
- 0x63, 0x6f, 0x6e, 0x74, 0x69, 0x6e, 0x75, 0x65, 0x26, 0x61, 0x6d, 0x70, 0x3b,
- 0x6d, 0x69, 0x6e, 0x75, 0x73, 0x3b, 0x61, 0x70, 0x70, 0x72, 0x6f, 0x76, 0x65,
- 0x64, 0x20, 0x62, 0x79, 0x20, 0x74, 0x68, 0x65, 0x20, 0x66, 0x69, 0x72, 0x73,
- 0x74, 0x20, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x65, 0x64, 0x20, 0x74, 0x68, 0x65,
- 0x61, 0x6e, 0x64, 0x20, 0x66, 0x6f, 0x72, 0x20, 0x74, 0x68, 0x65, 0x66, 0x75,
- 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x69, 0x6e, 0x67, 0x70, 0x6c, 0x61, 0x79,
- 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65, 0x73, 0x6f, 0x6c, 0x75, 0x74, 0x69,
- 0x6f, 0x6e, 0x20, 0x74, 0x6f, 0x68, 0x65, 0x69, 0x67, 0x68, 0x74, 0x3d, 0x22,
- 0x30, 0x22, 0x20, 0x69, 0x6e, 0x20, 0x68, 0x69, 0x73, 0x20, 0x62, 0x6f, 0x6f,
- 0x6b, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x74, 0x68, 0x61, 0x6e, 0x20, 0x61, 0x66,
- 0x6f, 0x6c, 0x6c, 0x6f, 0x77, 0x73, 0x20, 0x74, 0x68, 0x65, 0x63, 0x72, 0x65,
- 0x61, 0x74, 0x65, 0x64, 0x20, 0x74, 0x68, 0x65, 0x70, 0x72, 0x65, 0x73, 0x65,
- 0x6e, 0x63, 0x65, 0x20, 0x69, 0x6e, 0x26, 0x6e, 0x62, 0x73, 0x70, 0x3b, 0x3c,
- 0x2f, 0x74, 0x64, 0x3e, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x69,
- 0x73, 0x74, 0x74, 0x68, 0x65, 0x20, 0x69, 0x64, 0x65, 0x61, 0x20, 0x6f, 0x66,
- 0x61, 0x20, 0x63, 0x68, 0x61, 0x72, 0x61, 0x63, 0x74, 0x65, 0x72, 0x77, 0x65,
- 0x72, 0x65, 0x20, 0x66, 0x6f, 0x72, 0x63, 0x65, 0x64, 0x20, 0x63, 0x6c, 0x61,
- 0x73, 0x73, 0x3d, 0x22, 0x62, 0x74, 0x6e, 0x64, 0x61, 0x79, 0x73, 0x20, 0x6f,
- 0x66, 0x20, 0x74, 0x68, 0x65, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x64,
- 0x20, 0x69, 0x6e, 0x73, 0x68, 0x6f, 0x77, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68,
- 0x65, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x65, 0x73, 0x74, 0x20, 0x69, 0x6e, 0x69,
- 0x6e, 0x20, 0x70, 0x6c, 0x61, 0x63, 0x65, 0x20, 0x6f, 0x66, 0x74, 0x75, 0x72,
- 0x6e, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x74, 0x68, 0x65, 0x20, 0x68,
- 0x65, 0x61, 0x64, 0x20, 0x6f, 0x66, 0x4c, 0x6f, 0x72, 0x64, 0x20, 0x6f, 0x66,
- 0x20, 0x74, 0x68, 0x65, 0x70, 0x6f, 0x6c, 0x69, 0x74, 0x69, 0x63, 0x61, 0x6c,
- 0x6c, 0x79, 0x68, 0x61, 0x73, 0x20, 0x69, 0x74, 0x73, 0x20, 0x6f, 0x77, 0x6e,
- 0x45, 0x64, 0x75, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x61, 0x70,
- 0x70, 0x72, 0x6f, 0x76, 0x61, 0x6c, 0x20, 0x6f, 0x66, 0x73, 0x6f, 0x6d, 0x65,
- 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x65, 0x61, 0x63, 0x68, 0x20, 0x6f,
- 0x74, 0x68, 0x65, 0x72, 0x2c, 0x62, 0x65, 0x68, 0x61, 0x76, 0x69, 0x6f, 0x72,
- 0x20, 0x6f, 0x66, 0x61, 0x6e, 0x64, 0x20, 0x62, 0x65, 0x63, 0x61, 0x75, 0x73,
- 0x65, 0x61, 0x6e, 0x64, 0x20, 0x61, 0x6e, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x61,
- 0x70, 0x70, 0x65, 0x61, 0x72, 0x65, 0x64, 0x20, 0x6f, 0x6e, 0x72, 0x65, 0x63,
- 0x6f, 0x72, 0x64, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x62, 0x6c, 0x61, 0x63, 0x6b,
- 0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b, 0x6d, 0x61, 0x79, 0x20, 0x69, 0x6e, 0x63,
- 0x6c, 0x75, 0x64, 0x65, 0x74, 0x68, 0x65, 0x20, 0x77, 0x6f, 0x72, 0x6c, 0x64,
- 0x27, 0x73, 0x63, 0x61, 0x6e, 0x20, 0x6c, 0x65, 0x61, 0x64, 0x20, 0x74, 0x6f,
- 0x72, 0x65, 0x66, 0x65, 0x72, 0x73, 0x20, 0x74, 0x6f, 0x20, 0x61, 0x62, 0x6f,
- 0x72, 0x64, 0x65, 0x72, 0x3d, 0x22, 0x30, 0x22, 0x20, 0x67, 0x6f, 0x76, 0x65,
- 0x72, 0x6e, 0x6d, 0x65, 0x6e, 0x74, 0x20, 0x77, 0x69, 0x6e, 0x6e, 0x69, 0x6e,
- 0x67, 0x20, 0x74, 0x68, 0x65, 0x72, 0x65, 0x73, 0x75, 0x6c, 0x74, 0x65, 0x64,
- 0x20, 0x69, 0x6e, 0x20, 0x77, 0x68, 0x69, 0x6c, 0x65, 0x20, 0x74, 0x68, 0x65,
- 0x20, 0x57, 0x61, 0x73, 0x68, 0x69, 0x6e, 0x67, 0x74, 0x6f, 0x6e, 0x2c, 0x74,
- 0x68, 0x65, 0x20, 0x73, 0x75, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x63, 0x69, 0x74,
- 0x79, 0x20, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x3e, 0x3c, 0x2f, 0x64, 0x69,
- 0x76, 0x3e, 0x0d, 0x0a, 0x09, 0x09, 0x72, 0x65, 0x66, 0x6c, 0x65, 0x63, 0x74,
- 0x20, 0x74, 0x68, 0x65, 0x74, 0x6f, 0x20, 0x63, 0x6f, 0x6d, 0x70, 0x6c, 0x65,
- 0x74, 0x65, 0x62, 0x65, 0x63, 0x61, 0x6d, 0x65, 0x20, 0x6d, 0x6f, 0x72, 0x65,
- 0x72, 0x61, 0x64, 0x69, 0x6f, 0x61, 0x63, 0x74, 0x69, 0x76, 0x65, 0x72, 0x65,
- 0x6a, 0x65, 0x63, 0x74, 0x65, 0x64, 0x20, 0x62, 0x79, 0x77, 0x69, 0x74, 0x68,
- 0x6f, 0x75, 0x74, 0x20, 0x61, 0x6e, 0x79, 0x68, 0x69, 0x73, 0x20, 0x66, 0x61,
- 0x74, 0x68, 0x65, 0x72, 0x2c, 0x77, 0x68, 0x69, 0x63, 0x68, 0x20, 0x63, 0x6f,
- 0x75, 0x6c, 0x64, 0x63, 0x6f, 0x70, 0x79, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68,
- 0x65, 0x74, 0x6f, 0x20, 0x69, 0x6e, 0x64, 0x69, 0x63, 0x61, 0x74, 0x65, 0x61,
- 0x20, 0x70, 0x6f, 0x6c, 0x69, 0x74, 0x69, 0x63, 0x61, 0x6c, 0x61, 0x63, 0x63,
- 0x6f, 0x75, 0x6e, 0x74, 0x73, 0x20, 0x6f, 0x66, 0x63, 0x6f, 0x6e, 0x73, 0x74,
- 0x69, 0x74, 0x75, 0x74, 0x65, 0x73, 0x77, 0x6f, 0x72, 0x6b, 0x65, 0x64, 0x20,
- 0x77, 0x69, 0x74, 0x68, 0x65, 0x72, 0x3c, 0x2f, 0x61, 0x3e, 0x3c, 0x2f, 0x6c,
- 0x69, 0x3e, 0x6f, 0x66, 0x20, 0x68, 0x69, 0x73, 0x20, 0x6c, 0x69, 0x66, 0x65,
- 0x61, 0x63, 0x63, 0x6f, 0x6d, 0x70, 0x61, 0x6e, 0x69, 0x65, 0x64, 0x63, 0x6c,
- 0x69, 0x65, 0x6e, 0x74, 0x57, 0x69, 0x64, 0x74, 0x68, 0x70, 0x72, 0x65, 0x76,
- 0x65, 0x6e, 0x74, 0x20, 0x74, 0x68, 0x65, 0x4c, 0x65, 0x67, 0x69, 0x73, 0x6c,
- 0x61, 0x74, 0x69, 0x76, 0x65, 0x64, 0x69, 0x66, 0x66, 0x65, 0x72, 0x65, 0x6e,
- 0x74, 0x6c, 0x79, 0x74, 0x6f, 0x67, 0x65, 0x74, 0x68, 0x65, 0x72, 0x20, 0x69,
- 0x6e, 0x68, 0x61, 0x73, 0x20, 0x73, 0x65, 0x76, 0x65, 0x72, 0x61, 0x6c, 0x66,
- 0x6f, 0x72, 0x20, 0x61, 0x6e, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x74, 0x65, 0x78,
- 0x74, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x66, 0x6f, 0x75, 0x6e, 0x64,
- 0x65, 0x64, 0x20, 0x74, 0x68, 0x65, 0x65, 0x20, 0x77, 0x69, 0x74, 0x68, 0x20,
- 0x74, 0x68, 0x65, 0x20, 0x69, 0x73, 0x20, 0x75, 0x73, 0x65, 0x64, 0x20, 0x66,
- 0x6f, 0x72, 0x63, 0x68, 0x61, 0x6e, 0x67, 0x65, 0x64, 0x20, 0x74, 0x68, 0x65,
- 0x75, 0x73, 0x75, 0x61, 0x6c, 0x6c, 0x79, 0x20, 0x74, 0x68, 0x65, 0x70, 0x6c,
- 0x61, 0x63, 0x65, 0x20, 0x77, 0x68, 0x65, 0x72, 0x65, 0x77, 0x68, 0x65, 0x72,
- 0x65, 0x61, 0x73, 0x20, 0x74, 0x68, 0x65, 0x3e, 0x20, 0x3c, 0x61, 0x20, 0x68,
- 0x72, 0x65, 0x66, 0x3d, 0x22, 0x22, 0x3e, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65,
- 0x66, 0x3d, 0x22, 0x74, 0x68, 0x65, 0x6d, 0x73, 0x65, 0x6c, 0x76, 0x65, 0x73,
- 0x2c, 0x61, 0x6c, 0x74, 0x68, 0x6f, 0x75, 0x67, 0x68, 0x20, 0x68, 0x65, 0x74,
- 0x68, 0x61, 0x74, 0x20, 0x63, 0x61, 0x6e, 0x20, 0x62, 0x65, 0x74, 0x72, 0x61,
- 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x72, 0x6f, 0x6c, 0x65, 0x20,
- 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x61, 0x73, 0x20, 0x61, 0x20, 0x72, 0x65,
- 0x73, 0x75, 0x6c, 0x74, 0x72, 0x65, 0x6d, 0x6f, 0x76, 0x65, 0x43, 0x68, 0x69,
- 0x6c, 0x64, 0x64, 0x65, 0x73, 0x69, 0x67, 0x6e, 0x65, 0x64, 0x20, 0x62, 0x79,
- 0x77, 0x65, 0x73, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x53, 0x6f,
- 0x6d, 0x65, 0x20, 0x70, 0x65, 0x6f, 0x70, 0x6c, 0x65, 0x70, 0x72, 0x6f, 0x64,
- 0x75, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x2c, 0x73, 0x69, 0x64, 0x65, 0x20, 0x6f,
- 0x66, 0x20, 0x74, 0x68, 0x65, 0x6e, 0x65, 0x77, 0x73, 0x6c, 0x65, 0x74, 0x74,
- 0x65, 0x72, 0x73, 0x75, 0x73, 0x65, 0x64, 0x20, 0x62, 0x79, 0x20, 0x74, 0x68,
- 0x65, 0x64, 0x6f, 0x77, 0x6e, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x61,
- 0x63, 0x63, 0x65, 0x70, 0x74, 0x65, 0x64, 0x20, 0x62, 0x79, 0x6c, 0x69, 0x76,
- 0x65, 0x20, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x61, 0x74, 0x74, 0x65, 0x6d,
- 0x70, 0x74, 0x73, 0x20, 0x74, 0x6f, 0x6f, 0x75, 0x74, 0x73, 0x69, 0x64, 0x65,
- 0x20, 0x74, 0x68, 0x65, 0x66, 0x72, 0x65, 0x71, 0x75, 0x65, 0x6e, 0x63, 0x69,
- 0x65, 0x73, 0x48, 0x6f, 0x77, 0x65, 0x76, 0x65, 0x72, 0x2c, 0x20, 0x69, 0x6e,
- 0x70, 0x72, 0x6f, 0x67, 0x72, 0x61, 0x6d, 0x6d, 0x65, 0x72, 0x73, 0x61, 0x74,
- 0x20, 0x6c, 0x65, 0x61, 0x73, 0x74, 0x20, 0x69, 0x6e, 0x61, 0x70, 0x70, 0x72,
- 0x6f, 0x78, 0x69, 0x6d, 0x61, 0x74, 0x65, 0x61, 0x6c, 0x74, 0x68, 0x6f, 0x75,
- 0x67, 0x68, 0x20, 0x69, 0x74, 0x77, 0x61, 0x73, 0x20, 0x70, 0x61, 0x72, 0x74,
- 0x20, 0x6f, 0x66, 0x61, 0x6e, 0x64, 0x20, 0x76, 0x61, 0x72, 0x69, 0x6f, 0x75,
- 0x73, 0x47, 0x6f, 0x76, 0x65, 0x72, 0x6e, 0x6f, 0x72, 0x20, 0x6f, 0x66, 0x74,
- 0x68, 0x65, 0x20, 0x61, 0x72, 0x74, 0x69, 0x63, 0x6c, 0x65, 0x74, 0x75, 0x72,
- 0x6e, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x74, 0x6f, 0x3e, 0x3c, 0x61, 0x20, 0x68,
- 0x72, 0x65, 0x66, 0x3d, 0x22, 0x2f, 0x74, 0x68, 0x65, 0x20, 0x65, 0x63, 0x6f,
- 0x6e, 0x6f, 0x6d, 0x79, 0x69, 0x73, 0x20, 0x74, 0x68, 0x65, 0x20, 0x6d, 0x6f,
- 0x73, 0x74, 0x6d, 0x6f, 0x73, 0x74, 0x20, 0x77, 0x69, 0x64, 0x65, 0x6c, 0x79,
- 0x77, 0x6f, 0x75, 0x6c, 0x64, 0x20, 0x6c, 0x61, 0x74, 0x65, 0x72, 0x61, 0x6e,
- 0x64, 0x20, 0x70, 0x65, 0x72, 0x68, 0x61, 0x70, 0x73, 0x72, 0x69, 0x73, 0x65,
- 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x6f, 0x63, 0x63, 0x75, 0x72, 0x73,
- 0x20, 0x77, 0x68, 0x65, 0x6e, 0x75, 0x6e, 0x64, 0x65, 0x72, 0x20, 0x77, 0x68,
- 0x69, 0x63, 0x68, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73,
- 0x2e, 0x74, 0x68, 0x65, 0x20, 0x77, 0x65, 0x73, 0x74, 0x65, 0x72, 0x6e, 0x74,
- 0x68, 0x65, 0x6f, 0x72, 0x79, 0x20, 0x74, 0x68, 0x61, 0x74, 0x69, 0x73, 0x20,
- 0x70, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x65, 0x64, 0x74, 0x68, 0x65, 0x20, 0x63,
- 0x69, 0x74, 0x79, 0x20, 0x6f, 0x66, 0x69, 0x6e, 0x20, 0x77, 0x68, 0x69, 0x63,
- 0x68, 0x20, 0x68, 0x65, 0x73, 0x65, 0x65, 0x6e, 0x20, 0x69, 0x6e, 0x20, 0x74,
- 0x68, 0x65, 0x74, 0x68, 0x65, 0x20, 0x63, 0x65, 0x6e, 0x74, 0x72, 0x61, 0x6c,
- 0x62, 0x75, 0x69, 0x6c, 0x64, 0x69, 0x6e, 0x67, 0x20, 0x6f, 0x66, 0x6d, 0x61,
- 0x6e, 0x79, 0x20, 0x6f, 0x66, 0x20, 0x68, 0x69, 0x73, 0x61, 0x72, 0x65, 0x61,
- 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x69, 0x73, 0x20, 0x74, 0x68, 0x65,
- 0x20, 0x6f, 0x6e, 0x6c, 0x79, 0x6d, 0x6f, 0x73, 0x74, 0x20, 0x6f, 0x66, 0x20,
- 0x74, 0x68, 0x65, 0x6d, 0x61, 0x6e, 0x79, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68,
- 0x65, 0x74, 0x68, 0x65, 0x20, 0x57, 0x65, 0x73, 0x74, 0x65, 0x72, 0x6e, 0x54,
- 0x68, 0x65, 0x72, 0x65, 0x20, 0x69, 0x73, 0x20, 0x6e, 0x6f, 0x65, 0x78, 0x74,
- 0x65, 0x6e, 0x64, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x53, 0x74, 0x61, 0x74, 0x69,
- 0x73, 0x74, 0x69, 0x63, 0x61, 0x6c, 0x63, 0x6f, 0x6c, 0x73, 0x70, 0x61, 0x6e,
- 0x3d, 0x32, 0x20, 0x7c, 0x73, 0x68, 0x6f, 0x72, 0x74, 0x20, 0x73, 0x74, 0x6f,
- 0x72, 0x79, 0x70, 0x6f, 0x73, 0x73, 0x69, 0x62, 0x6c, 0x65, 0x20, 0x74, 0x6f,
- 0x74, 0x6f, 0x70, 0x6f, 0x6c, 0x6f, 0x67, 0x69, 0x63, 0x61, 0x6c, 0x63, 0x72,
- 0x69, 0x74, 0x69, 0x63, 0x61, 0x6c, 0x20, 0x6f, 0x66, 0x72, 0x65, 0x70, 0x6f,
- 0x72, 0x74, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x61, 0x20, 0x43, 0x68, 0x72, 0x69,
- 0x73, 0x74, 0x69, 0x61, 0x6e, 0x64, 0x65, 0x63, 0x69, 0x73, 0x69, 0x6f, 0x6e,
- 0x20, 0x74, 0x6f, 0x69, 0x73, 0x20, 0x65, 0x71, 0x75, 0x61, 0x6c, 0x20, 0x74,
- 0x6f, 0x70, 0x72, 0x6f, 0x62, 0x6c, 0x65, 0x6d, 0x73, 0x20, 0x6f, 0x66, 0x54,
- 0x68, 0x69, 0x73, 0x20, 0x63, 0x61, 0x6e, 0x20, 0x62, 0x65, 0x6d, 0x65, 0x72,
- 0x63, 0x68, 0x61, 0x6e, 0x64, 0x69, 0x73, 0x65, 0x66, 0x6f, 0x72, 0x20, 0x6d,
- 0x6f, 0x73, 0x74, 0x20, 0x6f, 0x66, 0x6e, 0x6f, 0x20, 0x65, 0x76, 0x69, 0x64,
- 0x65, 0x6e, 0x63, 0x65, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x20,
- 0x6f, 0x66, 0x65, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x20, 0x69, 0x6e,
- 0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b, 0x2e, 0x20, 0x54, 0x68, 0x65, 0x63, 0x6f,
- 0x6d, 0x2f, 0x69, 0x6d, 0x61, 0x67, 0x65, 0x73, 0x2f, 0x77, 0x68, 0x69, 0x63,
- 0x68, 0x20, 0x6d, 0x61, 0x6b, 0x65, 0x73, 0x74, 0x68, 0x65, 0x20, 0x70, 0x72,
- 0x6f, 0x63, 0x65, 0x73, 0x73, 0x72, 0x65, 0x6d, 0x61, 0x69, 0x6e, 0x73, 0x20,
- 0x74, 0x68, 0x65, 0x6c, 0x69, 0x74, 0x65, 0x72, 0x61, 0x74, 0x75, 0x72, 0x65,
- 0x2c, 0x69, 0x73, 0x20, 0x61, 0x20, 0x6d, 0x65, 0x6d, 0x62, 0x65, 0x72, 0x74,
- 0x68, 0x65, 0x20, 0x70, 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x72, 0x74, 0x68, 0x65,
- 0x20, 0x61, 0x6e, 0x63, 0x69, 0x65, 0x6e, 0x74, 0x70, 0x72, 0x6f, 0x62, 0x6c,
- 0x65, 0x6d, 0x73, 0x20, 0x69, 0x6e, 0x74, 0x69, 0x6d, 0x65, 0x20, 0x6f, 0x66,
- 0x20, 0x74, 0x68, 0x65, 0x64, 0x65, 0x66, 0x65, 0x61, 0x74, 0x65, 0x64, 0x20,
- 0x62, 0x79, 0x62, 0x6f, 0x64, 0x79, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65,
- 0x61, 0x20, 0x66, 0x65, 0x77, 0x20, 0x79, 0x65, 0x61, 0x72, 0x73, 0x6d, 0x75,
- 0x63, 0x68, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x74, 0x68, 0x65, 0x20,
- 0x77, 0x6f, 0x72, 0x6b, 0x20, 0x6f, 0x66, 0x43, 0x61, 0x6c, 0x69, 0x66, 0x6f,
- 0x72, 0x6e, 0x69, 0x61, 0x2c, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x20, 0x61,
- 0x73, 0x20, 0x61, 0x67, 0x6f, 0x76, 0x65, 0x72, 0x6e, 0x6d, 0x65, 0x6e, 0x74,
- 0x2e, 0x63, 0x6f, 0x6e, 0x63, 0x65, 0x70, 0x74, 0x73, 0x20, 0x6f, 0x66, 0x6d,
- 0x6f, 0x76, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x20, 0x69, 0x6e, 0x09, 0x09, 0x3c,
- 0x64, 0x69, 0x76, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x69, 0x74, 0x22, 0x20, 0x76,
- 0x61, 0x6c, 0x75, 0x65, 0x3d, 0x22, 0x6c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67,
- 0x65, 0x20, 0x6f, 0x66, 0x61, 0x73, 0x20, 0x74, 0x68, 0x65, 0x79, 0x20, 0x61,
- 0x72, 0x65, 0x70, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x65, 0x64, 0x20, 0x69, 0x6e,
- 0x69, 0x73, 0x20, 0x74, 0x68, 0x61, 0x74, 0x20, 0x74, 0x68, 0x65, 0x65, 0x78,
- 0x70, 0x6c, 0x61, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x64, 0x69, 0x76, 0x3e,
- 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0a, 0x48, 0x6f, 0x77, 0x65, 0x76, 0x65,
- 0x72, 0x20, 0x74, 0x68, 0x65, 0x6c, 0x65, 0x61, 0x64, 0x20, 0x74, 0x6f, 0x20,
- 0x74, 0x68, 0x65, 0x09, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22,
- 0x2f, 0x77, 0x61, 0x73, 0x20, 0x67, 0x72, 0x61, 0x6e, 0x74, 0x65, 0x64, 0x70,
- 0x65, 0x6f, 0x70, 0x6c, 0x65, 0x20, 0x68, 0x61, 0x76, 0x65, 0x63, 0x6f, 0x6e,
- 0x74, 0x69, 0x6e, 0x75, 0x61, 0x6c, 0x6c, 0x79, 0x77, 0x61, 0x73, 0x20, 0x73,
- 0x65, 0x65, 0x6e, 0x20, 0x61, 0x73, 0x61, 0x6e, 0x64, 0x20, 0x72, 0x65, 0x6c,
- 0x61, 0x74, 0x65, 0x64, 0x74, 0x68, 0x65, 0x20, 0x72, 0x6f, 0x6c, 0x65, 0x20,
- 0x6f, 0x66, 0x70, 0x72, 0x6f, 0x70, 0x6f, 0x73, 0x65, 0x64, 0x20, 0x62, 0x79,
- 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x62, 0x65, 0x73, 0x74, 0x65, 0x61,
- 0x63, 0x68, 0x20, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x2e, 0x43, 0x6f, 0x6e, 0x73,
- 0x74, 0x61, 0x6e, 0x74, 0x69, 0x6e, 0x65, 0x70, 0x65, 0x6f, 0x70, 0x6c, 0x65,
- 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x64, 0x69, 0x61, 0x6c, 0x65, 0x63, 0x74, 0x73,
- 0x20, 0x6f, 0x66, 0x74, 0x6f, 0x20, 0x72, 0x65, 0x76, 0x69, 0x73, 0x69, 0x6f,
- 0x6e, 0x77, 0x61, 0x73, 0x20, 0x72, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x61,
- 0x20, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x20, 0x6f, 0x66, 0x74, 0x68, 0x65,
- 0x20, 0x69, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x6c, 0x61, 0x75, 0x6e, 0x63,
- 0x68, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x70, 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65,
- 0x20, 0x74, 0x68, 0x65, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x20, 0x77, 0x65,
- 0x73, 0x74, 0x77, 0x68, 0x65, 0x72, 0x65, 0x20, 0x74, 0x68, 0x65, 0x72, 0x65,
- 0x61, 0x6e, 0x64, 0x20, 0x73, 0x69, 0x6d, 0x69, 0x6c, 0x61, 0x72, 0x62, 0x65,
- 0x74, 0x77, 0x65, 0x65, 0x6e, 0x20, 0x74, 0x77, 0x6f, 0x69, 0x73, 0x20, 0x61,
- 0x6c, 0x73, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x45, 0x6e, 0x67, 0x6c, 0x69, 0x73,
- 0x68, 0x20, 0x61, 0x6e, 0x64, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f,
- 0x6e, 0x73, 0x2c, 0x74, 0x68, 0x61, 0x74, 0x20, 0x69, 0x74, 0x20, 0x77, 0x61,
- 0x73, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x6c, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x74,
- 0x68, 0x65, 0x6d, 0x73, 0x65, 0x6c, 0x76, 0x65, 0x73, 0x2e, 0x71, 0x75, 0x61,
- 0x6e, 0x74, 0x69, 0x74, 0x79, 0x20, 0x6f, 0x66, 0x72, 0x61, 0x6e, 0x73, 0x70,
- 0x61, 0x72, 0x65, 0x6e, 0x63, 0x79, 0x74, 0x68, 0x65, 0x20, 0x73, 0x61, 0x6d,
- 0x65, 0x20, 0x61, 0x73, 0x74, 0x6f, 0x20, 0x6a, 0x6f, 0x69, 0x6e, 0x20, 0x74,
- 0x68, 0x65, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x72, 0x79, 0x20, 0x61, 0x6e, 0x64,
- 0x74, 0x68, 0x69, 0x73, 0x20, 0x69, 0x73, 0x20, 0x74, 0x68, 0x65, 0x54, 0x68,
- 0x69, 0x73, 0x20, 0x6c, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x61, 0x20, 0x73, 0x74,
- 0x61, 0x74, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x61,
- 0x73, 0x74, 0x20, 0x74, 0x6f, 0x6c, 0x61, 0x73, 0x74, 0x49, 0x6e, 0x64, 0x65,
- 0x78, 0x4f, 0x66, 0x74, 0x68, 0x72, 0x6f, 0x75, 0x67, 0x68, 0x20, 0x68, 0x69,
- 0x73, 0x69, 0x73, 0x20, 0x64, 0x65, 0x73, 0x69, 0x67, 0x6e, 0x65, 0x64, 0x74,
- 0x68, 0x65, 0x20, 0x74, 0x65, 0x72, 0x6d, 0x20, 0x69, 0x73, 0x69, 0x73, 0x20,
- 0x70, 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65, 0x64, 0x70, 0x72, 0x6f, 0x74, 0x65,
- 0x63, 0x74, 0x20, 0x74, 0x68, 0x65, 0x6e, 0x67, 0x3c, 0x2f, 0x61, 0x3e, 0x3c,
- 0x2f, 0x6c, 0x69, 0x3e, 0x54, 0x68, 0x65, 0x20, 0x63, 0x75, 0x72, 0x72, 0x65,
- 0x6e, 0x74, 0x74, 0x68, 0x65, 0x20, 0x73, 0x69, 0x74, 0x65, 0x20, 0x6f, 0x66,
- 0x73, 0x75, 0x62, 0x73, 0x74, 0x61, 0x6e, 0x74, 0x69, 0x61, 0x6c, 0x65, 0x78,
- 0x70, 0x65, 0x72, 0x69, 0x65, 0x6e, 0x63, 0x65, 0x2c, 0x69, 0x6e, 0x20, 0x74,
- 0x68, 0x65, 0x20, 0x57, 0x65, 0x73, 0x74, 0x74, 0x68, 0x65, 0x79, 0x20, 0x73,
- 0x68, 0x6f, 0x75, 0x6c, 0x64, 0x73, 0x6c, 0x6f, 0x76, 0x65, 0x6e, 0xc4, 0x8d,
- 0x69, 0x6e, 0x61, 0x63, 0x6f, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x72, 0x69, 0x6f,
- 0x73, 0x75, 0x6e, 0x69, 0x76, 0x65, 0x72, 0x73, 0x69, 0x64, 0x61, 0x64, 0x63,
- 0x6f, 0x6e, 0x64, 0x69, 0x63, 0x69, 0x6f, 0x6e, 0x65, 0x73, 0x61, 0x63, 0x74,
- 0x69, 0x76, 0x69, 0x64, 0x61, 0x64, 0x65, 0x73, 0x65, 0x78, 0x70, 0x65, 0x72,
- 0x69, 0x65, 0x6e, 0x63, 0x69, 0x61, 0x74, 0x65, 0x63, 0x6e, 0x6f, 0x6c, 0x6f,
- 0x67, 0xc3, 0xad, 0x61, 0x70, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x63, 0x69, 0xc3,
- 0xb3, 0x6e, 0x70, 0x75, 0x6e, 0x74, 0x75, 0x61, 0x63, 0x69, 0xc3, 0xb3, 0x6e,
- 0x61, 0x70, 0x6c, 0x69, 0x63, 0x61, 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x63, 0x6f,
- 0x6e, 0x74, 0x72, 0x61, 0x73, 0x65, 0xc3, 0xb1, 0x61, 0x63, 0x61, 0x74, 0x65,
- 0x67, 0x6f, 0x72, 0xc3, 0xad, 0x61, 0x73, 0x72, 0x65, 0x67, 0x69, 0x73, 0x74,
- 0x72, 0x61, 0x72, 0x73, 0x65, 0x70, 0x72, 0x6f, 0x66, 0x65, 0x73, 0x69, 0x6f,
- 0x6e, 0x61, 0x6c, 0x74, 0x72, 0x61, 0x74, 0x61, 0x6d, 0x69, 0x65, 0x6e, 0x74,
- 0x6f, 0x72, 0x65, 0x67, 0xc3, 0xad, 0x73, 0x74, 0x72, 0x61, 0x74, 0x65, 0x73,
- 0x65, 0x63, 0x72, 0x65, 0x74, 0x61, 0x72, 0xc3, 0xad, 0x61, 0x70, 0x72, 0x69,
- 0x6e, 0x63, 0x69, 0x70, 0x61, 0x6c, 0x65, 0x73, 0x70, 0x72, 0x6f, 0x74, 0x65,
- 0x63, 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x69, 0x6d, 0x70, 0x6f, 0x72, 0x74, 0x61,
- 0x6e, 0x74, 0x65, 0x73, 0x69, 0x6d, 0x70, 0x6f, 0x72, 0x74, 0x61, 0x6e, 0x63,
- 0x69, 0x61, 0x70, 0x6f, 0x73, 0x69, 0x62, 0x69, 0x6c, 0x69, 0x64, 0x61, 0x64,
- 0x69, 0x6e, 0x74, 0x65, 0x72, 0x65, 0x73, 0x61, 0x6e, 0x74, 0x65, 0x63, 0x72,
- 0x65, 0x63, 0x69, 0x6d, 0x69, 0x65, 0x6e, 0x74, 0x6f, 0x6e, 0x65, 0x63, 0x65,
- 0x73, 0x69, 0x64, 0x61, 0x64, 0x65, 0x73, 0x73, 0x75, 0x73, 0x63, 0x72, 0x69,
- 0x62, 0x69, 0x72, 0x73, 0x65, 0x61, 0x73, 0x6f, 0x63, 0x69, 0x61, 0x63, 0x69,
- 0xc3, 0xb3, 0x6e, 0x64, 0x69, 0x73, 0x70, 0x6f, 0x6e, 0x69, 0x62, 0x6c, 0x65,
- 0x73, 0x65, 0x76, 0x61, 0x6c, 0x75, 0x61, 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x65,
- 0x73, 0x74, 0x75, 0x64, 0x69, 0x61, 0x6e, 0x74, 0x65, 0x73, 0x72, 0x65, 0x73,
- 0x70, 0x6f, 0x6e, 0x73, 0x61, 0x62, 0x6c, 0x65, 0x72, 0x65, 0x73, 0x6f, 0x6c,
- 0x75, 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x67, 0x75, 0x61, 0x64, 0x61, 0x6c, 0x61,
- 0x6a, 0x61, 0x72, 0x61, 0x72, 0x65, 0x67, 0x69, 0x73, 0x74, 0x72, 0x61, 0x64,
- 0x6f, 0x73, 0x6f, 0x70, 0x6f, 0x72, 0x74, 0x75, 0x6e, 0x69, 0x64, 0x61, 0x64,
- 0x63, 0x6f, 0x6d, 0x65, 0x72, 0x63, 0x69, 0x61, 0x6c, 0x65, 0x73, 0x66, 0x6f,
- 0x74, 0x6f, 0x67, 0x72, 0x61, 0x66, 0xc3, 0xad, 0x61, 0x61, 0x75, 0x74, 0x6f,
- 0x72, 0x69, 0x64, 0x61, 0x64, 0x65, 0x73, 0x69, 0x6e, 0x67, 0x65, 0x6e, 0x69,
- 0x65, 0x72, 0xc3, 0xad, 0x61, 0x74, 0x65, 0x6c, 0x65, 0x76, 0x69, 0x73, 0x69,
- 0xc3, 0xb3, 0x6e, 0x63, 0x6f, 0x6d, 0x70, 0x65, 0x74, 0x65, 0x6e, 0x63, 0x69,
- 0x61, 0x6f, 0x70, 0x65, 0x72, 0x61, 0x63, 0x69, 0x6f, 0x6e, 0x65, 0x73, 0x65,
- 0x73, 0x74, 0x61, 0x62, 0x6c, 0x65, 0x63, 0x69, 0x64, 0x6f, 0x73, 0x69, 0x6d,
- 0x70, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x65, 0x61, 0x63, 0x74, 0x75, 0x61,
- 0x6c, 0x6d, 0x65, 0x6e, 0x74, 0x65, 0x6e, 0x61, 0x76, 0x65, 0x67, 0x61, 0x63,
- 0x69, 0xc3, 0xb3, 0x6e, 0x63, 0x6f, 0x6e, 0x66, 0x6f, 0x72, 0x6d, 0x69, 0x64,
- 0x61, 0x64, 0x6c, 0x69, 0x6e, 0x65, 0x2d, 0x68, 0x65, 0x69, 0x67, 0x68, 0x74,
- 0x3a, 0x66, 0x6f, 0x6e, 0x74, 0x2d, 0x66, 0x61, 0x6d, 0x69, 0x6c, 0x79, 0x3a,
- 0x22, 0x20, 0x3a, 0x20, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x61,
- 0x70, 0x70, 0x6c, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x6c, 0x69,
- 0x6e, 0x6b, 0x22, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x73, 0x70, 0x65,
- 0x63, 0x69, 0x66, 0x69, 0x63, 0x61, 0x6c, 0x6c, 0x79, 0x2f, 0x2f, 0x3c, 0x21,
- 0x5b, 0x43, 0x44, 0x41, 0x54, 0x41, 0x5b, 0x0a, 0x4f, 0x72, 0x67, 0x61, 0x6e,
- 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x64, 0x69, 0x73, 0x74, 0x72, 0x69,
- 0x62, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x30, 0x70, 0x78, 0x3b, 0x20, 0x68, 0x65,
- 0x69, 0x67, 0x68, 0x74, 0x3a, 0x72, 0x65, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e,
- 0x73, 0x68, 0x69, 0x70, 0x64, 0x65, 0x76, 0x69, 0x63, 0x65, 0x2d, 0x77, 0x69,
- 0x64, 0x74, 0x68, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73,
- 0x3d, 0x22, 0x3c, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x20, 0x66, 0x6f, 0x72, 0x3d,
- 0x22, 0x72, 0x65, 0x67, 0x69, 0x73, 0x74, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e,
- 0x3c, 0x2f, 0x6e, 0x6f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x0a, 0x2f,
- 0x69, 0x6e, 0x64, 0x65, 0x78, 0x2e, 0x68, 0x74, 0x6d, 0x6c, 0x22, 0x77, 0x69,
- 0x6e, 0x64, 0x6f, 0x77, 0x2e, 0x6f, 0x70, 0x65, 0x6e, 0x28, 0x20, 0x21, 0x69,
- 0x6d, 0x70, 0x6f, 0x72, 0x74, 0x61, 0x6e, 0x74, 0x3b, 0x61, 0x70, 0x70, 0x6c,
- 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2f, 0x69, 0x6e, 0x64, 0x65, 0x70,
- 0x65, 0x6e, 0x64, 0x65, 0x6e, 0x63, 0x65, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e,
- 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x75, 0x74, 0x6f, 0x63, 0x6f, 0x6d, 0x70,
- 0x6c, 0x65, 0x74, 0x65, 0x72, 0x65, 0x71, 0x75, 0x69, 0x72, 0x65, 0x6d, 0x65,
- 0x6e, 0x74, 0x73, 0x63, 0x6f, 0x6e, 0x73, 0x65, 0x72, 0x76, 0x61, 0x74, 0x69,
- 0x76, 0x65, 0x3c, 0x66, 0x6f, 0x72, 0x6d, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x3d,
- 0x22, 0x69, 0x6e, 0x74, 0x65, 0x6c, 0x6c, 0x65, 0x63, 0x74, 0x75, 0x61, 0x6c,
- 0x6d, 0x61, 0x72, 0x67, 0x69, 0x6e, 0x2d, 0x6c, 0x65, 0x66, 0x74, 0x3a, 0x31,
- 0x38, 0x74, 0x68, 0x20, 0x63, 0x65, 0x6e, 0x74, 0x75, 0x72, 0x79, 0x61, 0x6e,
- 0x20, 0x69, 0x6d, 0x70, 0x6f, 0x72, 0x74, 0x61, 0x6e, 0x74, 0x69, 0x6e, 0x73,
- 0x74, 0x69, 0x74, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x61, 0x62, 0x62, 0x72,
- 0x65, 0x76, 0x69, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x3c, 0x69, 0x6d, 0x67, 0x20,
- 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69,
- 0x73, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x63, 0x69, 0x76, 0x69, 0x6c, 0x69, 0x7a,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x31, 0x39, 0x74, 0x68, 0x20, 0x63, 0x65, 0x6e,
- 0x74, 0x75, 0x72, 0x79, 0x61, 0x72, 0x63, 0x68, 0x69, 0x74, 0x65, 0x63, 0x74,
- 0x75, 0x72, 0x65, 0x69, 0x6e, 0x63, 0x6f, 0x72, 0x70, 0x6f, 0x72, 0x61, 0x74,
- 0x65, 0x64, 0x32, 0x30, 0x74, 0x68, 0x20, 0x63, 0x65, 0x6e, 0x74, 0x75, 0x72,
- 0x79, 0x2d, 0x63, 0x6f, 0x6e, 0x74, 0x61, 0x69, 0x6e, 0x65, 0x72, 0x22, 0x3e,
- 0x6d, 0x6f, 0x73, 0x74, 0x20, 0x6e, 0x6f, 0x74, 0x61, 0x62, 0x6c, 0x79, 0x2f,
- 0x3e, 0x3c, 0x2f, 0x61, 0x3e, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x6e, 0x6f,
- 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x27, 0x75, 0x6e,
- 0x64, 0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, 0x27, 0x29, 0x46, 0x75, 0x72, 0x74,
- 0x68, 0x65, 0x72, 0x6d, 0x6f, 0x72, 0x65, 0x2c, 0x62, 0x65, 0x6c, 0x69, 0x65,
- 0x76, 0x65, 0x20, 0x74, 0x68, 0x61, 0x74, 0x69, 0x6e, 0x6e, 0x65, 0x72, 0x48,
- 0x54, 0x4d, 0x4c, 0x20, 0x3d, 0x20, 0x70, 0x72, 0x69, 0x6f, 0x72, 0x20, 0x74,
- 0x6f, 0x20, 0x74, 0x68, 0x65, 0x64, 0x72, 0x61, 0x6d, 0x61, 0x74, 0x69, 0x63,
- 0x61, 0x6c, 0x6c, 0x79, 0x72, 0x65, 0x66, 0x65, 0x72, 0x72, 0x69, 0x6e, 0x67,
- 0x20, 0x74, 0x6f, 0x6e, 0x65, 0x67, 0x6f, 0x74, 0x69, 0x61, 0x74, 0x69, 0x6f,
- 0x6e, 0x73, 0x68, 0x65, 0x61, 0x64, 0x71, 0x75, 0x61, 0x72, 0x74, 0x65, 0x72,
- 0x73, 0x53, 0x6f, 0x75, 0x74, 0x68, 0x20, 0x41, 0x66, 0x72, 0x69, 0x63, 0x61,
- 0x75, 0x6e, 0x73, 0x75, 0x63, 0x63, 0x65, 0x73, 0x73, 0x66, 0x75, 0x6c, 0x50,
- 0x65, 0x6e, 0x6e, 0x73, 0x79, 0x6c, 0x76, 0x61, 0x6e, 0x69, 0x61, 0x41, 0x73,
- 0x20, 0x61, 0x20, 0x72, 0x65, 0x73, 0x75, 0x6c, 0x74, 0x2c, 0x3c, 0x68, 0x74,
- 0x6d, 0x6c, 0x20, 0x6c, 0x61, 0x6e, 0x67, 0x3d, 0x22, 0x26, 0x6c, 0x74, 0x3b,
- 0x2f, 0x73, 0x75, 0x70, 0x26, 0x67, 0x74, 0x3b, 0x64, 0x65, 0x61, 0x6c, 0x69,
- 0x6e, 0x67, 0x20, 0x77, 0x69, 0x74, 0x68, 0x70, 0x68, 0x69, 0x6c, 0x61, 0x64,
- 0x65, 0x6c, 0x70, 0x68, 0x69, 0x61, 0x68, 0x69, 0x73, 0x74, 0x6f, 0x72, 0x69,
- 0x63, 0x61, 0x6c, 0x6c, 0x79, 0x29, 0x3b, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69,
- 0x70, 0x74, 0x3e, 0x0a, 0x70, 0x61, 0x64, 0x64, 0x69, 0x6e, 0x67, 0x2d, 0x74,
- 0x6f, 0x70, 0x3a, 0x65, 0x78, 0x70, 0x65, 0x72, 0x69, 0x6d, 0x65, 0x6e, 0x74,
- 0x61, 0x6c, 0x67, 0x65, 0x74, 0x41, 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74,
- 0x65, 0x69, 0x6e, 0x73, 0x74, 0x72, 0x75, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73,
- 0x74, 0x65, 0x63, 0x68, 0x6e, 0x6f, 0x6c, 0x6f, 0x67, 0x69, 0x65, 0x73, 0x70,
- 0x61, 0x72, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x3d, 0x66,
- 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x28, 0x29, 0x7b, 0x73, 0x75, 0x62,
- 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x6c, 0x2e, 0x64, 0x74,
- 0x64, 0x22, 0x3e, 0x0d, 0x0a, 0x3c, 0x68, 0x74, 0x67, 0x65, 0x6f, 0x67, 0x72,
- 0x61, 0x70, 0x68, 0x69, 0x63, 0x61, 0x6c, 0x43, 0x6f, 0x6e, 0x73, 0x74, 0x69,
- 0x74, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x27, 0x2c, 0x20, 0x66, 0x75, 0x6e, 0x63,
- 0x74, 0x69, 0x6f, 0x6e, 0x28, 0x73, 0x75, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x65,
- 0x64, 0x20, 0x62, 0x79, 0x61, 0x67, 0x72, 0x69, 0x63, 0x75, 0x6c, 0x74, 0x75,
- 0x72, 0x61, 0x6c, 0x63, 0x6f, 0x6e, 0x73, 0x74, 0x72, 0x75, 0x63, 0x74, 0x69,
- 0x6f, 0x6e, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e,
- 0x73, 0x66, 0x6f, 0x6e, 0x74, 0x2d, 0x73, 0x69, 0x7a, 0x65, 0x3a, 0x20, 0x31,
- 0x61, 0x20, 0x76, 0x61, 0x72, 0x69, 0x65, 0x74, 0x79, 0x20, 0x6f, 0x66, 0x3c,
- 0x64, 0x69, 0x76, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x45, 0x6e,
- 0x63, 0x79, 0x63, 0x6c, 0x6f, 0x70, 0x65, 0x64, 0x69, 0x61, 0x69, 0x66, 0x72,
- 0x61, 0x6d, 0x65, 0x20, 0x73, 0x72, 0x63, 0x3d, 0x22, 0x64, 0x65, 0x6d, 0x6f,
- 0x6e, 0x73, 0x74, 0x72, 0x61, 0x74, 0x65, 0x64, 0x61, 0x63, 0x63, 0x6f, 0x6d,
- 0x70, 0x6c, 0x69, 0x73, 0x68, 0x65, 0x64, 0x75, 0x6e, 0x69, 0x76, 0x65, 0x72,
- 0x73, 0x69, 0x74, 0x69, 0x65, 0x73, 0x44, 0x65, 0x6d, 0x6f, 0x67, 0x72, 0x61,
- 0x70, 0x68, 0x69, 0x63, 0x73, 0x29, 0x3b, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69,
- 0x70, 0x74, 0x3e, 0x3c, 0x64, 0x65, 0x64, 0x69, 0x63, 0x61, 0x74, 0x65, 0x64,
- 0x20, 0x74, 0x6f, 0x6b, 0x6e, 0x6f, 0x77, 0x6c, 0x65, 0x64, 0x67, 0x65, 0x20,
- 0x6f, 0x66, 0x73, 0x61, 0x74, 0x69, 0x73, 0x66, 0x61, 0x63, 0x74, 0x69, 0x6f,
- 0x6e, 0x70, 0x61, 0x72, 0x74, 0x69, 0x63, 0x75, 0x6c, 0x61, 0x72, 0x6c, 0x79,
- 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x45,
- 0x6e, 0x67, 0x6c, 0x69, 0x73, 0x68, 0x20, 0x28, 0x55, 0x53, 0x29, 0x61, 0x70,
- 0x70, 0x65, 0x6e, 0x64, 0x43, 0x68, 0x69, 0x6c, 0x64, 0x28, 0x74, 0x72, 0x61,
- 0x6e, 0x73, 0x6d, 0x69, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x20, 0x48,
- 0x6f, 0x77, 0x65, 0x76, 0x65, 0x72, 0x2c, 0x20, 0x69, 0x6e, 0x74, 0x65, 0x6c,
- 0x6c, 0x69, 0x67, 0x65, 0x6e, 0x63, 0x65, 0x22, 0x20, 0x74, 0x61, 0x62, 0x69,
- 0x6e, 0x64, 0x65, 0x78, 0x3d, 0x22, 0x66, 0x6c, 0x6f, 0x61, 0x74, 0x3a, 0x72,
- 0x69, 0x67, 0x68, 0x74, 0x3b, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x77, 0x65,
- 0x61, 0x6c, 0x74, 0x68, 0x72, 0x61, 0x6e, 0x67, 0x69, 0x6e, 0x67, 0x20, 0x66,
- 0x72, 0x6f, 0x6d, 0x69, 0x6e, 0x20, 0x77, 0x68, 0x69, 0x63, 0x68, 0x20, 0x74,
- 0x68, 0x65, 0x61, 0x74, 0x20, 0x6c, 0x65, 0x61, 0x73, 0x74, 0x20, 0x6f, 0x6e,
- 0x65, 0x72, 0x65, 0x70, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x74, 0x69, 0x6f, 0x6e,
- 0x65, 0x6e, 0x63, 0x79, 0x63, 0x6c, 0x6f, 0x70, 0x65, 0x64, 0x69, 0x61, 0x3b,
- 0x66, 0x6f, 0x6e, 0x74, 0x2d, 0x73, 0x69, 0x7a, 0x65, 0x3a, 0x31, 0x6a, 0x75,
- 0x72, 0x69, 0x73, 0x64, 0x69, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x74, 0x20,
- 0x74, 0x68, 0x61, 0x74, 0x20, 0x74, 0x69, 0x6d, 0x65, 0x22, 0x3e, 0x3c, 0x61,
- 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x49, 0x6e, 0x20, 0x61, 0x64,
- 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2c, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69,
- 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x2b, 0x63, 0x6f, 0x6e, 0x76, 0x65, 0x72, 0x73,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x63, 0x6f, 0x6e, 0x74, 0x61, 0x63, 0x74, 0x20,
- 0x77, 0x69, 0x74, 0x68, 0x69, 0x73, 0x20, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61,
- 0x6c, 0x6c, 0x79, 0x72, 0x22, 0x20, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74,
- 0x3d, 0x22, 0x72, 0x65, 0x70, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x74, 0x69, 0x6e,
- 0x67, 0x26, 0x6c, 0x74, 0x3b, 0x6d, 0x61, 0x74, 0x68, 0x26, 0x67, 0x74, 0x3b,
- 0x70, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x6f,
- 0x63, 0x63, 0x61, 0x73, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x6c, 0x79, 0x3c, 0x69,
- 0x6d, 0x67, 0x20, 0x77, 0x69, 0x64, 0x74, 0x68, 0x3d, 0x22, 0x6e, 0x61, 0x76,
- 0x69, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x3e, 0x63, 0x6f, 0x6d, 0x70,
- 0x65, 0x6e, 0x73, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x63, 0x68, 0x61, 0x6d, 0x70,
- 0x69, 0x6f, 0x6e, 0x73, 0x68, 0x69, 0x70, 0x6d, 0x65, 0x64, 0x69, 0x61, 0x3d,
- 0x22, 0x61, 0x6c, 0x6c, 0x22, 0x20, 0x76, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69,
- 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x72, 0x65, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63,
- 0x65, 0x20, 0x74, 0x6f, 0x72, 0x65, 0x74, 0x75, 0x72, 0x6e, 0x20, 0x74, 0x72,
- 0x75, 0x65, 0x3b, 0x53, 0x74, 0x72, 0x69, 0x63, 0x74, 0x2f, 0x2f, 0x45, 0x4e,
- 0x22, 0x20, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e,
- 0x73, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e,
- 0x76, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x49,
- 0x6e, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x64, 0x69,
- 0x66, 0x66, 0x69, 0x63, 0x75, 0x6c, 0x74, 0x69, 0x65, 0x73, 0x43, 0x68, 0x61,
- 0x6d, 0x70, 0x69, 0x6f, 0x6e, 0x73, 0x68, 0x69, 0x70, 0x63, 0x61, 0x70, 0x61,
- 0x62, 0x69, 0x6c, 0x69, 0x74, 0x69, 0x65, 0x73, 0x3c, 0x21, 0x5b, 0x65, 0x6e,
- 0x64, 0x69, 0x66, 0x5d, 0x2d, 0x2d, 0x3e, 0x7d, 0x0a, 0x3c, 0x2f, 0x73, 0x63,
- 0x72, 0x69, 0x70, 0x74, 0x3e, 0x0a, 0x43, 0x68, 0x72, 0x69, 0x73, 0x74, 0x69,
- 0x61, 0x6e, 0x69, 0x74, 0x79, 0x66, 0x6f, 0x72, 0x20, 0x65, 0x78, 0x61, 0x6d,
- 0x70, 0x6c, 0x65, 0x2c, 0x50, 0x72, 0x6f, 0x66, 0x65, 0x73, 0x73, 0x69, 0x6f,
- 0x6e, 0x61, 0x6c, 0x72, 0x65, 0x73, 0x74, 0x72, 0x69, 0x63, 0x74, 0x69, 0x6f,
- 0x6e, 0x73, 0x73, 0x75, 0x67, 0x67, 0x65, 0x73, 0x74, 0x20, 0x74, 0x68, 0x61,
- 0x74, 0x77, 0x61, 0x73, 0x20, 0x72, 0x65, 0x6c, 0x65, 0x61, 0x73, 0x65, 0x64,
- 0x28, 0x73, 0x75, 0x63, 0x68, 0x20, 0x61, 0x73, 0x20, 0x74, 0x68, 0x65, 0x72,
- 0x65, 0x6d, 0x6f, 0x76, 0x65, 0x43, 0x6c, 0x61, 0x73, 0x73, 0x28, 0x75, 0x6e,
- 0x65, 0x6d, 0x70, 0x6c, 0x6f, 0x79, 0x6d, 0x65, 0x6e, 0x74, 0x74, 0x68, 0x65,
- 0x20, 0x41, 0x6d, 0x65, 0x72, 0x69, 0x63, 0x61, 0x6e, 0x73, 0x74, 0x72, 0x75,
- 0x63, 0x74, 0x75, 0x72, 0x65, 0x20, 0x6f, 0x66, 0x2f, 0x69, 0x6e, 0x64, 0x65,
- 0x78, 0x2e, 0x68, 0x74, 0x6d, 0x6c, 0x20, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x73,
- 0x68, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x73, 0x70, 0x61, 0x6e, 0x20, 0x63, 0x6c,
- 0x61, 0x73, 0x73, 0x3d, 0x22, 0x22, 0x3e, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65,
- 0x66, 0x3d, 0x22, 0x2f, 0x69, 0x6e, 0x74, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x74,
- 0x69, 0x6f, 0x6e, 0x62, 0x65, 0x6c, 0x6f, 0x6e, 0x67, 0x69, 0x6e, 0x67, 0x20,
- 0x74, 0x6f, 0x63, 0x6c, 0x61, 0x69, 0x6d, 0x65, 0x64, 0x20, 0x74, 0x68, 0x61,
- 0x74, 0x63, 0x6f, 0x6e, 0x73, 0x65, 0x71, 0x75, 0x65, 0x6e, 0x63, 0x65, 0x73,
- 0x3c, 0x6d, 0x65, 0x74, 0x61, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x22, 0x47,
- 0x75, 0x69, 0x64, 0x65, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x6f, 0x76,
- 0x65, 0x72, 0x77, 0x68, 0x65, 0x6c, 0x6d, 0x69, 0x6e, 0x67, 0x61, 0x67, 0x61,
- 0x69, 0x6e, 0x73, 0x74, 0x20, 0x74, 0x68, 0x65, 0x20, 0x63, 0x6f, 0x6e, 0x63,
- 0x65, 0x6e, 0x74, 0x72, 0x61, 0x74, 0x65, 0x64, 0x2c, 0x0a, 0x2e, 0x6e, 0x6f,
- 0x6e, 0x74, 0x6f, 0x75, 0x63, 0x68, 0x20, 0x6f, 0x62, 0x73, 0x65, 0x72, 0x76,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x3c, 0x2f, 0x61, 0x3e, 0x0a, 0x3c, 0x2f,
- 0x64, 0x69, 0x76, 0x3e, 0x0a, 0x66, 0x20, 0x28, 0x64, 0x6f, 0x63, 0x75, 0x6d,
- 0x65, 0x6e, 0x74, 0x2e, 0x62, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x3a, 0x20, 0x31,
- 0x70, 0x78, 0x20, 0x7b, 0x66, 0x6f, 0x6e, 0x74, 0x2d, 0x73, 0x69, 0x7a, 0x65,
- 0x3a, 0x31, 0x74, 0x72, 0x65, 0x61, 0x74, 0x6d, 0x65, 0x6e, 0x74, 0x20, 0x6f,
- 0x66, 0x30, 0x22, 0x20, 0x68, 0x65, 0x69, 0x67, 0x68, 0x74, 0x3d, 0x22, 0x31,
- 0x6d, 0x6f, 0x64, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x49,
- 0x6e, 0x64, 0x65, 0x70, 0x65, 0x6e, 0x64, 0x65, 0x6e, 0x63, 0x65, 0x64, 0x69,
- 0x76, 0x69, 0x64, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x74, 0x6f, 0x67, 0x72, 0x65,
- 0x61, 0x74, 0x65, 0x72, 0x20, 0x74, 0x68, 0x61, 0x6e, 0x61, 0x63, 0x68, 0x69,
- 0x65, 0x76, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x65, 0x73, 0x74, 0x61, 0x62,
- 0x6c, 0x69, 0x73, 0x68, 0x69, 0x6e, 0x67, 0x4a, 0x61, 0x76, 0x61, 0x53, 0x63,
- 0x72, 0x69, 0x70, 0x74, 0x22, 0x20, 0x6e, 0x65, 0x76, 0x65, 0x72, 0x74, 0x68,
- 0x65, 0x6c, 0x65, 0x73, 0x73, 0x73, 0x69, 0x67, 0x6e, 0x69, 0x66, 0x69, 0x63,
- 0x61, 0x6e, 0x63, 0x65, 0x42, 0x72, 0x6f, 0x61, 0x64, 0x63, 0x61, 0x73, 0x74,
- 0x69, 0x6e, 0x67, 0x3e, 0x26, 0x6e, 0x62, 0x73, 0x70, 0x3b, 0x3c, 0x2f, 0x74,
- 0x64, 0x3e, 0x63, 0x6f, 0x6e, 0x74, 0x61, 0x69, 0x6e, 0x65, 0x72, 0x22, 0x3e,
- 0x0a, 0x73, 0x75, 0x63, 0x68, 0x20, 0x61, 0x73, 0x20, 0x74, 0x68, 0x65, 0x20,
- 0x69, 0x6e, 0x66, 0x6c, 0x75, 0x65, 0x6e, 0x63, 0x65, 0x20, 0x6f, 0x66, 0x61,
- 0x20, 0x70, 0x61, 0x72, 0x74, 0x69, 0x63, 0x75, 0x6c, 0x61, 0x72, 0x73, 0x72,
- 0x63, 0x3d, 0x27, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x6e, 0x61, 0x76,
- 0x69, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x20, 0x68, 0x61, 0x6c, 0x66,
- 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x73, 0x75, 0x62, 0x73, 0x74,
- 0x61, 0x6e, 0x74, 0x69, 0x61, 0x6c, 0x20, 0x26, 0x6e, 0x62, 0x73, 0x70, 0x3b,
- 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x61, 0x64, 0x76, 0x61, 0x6e, 0x74, 0x61,
- 0x67, 0x65, 0x20, 0x6f, 0x66, 0x64, 0x69, 0x73, 0x63, 0x6f, 0x76, 0x65, 0x72,
- 0x79, 0x20, 0x6f, 0x66, 0x66, 0x75, 0x6e, 0x64, 0x61, 0x6d, 0x65, 0x6e, 0x74,
- 0x61, 0x6c, 0x20, 0x6d, 0x65, 0x74, 0x72, 0x6f, 0x70, 0x6f, 0x6c, 0x69, 0x74,
- 0x61, 0x6e, 0x74, 0x68, 0x65, 0x20, 0x6f, 0x70, 0x70, 0x6f, 0x73, 0x69, 0x74,
- 0x65, 0x22, 0x20, 0x78, 0x6d, 0x6c, 0x3a, 0x6c, 0x61, 0x6e, 0x67, 0x3d, 0x22,
- 0x64, 0x65, 0x6c, 0x69, 0x62, 0x65, 0x72, 0x61, 0x74, 0x65, 0x6c, 0x79, 0x61,
- 0x6c, 0x69, 0x67, 0x6e, 0x3d, 0x63, 0x65, 0x6e, 0x74, 0x65, 0x72, 0x65, 0x76,
- 0x6f, 0x6c, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x70, 0x72, 0x65,
- 0x73, 0x65, 0x72, 0x76, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x69, 0x6d, 0x70, 0x72,
- 0x6f, 0x76, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x62, 0x65, 0x67, 0x69, 0x6e,
- 0x6e, 0x69, 0x6e, 0x67, 0x20, 0x69, 0x6e, 0x4a, 0x65, 0x73, 0x75, 0x73, 0x20,
- 0x43, 0x68, 0x72, 0x69, 0x73, 0x74, 0x50, 0x75, 0x62, 0x6c, 0x69, 0x63, 0x61,
- 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x64, 0x69, 0x73, 0x61, 0x67, 0x72, 0x65, 0x65,
- 0x6d, 0x65, 0x6e, 0x74, 0x74, 0x65, 0x78, 0x74, 0x2d, 0x61, 0x6c, 0x69, 0x67,
- 0x6e, 0x3a, 0x72, 0x2c, 0x20, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e,
- 0x28, 0x29, 0x73, 0x69, 0x6d, 0x69, 0x6c, 0x61, 0x72, 0x69, 0x74, 0x69, 0x65,
- 0x73, 0x62, 0x6f, 0x64, 0x79, 0x3e, 0x3c, 0x2f, 0x68, 0x74, 0x6d, 0x6c, 0x3e,
- 0x69, 0x73, 0x20, 0x63, 0x75, 0x72, 0x72, 0x65, 0x6e, 0x74, 0x6c, 0x79, 0x61,
- 0x6c, 0x70, 0x68, 0x61, 0x62, 0x65, 0x74, 0x69, 0x63, 0x61, 0x6c, 0x69, 0x73,
- 0x20, 0x73, 0x6f, 0x6d, 0x65, 0x74, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x79, 0x70,
- 0x65, 0x3d, 0x22, 0x69, 0x6d, 0x61, 0x67, 0x65, 0x2f, 0x6d, 0x61, 0x6e, 0x79,
- 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x66, 0x6c, 0x6f, 0x77, 0x3a,
- 0x68, 0x69, 0x64, 0x64, 0x65, 0x6e, 0x3b, 0x61, 0x76, 0x61, 0x69, 0x6c, 0x61,
- 0x62, 0x6c, 0x65, 0x20, 0x69, 0x6e, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x62,
- 0x65, 0x20, 0x74, 0x68, 0x65, 0x65, 0x78, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x63,
- 0x65, 0x20, 0x6f, 0x66, 0x61, 0x6c, 0x6c, 0x20, 0x6f, 0x76, 0x65, 0x72, 0x20,
- 0x74, 0x68, 0x65, 0x74, 0x68, 0x65, 0x20, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x6e,
- 0x65, 0x74, 0x09, 0x3c, 0x75, 0x6c, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d,
- 0x22, 0x69, 0x6e, 0x73, 0x74, 0x61, 0x6c, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e,
- 0x6e, 0x65, 0x69, 0x67, 0x68, 0x62, 0x6f, 0x72, 0x68, 0x6f, 0x6f, 0x64, 0x61,
- 0x72, 0x6d, 0x65, 0x64, 0x20, 0x66, 0x6f, 0x72, 0x63, 0x65, 0x73, 0x72, 0x65,
- 0x64, 0x75, 0x63, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65, 0x63, 0x6f, 0x6e,
- 0x74, 0x69, 0x6e, 0x75, 0x65, 0x73, 0x20, 0x74, 0x6f, 0x4e, 0x6f, 0x6e, 0x65,
- 0x74, 0x68, 0x65, 0x6c, 0x65, 0x73, 0x73, 0x2c, 0x74, 0x65, 0x6d, 0x70, 0x65,
- 0x72, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x0a, 0x09, 0x09, 0x3c, 0x61, 0x20,
- 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x63, 0x6c, 0x6f, 0x73, 0x65, 0x20, 0x74,
- 0x6f, 0x20, 0x74, 0x68, 0x65, 0x65, 0x78, 0x61, 0x6d, 0x70, 0x6c, 0x65, 0x73,
- 0x20, 0x6f, 0x66, 0x20, 0x69, 0x73, 0x20, 0x61, 0x62, 0x6f, 0x75, 0x74, 0x20,
- 0x74, 0x68, 0x65, 0x28, 0x73, 0x65, 0x65, 0x20, 0x62, 0x65, 0x6c, 0x6f, 0x77,
- 0x29, 0x2e, 0x22, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x73, 0x65, 0x61, 0x72, 0x63,
- 0x68, 0x70, 0x72, 0x6f, 0x66, 0x65, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x61, 0x6c,
- 0x69, 0x73, 0x20, 0x61, 0x76, 0x61, 0x69, 0x6c, 0x61, 0x62, 0x6c, 0x65, 0x74,
- 0x68, 0x65, 0x20, 0x6f, 0x66, 0x66, 0x69, 0x63, 0x69, 0x61, 0x6c, 0x09, 0x09,
- 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x0a, 0x0a, 0x09, 0x09,
- 0x3c, 0x64, 0x69, 0x76, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x61, 0x63, 0x63, 0x65,
- 0x6c, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x74, 0x68, 0x72, 0x6f, 0x75,
- 0x67, 0x68, 0x20, 0x74, 0x68, 0x65, 0x20, 0x48, 0x61, 0x6c, 0x6c, 0x20, 0x6f,
- 0x66, 0x20, 0x46, 0x61, 0x6d, 0x65, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70,
- 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x6c, 0x61, 0x74,
- 0x69, 0x6f, 0x6e, 0x73, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x66, 0x65, 0x72, 0x65,
- 0x6e, 0x63, 0x65, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x27, 0x74, 0x65, 0x78,
- 0x74, 0x2f, 0x72, 0x65, 0x63, 0x65, 0x6e, 0x74, 0x20, 0x79, 0x65, 0x61, 0x72,
- 0x73, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x77, 0x6f, 0x72, 0x6c, 0x64,
- 0x76, 0x65, 0x72, 0x79, 0x20, 0x70, 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x72, 0x7b,
- 0x62, 0x61, 0x63, 0x6b, 0x67, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x3a, 0x74, 0x72,
- 0x61, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x20, 0x73, 0x6f, 0x6d,
- 0x65, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x63, 0x6f, 0x6e, 0x6e,
- 0x65, 0x63, 0x74, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x65, 0x78, 0x70, 0x6c, 0x6f,
- 0x69, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x65, 0x6d, 0x65, 0x72, 0x67, 0x65,
- 0x6e, 0x63, 0x65, 0x20, 0x6f, 0x66, 0x63, 0x6f, 0x6e, 0x73, 0x74, 0x69, 0x74,
- 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x41, 0x20, 0x48, 0x69, 0x73, 0x74, 0x6f, 0x72,
- 0x79, 0x20, 0x6f, 0x66, 0x73, 0x69, 0x67, 0x6e, 0x69, 0x66, 0x69, 0x63, 0x61,
- 0x6e, 0x74, 0x20, 0x6d, 0x61, 0x6e, 0x75, 0x66, 0x61, 0x63, 0x74, 0x75, 0x72,
- 0x65, 0x64, 0x65, 0x78, 0x70, 0x65, 0x63, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e,
- 0x73, 0x3e, 0x3c, 0x6e, 0x6f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x3c,
- 0x63, 0x61, 0x6e, 0x20, 0x62, 0x65, 0x20, 0x66, 0x6f, 0x75, 0x6e, 0x64, 0x62,
- 0x65, 0x63, 0x61, 0x75, 0x73, 0x65, 0x20, 0x74, 0x68, 0x65, 0x20, 0x68, 0x61,
- 0x73, 0x20, 0x6e, 0x6f, 0x74, 0x20, 0x62, 0x65, 0x65, 0x6e, 0x6e, 0x65, 0x69,
- 0x67, 0x68, 0x62, 0x6f, 0x75, 0x72, 0x69, 0x6e, 0x67, 0x77, 0x69, 0x74, 0x68,
- 0x6f, 0x75, 0x74, 0x20, 0x74, 0x68, 0x65, 0x20, 0x61, 0x64, 0x64, 0x65, 0x64,
- 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x09, 0x3c, 0x6c, 0x69, 0x20, 0x63,
- 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x69, 0x6e, 0x73, 0x74, 0x72, 0x75, 0x6d,
- 0x65, 0x6e, 0x74, 0x61, 0x6c, 0x53, 0x6f, 0x76, 0x69, 0x65, 0x74, 0x20, 0x55,
- 0x6e, 0x69, 0x6f, 0x6e, 0x61, 0x63, 0x6b, 0x6e, 0x6f, 0x77, 0x6c, 0x65, 0x64,
- 0x67, 0x65, 0x64, 0x77, 0x68, 0x69, 0x63, 0x68, 0x20, 0x63, 0x61, 0x6e, 0x20,
- 0x62, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x20, 0x66, 0x6f, 0x72, 0x20, 0x74, 0x68,
- 0x65, 0x61, 0x74, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x74, 0x6f,
- 0x61, 0x74, 0x74, 0x65, 0x6d, 0x70, 0x74, 0x73, 0x20, 0x74, 0x6f, 0x20, 0x64,
- 0x65, 0x76, 0x65, 0x6c, 0x6f, 0x70, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x49, 0x6e,
- 0x20, 0x66, 0x61, 0x63, 0x74, 0x2c, 0x20, 0x74, 0x68, 0x65, 0x3c, 0x6c, 0x69,
- 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x61, 0x69, 0x6d, 0x70, 0x6c,
- 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x73, 0x75, 0x69, 0x74, 0x61,
- 0x62, 0x6c, 0x65, 0x20, 0x66, 0x6f, 0x72, 0x6d, 0x75, 0x63, 0x68, 0x20, 0x6f,
- 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x63, 0x6f, 0x6c, 0x6f, 0x6e, 0x69, 0x7a,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x70, 0x72, 0x65, 0x73, 0x69, 0x64, 0x65, 0x6e,
- 0x74, 0x69, 0x61, 0x6c, 0x63, 0x61, 0x6e, 0x63, 0x65, 0x6c, 0x42, 0x75, 0x62,
- 0x62, 0x6c, 0x65, 0x20, 0x49, 0x6e, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x69,
- 0x6f, 0x6e, 0x6d, 0x6f, 0x73, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65,
- 0x20, 0x69, 0x73, 0x20, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x62, 0x65, 0x64,
- 0x72, 0x65, 0x73, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x6d,
- 0x6f, 0x72, 0x65, 0x20, 0x6f, 0x72, 0x20, 0x6c, 0x65, 0x73, 0x73, 0x69, 0x6e,
- 0x20, 0x53, 0x65, 0x70, 0x74, 0x65, 0x6d, 0x62, 0x65, 0x72, 0x49, 0x6e, 0x74,
- 0x65, 0x6c, 0x6c, 0x69, 0x67, 0x65, 0x6e, 0x63, 0x65, 0x73, 0x72, 0x63, 0x3d,
- 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x70, 0x78, 0x3b, 0x20, 0x68,
- 0x65, 0x69, 0x67, 0x68, 0x74, 0x3a, 0x20, 0x61, 0x76, 0x61, 0x69, 0x6c, 0x61,
- 0x62, 0x6c, 0x65, 0x20, 0x74, 0x6f, 0x6d, 0x61, 0x6e, 0x75, 0x66, 0x61, 0x63,
- 0x74, 0x75, 0x72, 0x65, 0x72, 0x68, 0x75, 0x6d, 0x61, 0x6e, 0x20, 0x72, 0x69,
- 0x67, 0x68, 0x74, 0x73, 0x6c, 0x69, 0x6e, 0x6b, 0x20, 0x68, 0x72, 0x65, 0x66,
- 0x3d, 0x22, 0x2f, 0x61, 0x76, 0x61, 0x69, 0x6c, 0x61, 0x62, 0x69, 0x6c, 0x69,
- 0x74, 0x79, 0x70, 0x72, 0x6f, 0x70, 0x6f, 0x72, 0x74, 0x69, 0x6f, 0x6e, 0x61,
- 0x6c, 0x6f, 0x75, 0x74, 0x73, 0x69, 0x64, 0x65, 0x20, 0x74, 0x68, 0x65, 0x20,
- 0x61, 0x73, 0x74, 0x72, 0x6f, 0x6e, 0x6f, 0x6d, 0x69, 0x63, 0x61, 0x6c, 0x68,
- 0x75, 0x6d, 0x61, 0x6e, 0x20, 0x62, 0x65, 0x69, 0x6e, 0x67, 0x73, 0x6e, 0x61,
- 0x6d, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x61, 0x72, 0x65,
- 0x20, 0x66, 0x6f, 0x75, 0x6e, 0x64, 0x20, 0x69, 0x6e, 0x61, 0x72, 0x65, 0x20,
- 0x62, 0x61, 0x73, 0x65, 0x64, 0x20, 0x6f, 0x6e, 0x73, 0x6d, 0x61, 0x6c, 0x6c,
- 0x65, 0x72, 0x20, 0x74, 0x68, 0x61, 0x6e, 0x61, 0x20, 0x70, 0x65, 0x72, 0x73,
- 0x6f, 0x6e, 0x20, 0x77, 0x68, 0x6f, 0x65, 0x78, 0x70, 0x61, 0x6e, 0x73, 0x69,
- 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x61, 0x72, 0x67, 0x75, 0x69, 0x6e, 0x67, 0x20,
- 0x74, 0x68, 0x61, 0x74, 0x6e, 0x6f, 0x77, 0x20, 0x6b, 0x6e, 0x6f, 0x77, 0x6e,
- 0x20, 0x61, 0x73, 0x49, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x65, 0x61, 0x72,
- 0x6c, 0x79, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x6d, 0x65, 0x64, 0x69, 0x61, 0x74,
- 0x65, 0x64, 0x65, 0x72, 0x69, 0x76, 0x65, 0x64, 0x20, 0x66, 0x72, 0x6f, 0x6d,
- 0x53, 0x63, 0x61, 0x6e, 0x64, 0x69, 0x6e, 0x61, 0x76, 0x69, 0x61, 0x6e, 0x3c,
- 0x2f, 0x61, 0x3e, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0d, 0x0a, 0x63, 0x6f,
- 0x6e, 0x73, 0x69, 0x64, 0x65, 0x72, 0x20, 0x74, 0x68, 0x65, 0x61, 0x6e, 0x20,
- 0x65, 0x73, 0x74, 0x69, 0x6d, 0x61, 0x74, 0x65, 0x64, 0x74, 0x68, 0x65, 0x20,
- 0x4e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x3c, 0x64, 0x69, 0x76, 0x20,
- 0x69, 0x64, 0x3d, 0x22, 0x70, 0x61, 0x67, 0x72, 0x65, 0x73, 0x75, 0x6c, 0x74,
- 0x69, 0x6e, 0x67, 0x20, 0x69, 0x6e, 0x63, 0x6f, 0x6d, 0x6d, 0x69, 0x73, 0x73,
- 0x69, 0x6f, 0x6e, 0x65, 0x64, 0x61, 0x6e, 0x61, 0x6c, 0x6f, 0x67, 0x6f, 0x75,
- 0x73, 0x20, 0x74, 0x6f, 0x61, 0x72, 0x65, 0x20, 0x72, 0x65, 0x71, 0x75, 0x69,
- 0x72, 0x65, 0x64, 0x2f, 0x75, 0x6c, 0x3e, 0x0a, 0x3c, 0x2f, 0x64, 0x69, 0x76,
- 0x3e, 0x0a, 0x77, 0x61, 0x73, 0x20, 0x62, 0x61, 0x73, 0x65, 0x64, 0x20, 0x6f,
- 0x6e, 0x61, 0x6e, 0x64, 0x20, 0x62, 0x65, 0x63, 0x61, 0x6d, 0x65, 0x20, 0x61,
- 0x26, 0x6e, 0x62, 0x73, 0x70, 0x3b, 0x26, 0x6e, 0x62, 0x73, 0x70, 0x3b, 0x74,
- 0x22, 0x20, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3d, 0x22, 0x22, 0x20, 0x77, 0x61,
- 0x73, 0x20, 0x63, 0x61, 0x70, 0x74, 0x75, 0x72, 0x65, 0x64, 0x6e, 0x6f, 0x20,
- 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x74, 0x68, 0x61, 0x6e, 0x72, 0x65, 0x73, 0x70,
- 0x65, 0x63, 0x74, 0x69, 0x76, 0x65, 0x6c, 0x79, 0x63, 0x6f, 0x6e, 0x74, 0x69,
- 0x6e, 0x75, 0x65, 0x20, 0x74, 0x6f, 0x20, 0x3e, 0x0d, 0x0a, 0x3c, 0x68, 0x65,
- 0x61, 0x64, 0x3e, 0x0d, 0x0a, 0x3c, 0x77, 0x65, 0x72, 0x65, 0x20, 0x63, 0x72,
- 0x65, 0x61, 0x74, 0x65, 0x64, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x67, 0x65, 0x6e,
- 0x65, 0x72, 0x61, 0x6c, 0x69, 0x6e, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x69,
- 0x6f, 0x6e, 0x20, 0x75, 0x73, 0x65, 0x64, 0x20, 0x66, 0x6f, 0x72, 0x20, 0x74,
- 0x68, 0x65, 0x69, 0x6e, 0x64, 0x65, 0x70, 0x65, 0x6e, 0x64, 0x65, 0x6e, 0x74,
- 0x20, 0x74, 0x68, 0x65, 0x20, 0x49, 0x6d, 0x70, 0x65, 0x72, 0x69, 0x61, 0x6c,
- 0x63, 0x6f, 0x6d, 0x70, 0x6f, 0x6e, 0x65, 0x6e, 0x74, 0x20, 0x6f, 0x66, 0x74,
- 0x6f, 0x20, 0x74, 0x68, 0x65, 0x20, 0x6e, 0x6f, 0x72, 0x74, 0x68, 0x69, 0x6e,
- 0x63, 0x6c, 0x75, 0x64, 0x65, 0x20, 0x74, 0x68, 0x65, 0x20, 0x43, 0x6f, 0x6e,
- 0x73, 0x74, 0x72, 0x75, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x69, 0x64, 0x65,
- 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x77, 0x6f, 0x75, 0x6c, 0x64,
- 0x20, 0x6e, 0x6f, 0x74, 0x20, 0x62, 0x65, 0x66, 0x6f, 0x72, 0x20, 0x69, 0x6e,
- 0x73, 0x74, 0x61, 0x6e, 0x63, 0x65, 0x69, 0x6e, 0x76, 0x65, 0x6e, 0x74, 0x69,
- 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x63, 0x6f, 0x6d,
- 0x70, 0x6c, 0x65, 0x78, 0x63, 0x6f, 0x6c, 0x6c, 0x65, 0x63, 0x74, 0x69, 0x76,
- 0x65, 0x6c, 0x79, 0x62, 0x61, 0x63, 0x6b, 0x67, 0x72, 0x6f, 0x75, 0x6e, 0x64,
- 0x3a, 0x20, 0x74, 0x65, 0x78, 0x74, 0x2d, 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3a,
- 0x20, 0x69, 0x74, 0x73, 0x20, 0x6f, 0x72, 0x69, 0x67, 0x69, 0x6e, 0x61, 0x6c,
- 0x69, 0x6e, 0x74, 0x6f, 0x20, 0x61, 0x63, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x74,
- 0x68, 0x69, 0x73, 0x20, 0x70, 0x72, 0x6f, 0x63, 0x65, 0x73, 0x73, 0x61, 0x6e,
- 0x20, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x76, 0x65, 0x68, 0x6f, 0x77,
- 0x65, 0x76, 0x65, 0x72, 0x2c, 0x20, 0x74, 0x68, 0x65, 0x74, 0x68, 0x65, 0x79,
- 0x20, 0x61, 0x72, 0x65, 0x20, 0x6e, 0x6f, 0x74, 0x72, 0x65, 0x6a, 0x65, 0x63,
- 0x74, 0x65, 0x64, 0x20, 0x74, 0x68, 0x65, 0x63, 0x72, 0x69, 0x74, 0x69, 0x63,
- 0x69, 0x73, 0x6d, 0x20, 0x6f, 0x66, 0x64, 0x75, 0x72, 0x69, 0x6e, 0x67, 0x20,
- 0x77, 0x68, 0x69, 0x63, 0x68, 0x70, 0x72, 0x6f, 0x62, 0x61, 0x62, 0x6c, 0x79,
- 0x20, 0x74, 0x68, 0x65, 0x74, 0x68, 0x69, 0x73, 0x20, 0x61, 0x72, 0x74, 0x69,
- 0x63, 0x6c, 0x65, 0x28, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x28,
- 0x29, 0x7b, 0x49, 0x74, 0x20, 0x73, 0x68, 0x6f, 0x75, 0x6c, 0x64, 0x20, 0x62,
- 0x65, 0x61, 0x6e, 0x20, 0x61, 0x67, 0x72, 0x65, 0x65, 0x6d, 0x65, 0x6e, 0x74,
- 0x61, 0x63, 0x63, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x61, 0x6c, 0x6c, 0x79, 0x64,
- 0x69, 0x66, 0x66, 0x65, 0x72, 0x73, 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x41, 0x72,
- 0x63, 0x68, 0x69, 0x74, 0x65, 0x63, 0x74, 0x75, 0x72, 0x65, 0x62, 0x65, 0x74,
- 0x74, 0x65, 0x72, 0x20, 0x6b, 0x6e, 0x6f, 0x77, 0x6e, 0x61, 0x72, 0x72, 0x61,
- 0x6e, 0x67, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x69, 0x6e, 0x66, 0x6c, 0x75,
- 0x65, 0x6e, 0x63, 0x65, 0x20, 0x6f, 0x6e, 0x61, 0x74, 0x74, 0x65, 0x6e, 0x64,
- 0x65, 0x64, 0x20, 0x74, 0x68, 0x65, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x63,
- 0x61, 0x6c, 0x20, 0x74, 0x6f, 0x73, 0x6f, 0x75, 0x74, 0x68, 0x20, 0x6f, 0x66,
- 0x20, 0x74, 0x68, 0x65, 0x70, 0x61, 0x73, 0x73, 0x20, 0x74, 0x68, 0x72, 0x6f,
- 0x75, 0x67, 0x68, 0x78, 0x6d, 0x6c, 0x22, 0x20, 0x74, 0x69, 0x74, 0x6c, 0x65,
- 0x3d, 0x22, 0x77, 0x65, 0x69, 0x67, 0x68, 0x74, 0x3a, 0x62, 0x6f, 0x6c, 0x64,
- 0x3b, 0x63, 0x72, 0x65, 0x61, 0x74, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65,
- 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x3a, 0x6e, 0x6f, 0x6e, 0x65, 0x72,
- 0x65, 0x70, 0x6c, 0x61, 0x63, 0x65, 0x64, 0x20, 0x74, 0x68, 0x65, 0x3c, 0x69,
- 0x6d, 0x67, 0x20, 0x73, 0x72, 0x63, 0x3d, 0x22, 0x2f, 0x69, 0x68, 0x74, 0x74,
- 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x57, 0x6f, 0x72, 0x6c,
- 0x64, 0x20, 0x57, 0x61, 0x72, 0x20, 0x49, 0x49, 0x74, 0x65, 0x73, 0x74, 0x69,
- 0x6d, 0x6f, 0x6e, 0x69, 0x61, 0x6c, 0x73, 0x66, 0x6f, 0x75, 0x6e, 0x64, 0x20,
- 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x72, 0x65, 0x71, 0x75, 0x69, 0x72, 0x65,
- 0x64, 0x20, 0x74, 0x6f, 0x20, 0x61, 0x6e, 0x64, 0x20, 0x74, 0x68, 0x61, 0x74,
- 0x20, 0x74, 0x68, 0x65, 0x62, 0x65, 0x74, 0x77, 0x65, 0x65, 0x6e, 0x20, 0x74,
- 0x68, 0x65, 0x20, 0x77, 0x61, 0x73, 0x20, 0x64, 0x65, 0x73, 0x69, 0x67, 0x6e,
- 0x65, 0x64, 0x63, 0x6f, 0x6e, 0x73, 0x69, 0x73, 0x74, 0x73, 0x20, 0x6f, 0x66,
- 0x20, 0x63, 0x6f, 0x6e, 0x73, 0x69, 0x64, 0x65, 0x72, 0x61, 0x62, 0x6c, 0x79,
- 0x70, 0x75, 0x62, 0x6c, 0x69, 0x73, 0x68, 0x65, 0x64, 0x20, 0x62, 0x79, 0x74,
- 0x68, 0x65, 0x20, 0x6c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x43, 0x6f,
- 0x6e, 0x73, 0x65, 0x72, 0x76, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x63, 0x6f, 0x6e,
- 0x73, 0x69, 0x73, 0x74, 0x65, 0x64, 0x20, 0x6f, 0x66, 0x72, 0x65, 0x66, 0x65,
- 0x72, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x62, 0x61, 0x63, 0x6b, 0x20,
- 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x20, 0x63, 0x73, 0x73, 0x22, 0x20, 0x6d,
- 0x65, 0x64, 0x69, 0x61, 0x3d, 0x22, 0x50, 0x65, 0x6f, 0x70, 0x6c, 0x65, 0x20,
- 0x66, 0x72, 0x6f, 0x6d, 0x20, 0x61, 0x76, 0x61, 0x69, 0x6c, 0x61, 0x62, 0x6c,
- 0x65, 0x20, 0x6f, 0x6e, 0x70, 0x72, 0x6f, 0x76, 0x65, 0x64, 0x20, 0x74, 0x6f,
- 0x20, 0x62, 0x65, 0x73, 0x75, 0x67, 0x67, 0x65, 0x73, 0x74, 0x69, 0x6f, 0x6e,
- 0x73, 0x22, 0x77, 0x61, 0x73, 0x20, 0x6b, 0x6e, 0x6f, 0x77, 0x6e, 0x20, 0x61,
- 0x73, 0x76, 0x61, 0x72, 0x69, 0x65, 0x74, 0x69, 0x65, 0x73, 0x20, 0x6f, 0x66,
- 0x6c, 0x69, 0x6b, 0x65, 0x6c, 0x79, 0x20, 0x74, 0x6f, 0x20, 0x62, 0x65, 0x63,
- 0x6f, 0x6d, 0x70, 0x72, 0x69, 0x73, 0x65, 0x64, 0x20, 0x6f, 0x66, 0x73, 0x75,
- 0x70, 0x70, 0x6f, 0x72, 0x74, 0x20, 0x74, 0x68, 0x65, 0x20, 0x68, 0x61, 0x6e,
- 0x64, 0x73, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x63, 0x6f, 0x75, 0x70,
- 0x6c, 0x65, 0x64, 0x20, 0x77, 0x69, 0x74, 0x68, 0x63, 0x6f, 0x6e, 0x6e, 0x65,
- 0x63, 0x74, 0x20, 0x61, 0x6e, 0x64, 0x20, 0x62, 0x6f, 0x72, 0x64, 0x65, 0x72,
- 0x3a, 0x6e, 0x6f, 0x6e, 0x65, 0x3b, 0x70, 0x65, 0x72, 0x66, 0x6f, 0x72, 0x6d,
- 0x61, 0x6e, 0x63, 0x65, 0x73, 0x62, 0x65, 0x66, 0x6f, 0x72, 0x65, 0x20, 0x62,
- 0x65, 0x69, 0x6e, 0x67, 0x6c, 0x61, 0x74, 0x65, 0x72, 0x20, 0x62, 0x65, 0x63,
- 0x61, 0x6d, 0x65, 0x63, 0x61, 0x6c, 0x63, 0x75, 0x6c, 0x61, 0x74, 0x69, 0x6f,
- 0x6e, 0x73, 0x6f, 0x66, 0x74, 0x65, 0x6e, 0x20, 0x63, 0x61, 0x6c, 0x6c, 0x65,
- 0x64, 0x72, 0x65, 0x73, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x73, 0x20, 0x6f, 0x66,
- 0x6d, 0x65, 0x61, 0x6e, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x61, 0x74, 0x3e,
- 0x3c, 0x6c, 0x69, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x65, 0x76,
- 0x69, 0x64, 0x65, 0x6e, 0x63, 0x65, 0x20, 0x66, 0x6f, 0x72, 0x65, 0x78, 0x70,
- 0x6c, 0x61, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x65, 0x6e, 0x76, 0x69,
- 0x72, 0x6f, 0x6e, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x22, 0x3e, 0x3c, 0x2f, 0x61,
- 0x3e, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x77, 0x68, 0x69, 0x63, 0x68, 0x20,
- 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x73, 0x49, 0x6e, 0x74, 0x72, 0x6f, 0x64, 0x75,
- 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x64, 0x65, 0x76, 0x65, 0x6c, 0x6f, 0x70, 0x65,
- 0x64, 0x20, 0x62, 0x79, 0x61, 0x20, 0x77, 0x69, 0x64, 0x65, 0x20, 0x72, 0x61,
- 0x6e, 0x67, 0x65, 0x6f, 0x6e, 0x20, 0x62, 0x65, 0x68, 0x61, 0x6c, 0x66, 0x20,
- 0x6f, 0x66, 0x76, 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3d, 0x22, 0x74, 0x6f, 0x70,
- 0x22, 0x70, 0x72, 0x69, 0x6e, 0x63, 0x69, 0x70, 0x6c, 0x65, 0x20, 0x6f, 0x66,
- 0x61, 0x74, 0x20, 0x74, 0x68, 0x65, 0x20, 0x74, 0x69, 0x6d, 0x65, 0x2c, 0x3c,
- 0x2f, 0x6e, 0x6f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x0d, 0x73, 0x61,
- 0x69, 0x64, 0x20, 0x74, 0x6f, 0x20, 0x68, 0x61, 0x76, 0x65, 0x69, 0x6e, 0x20,
- 0x74, 0x68, 0x65, 0x20, 0x66, 0x69, 0x72, 0x73, 0x74, 0x77, 0x68, 0x69, 0x6c,
- 0x65, 0x20, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x73, 0x68, 0x79, 0x70, 0x6f, 0x74,
- 0x68, 0x65, 0x74, 0x69, 0x63, 0x61, 0x6c, 0x70, 0x68, 0x69, 0x6c, 0x6f, 0x73,
- 0x6f, 0x70, 0x68, 0x65, 0x72, 0x73, 0x70, 0x6f, 0x77, 0x65, 0x72, 0x20, 0x6f,
- 0x66, 0x20, 0x74, 0x68, 0x65, 0x63, 0x6f, 0x6e, 0x74, 0x61, 0x69, 0x6e, 0x65,
- 0x64, 0x20, 0x69, 0x6e, 0x70, 0x65, 0x72, 0x66, 0x6f, 0x72, 0x6d, 0x65, 0x64,
- 0x20, 0x62, 0x79, 0x69, 0x6e, 0x61, 0x62, 0x69, 0x6c, 0x69, 0x74, 0x79, 0x20,
- 0x74, 0x6f, 0x77, 0x65, 0x72, 0x65, 0x20, 0x77, 0x72, 0x69, 0x74, 0x74, 0x65,
- 0x6e, 0x73, 0x70, 0x61, 0x6e, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22,
- 0x69, 0x6e, 0x70, 0x75, 0x74, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x22, 0x74,
- 0x68, 0x65, 0x20, 0x71, 0x75, 0x65, 0x73, 0x74, 0x69, 0x6f, 0x6e, 0x69, 0x6e,
- 0x74, 0x65, 0x6e, 0x64, 0x65, 0x64, 0x20, 0x66, 0x6f, 0x72, 0x72, 0x65, 0x6a,
- 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x69, 0x6d, 0x70, 0x6c,
- 0x69, 0x65, 0x73, 0x20, 0x74, 0x68, 0x61, 0x74, 0x69, 0x6e, 0x76, 0x65, 0x6e,
- 0x74, 0x65, 0x64, 0x20, 0x74, 0x68, 0x65, 0x74, 0x68, 0x65, 0x20, 0x73, 0x74,
- 0x61, 0x6e, 0x64, 0x61, 0x72, 0x64, 0x77, 0x61, 0x73, 0x20, 0x70, 0x72, 0x6f,
- 0x62, 0x61, 0x62, 0x6c, 0x79, 0x6c, 0x69, 0x6e, 0x6b, 0x20, 0x62, 0x65, 0x74,
- 0x77, 0x65, 0x65, 0x6e, 0x70, 0x72, 0x6f, 0x66, 0x65, 0x73, 0x73, 0x6f, 0x72,
- 0x20, 0x6f, 0x66, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x61, 0x63, 0x74, 0x69, 0x6f,
- 0x6e, 0x73, 0x63, 0x68, 0x61, 0x6e, 0x67, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68,
- 0x65, 0x49, 0x6e, 0x64, 0x69, 0x61, 0x6e, 0x20, 0x4f, 0x63, 0x65, 0x61, 0x6e,
- 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x6c, 0x61, 0x73, 0x74, 0x77,
- 0x6f, 0x72, 0x6b, 0x69, 0x6e, 0x67, 0x20, 0x77, 0x69, 0x74, 0x68, 0x27, 0x68,
- 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x79, 0x65, 0x61,
- 0x72, 0x73, 0x20, 0x62, 0x65, 0x66, 0x6f, 0x72, 0x65, 0x54, 0x68, 0x69, 0x73,
- 0x20, 0x77, 0x61, 0x73, 0x20, 0x74, 0x68, 0x65, 0x72, 0x65, 0x63, 0x72, 0x65,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x65, 0x6e, 0x74, 0x65, 0x72, 0x69,
- 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65, 0x6d, 0x65, 0x61, 0x73, 0x75, 0x72, 0x65,
- 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x61, 0x6e, 0x20, 0x65, 0x78, 0x74, 0x72, 0x65,
- 0x6d, 0x65, 0x6c, 0x79, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x20, 0x6f, 0x66, 0x20,
- 0x74, 0x68, 0x65, 0x73, 0x74, 0x61, 0x72, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x74,
- 0x68, 0x65, 0x0a, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x0a,
- 0x0a, 0x61, 0x6e, 0x20, 0x65, 0x66, 0x66, 0x6f, 0x72, 0x74, 0x20, 0x74, 0x6f,
- 0x69, 0x6e, 0x63, 0x72, 0x65, 0x61, 0x73, 0x65, 0x20, 0x74, 0x68, 0x65, 0x74,
- 0x6f, 0x20, 0x74, 0x68, 0x65, 0x20, 0x73, 0x6f, 0x75, 0x74, 0x68, 0x73, 0x70,
- 0x61, 0x63, 0x69, 0x6e, 0x67, 0x3d, 0x22, 0x30, 0x22, 0x3e, 0x73, 0x75, 0x66,
- 0x66, 0x69, 0x63, 0x69, 0x65, 0x6e, 0x74, 0x6c, 0x79, 0x74, 0x68, 0x65, 0x20,
- 0x45, 0x75, 0x72, 0x6f, 0x70, 0x65, 0x61, 0x6e, 0x63, 0x6f, 0x6e, 0x76, 0x65,
- 0x72, 0x74, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x63, 0x6c, 0x65, 0x61, 0x72, 0x54,
- 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x64, 0x69, 0x64, 0x20, 0x6e, 0x6f, 0x74,
- 0x20, 0x68, 0x61, 0x76, 0x65, 0x63, 0x6f, 0x6e, 0x73, 0x65, 0x71, 0x75, 0x65,
- 0x6e, 0x74, 0x6c, 0x79, 0x66, 0x6f, 0x72, 0x20, 0x74, 0x68, 0x65, 0x20, 0x6e,
- 0x65, 0x78, 0x74, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x20,
- 0x6f, 0x66, 0x65, 0x63, 0x6f, 0x6e, 0x6f, 0x6d, 0x69, 0x63, 0x20, 0x61, 0x6e,
- 0x64, 0x61, 0x6c, 0x74, 0x68, 0x6f, 0x75, 0x67, 0x68, 0x20, 0x74, 0x68, 0x65,
- 0x61, 0x72, 0x65, 0x20, 0x70, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x65, 0x64, 0x61,
- 0x6e, 0x64, 0x20, 0x77, 0x69, 0x74, 0x68, 0x20, 0x74, 0x68, 0x65, 0x69, 0x6e,
- 0x73, 0x75, 0x66, 0x66, 0x69, 0x63, 0x69, 0x65, 0x6e, 0x74, 0x67, 0x69, 0x76,
- 0x65, 0x6e, 0x20, 0x62, 0x79, 0x20, 0x74, 0x68, 0x65, 0x73, 0x74, 0x61, 0x74,
- 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x61, 0x74, 0x65, 0x78, 0x70, 0x65, 0x6e,
- 0x64, 0x69, 0x74, 0x75, 0x72, 0x65, 0x73, 0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e,
- 0x3e, 0x3c, 0x2f, 0x61, 0x3e, 0x0a, 0x74, 0x68, 0x6f, 0x75, 0x67, 0x68, 0x74,
- 0x20, 0x74, 0x68, 0x61, 0x74, 0x6f, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x62,
- 0x61, 0x73, 0x69, 0x73, 0x63, 0x65, 0x6c, 0x6c, 0x70, 0x61, 0x64, 0x64, 0x69,
- 0x6e, 0x67, 0x3d, 0x69, 0x6d, 0x61, 0x67, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x74,
- 0x68, 0x65, 0x72, 0x65, 0x74, 0x75, 0x72, 0x6e, 0x69, 0x6e, 0x67, 0x20, 0x74,
- 0x6f, 0x69, 0x6e, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2c,
- 0x73, 0x65, 0x70, 0x61, 0x72, 0x61, 0x74, 0x65, 0x64, 0x20, 0x62, 0x79, 0x61,
- 0x73, 0x73, 0x61, 0x73, 0x73, 0x69, 0x6e, 0x61, 0x74, 0x65, 0x64, 0x73, 0x22,
- 0x20, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x3d, 0x22, 0x61, 0x75, 0x74,
- 0x68, 0x6f, 0x72, 0x69, 0x74, 0x79, 0x20, 0x6f, 0x66, 0x6e, 0x6f, 0x72, 0x74,
- 0x68, 0x77, 0x65, 0x73, 0x74, 0x65, 0x72, 0x6e, 0x3c, 0x2f, 0x64, 0x69, 0x76,
- 0x3e, 0x0a, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x22, 0x3e, 0x3c, 0x2f, 0x64, 0x69,
- 0x76, 0x3e, 0x0d, 0x0a, 0x20, 0x20, 0x63, 0x6f, 0x6e, 0x73, 0x75, 0x6c, 0x74,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x63, 0x6f, 0x6d, 0x6d, 0x75, 0x6e, 0x69, 0x74,
- 0x79, 0x20, 0x6f, 0x66, 0x74, 0x68, 0x65, 0x20, 0x6e, 0x61, 0x74, 0x69, 0x6f,
- 0x6e, 0x61, 0x6c, 0x69, 0x74, 0x20, 0x73, 0x68, 0x6f, 0x75, 0x6c, 0x64, 0x20,
- 0x62, 0x65, 0x70, 0x61, 0x72, 0x74, 0x69, 0x63, 0x69, 0x70, 0x61, 0x6e, 0x74,
- 0x73, 0x20, 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3d, 0x22, 0x6c, 0x65, 0x66, 0x74,
- 0x74, 0x68, 0x65, 0x20, 0x67, 0x72, 0x65, 0x61, 0x74, 0x65, 0x73, 0x74, 0x73,
- 0x65, 0x6c, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x73, 0x75,
- 0x70, 0x65, 0x72, 0x6e, 0x61, 0x74, 0x75, 0x72, 0x61, 0x6c, 0x64, 0x65, 0x70,
- 0x65, 0x6e, 0x64, 0x65, 0x6e, 0x74, 0x20, 0x6f, 0x6e, 0x69, 0x73, 0x20, 0x6d,
- 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x65, 0x64, 0x61, 0x6c, 0x6c, 0x6f, 0x77,
- 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65, 0x77, 0x61, 0x73, 0x20, 0x69, 0x6e,
- 0x76, 0x65, 0x6e, 0x74, 0x65, 0x64, 0x61, 0x63, 0x63, 0x6f, 0x6d, 0x70, 0x61,
- 0x6e, 0x79, 0x69, 0x6e, 0x67, 0x68, 0x69, 0x73, 0x20, 0x70, 0x65, 0x72, 0x73,
- 0x6f, 0x6e, 0x61, 0x6c, 0x61, 0x76, 0x61, 0x69, 0x6c, 0x61, 0x62, 0x6c, 0x65,
- 0x20, 0x61, 0x74, 0x73, 0x74, 0x75, 0x64, 0x79, 0x20, 0x6f, 0x66, 0x20, 0x74,
- 0x68, 0x65, 0x6f, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x6f, 0x74, 0x68, 0x65,
- 0x72, 0x65, 0x78, 0x65, 0x63, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66,
- 0x48, 0x75, 0x6d, 0x61, 0x6e, 0x20, 0x52, 0x69, 0x67, 0x68, 0x74, 0x73, 0x74,
- 0x65, 0x72, 0x6d, 0x73, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x61, 0x73,
- 0x73, 0x6f, 0x63, 0x69, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x72, 0x65, 0x73,
- 0x65, 0x61, 0x72, 0x63, 0x68, 0x20, 0x61, 0x6e, 0x64, 0x73, 0x75, 0x63, 0x63,
- 0x65, 0x65, 0x64, 0x65, 0x64, 0x20, 0x62, 0x79, 0x64, 0x65, 0x66, 0x65, 0x61,
- 0x74, 0x65, 0x64, 0x20, 0x74, 0x68, 0x65, 0x61, 0x6e, 0x64, 0x20, 0x66, 0x72,
- 0x6f, 0x6d, 0x20, 0x74, 0x68, 0x65, 0x62, 0x75, 0x74, 0x20, 0x74, 0x68, 0x65,
- 0x79, 0x20, 0x61, 0x72, 0x65, 0x63, 0x6f, 0x6d, 0x6d, 0x61, 0x6e, 0x64, 0x65,
- 0x72, 0x20, 0x6f, 0x66, 0x73, 0x74, 0x61, 0x74, 0x65, 0x20, 0x6f, 0x66, 0x20,
- 0x74, 0x68, 0x65, 0x79, 0x65, 0x61, 0x72, 0x73, 0x20, 0x6f, 0x66, 0x20, 0x61,
- 0x67, 0x65, 0x74, 0x68, 0x65, 0x20, 0x73, 0x74, 0x75, 0x64, 0x79, 0x20, 0x6f,
- 0x66, 0x3c, 0x75, 0x6c, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x73,
- 0x70, 0x6c, 0x61, 0x63, 0x65, 0x20, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x77,
- 0x68, 0x65, 0x72, 0x65, 0x20, 0x68, 0x65, 0x20, 0x77, 0x61, 0x73, 0x3c, 0x6c,
- 0x69, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x66, 0x74, 0x68, 0x65,
- 0x72, 0x65, 0x20, 0x61, 0x72, 0x65, 0x20, 0x6e, 0x6f, 0x77, 0x68, 0x69, 0x63,
- 0x68, 0x20, 0x62, 0x65, 0x63, 0x61, 0x6d, 0x65, 0x68, 0x65, 0x20, 0x70, 0x75,
- 0x62, 0x6c, 0x69, 0x73, 0x68, 0x65, 0x64, 0x65, 0x78, 0x70, 0x72, 0x65, 0x73,
- 0x73, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x74, 0x6f, 0x20, 0x77, 0x68, 0x69, 0x63,
- 0x68, 0x20, 0x74, 0x68, 0x65, 0x63, 0x6f, 0x6d, 0x6d, 0x69, 0x73, 0x73, 0x69,
- 0x6f, 0x6e, 0x65, 0x72, 0x66, 0x6f, 0x6e, 0x74, 0x2d, 0x77, 0x65, 0x69, 0x67,
- 0x68, 0x74, 0x3a, 0x74, 0x65, 0x72, 0x72, 0x69, 0x74, 0x6f, 0x72, 0x79, 0x20,
- 0x6f, 0x66, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x22,
- 0x3e, 0x52, 0x6f, 0x6d, 0x61, 0x6e, 0x20, 0x45, 0x6d, 0x70, 0x69, 0x72, 0x65,
- 0x65, 0x71, 0x75, 0x61, 0x6c, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x49,
- 0x6e, 0x20, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x61, 0x73, 0x74, 0x2c, 0x68, 0x6f,
- 0x77, 0x65, 0x76, 0x65, 0x72, 0x2c, 0x20, 0x61, 0x6e, 0x64, 0x69, 0x73, 0x20,
- 0x74, 0x79, 0x70, 0x69, 0x63, 0x61, 0x6c, 0x6c, 0x79, 0x61, 0x6e, 0x64, 0x20,
- 0x68, 0x69, 0x73, 0x20, 0x77, 0x69, 0x66, 0x65, 0x28, 0x61, 0x6c, 0x73, 0x6f,
- 0x20, 0x63, 0x61, 0x6c, 0x6c, 0x65, 0x64, 0x3e, 0x3c, 0x75, 0x6c, 0x20, 0x63,
- 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x65, 0x66, 0x66, 0x65, 0x63, 0x74, 0x69,
- 0x76, 0x65, 0x6c, 0x79, 0x20, 0x65, 0x76, 0x6f, 0x6c, 0x76, 0x65, 0x64, 0x20,
- 0x69, 0x6e, 0x74, 0x6f, 0x73, 0x65, 0x65, 0x6d, 0x20, 0x74, 0x6f, 0x20, 0x68,
- 0x61, 0x76, 0x65, 0x77, 0x68, 0x69, 0x63, 0x68, 0x20, 0x69, 0x73, 0x20, 0x74,
- 0x68, 0x65, 0x74, 0x68, 0x65, 0x72, 0x65, 0x20, 0x77, 0x61, 0x73, 0x20, 0x6e,
- 0x6f, 0x61, 0x6e, 0x20, 0x65, 0x78, 0x63, 0x65, 0x6c, 0x6c, 0x65, 0x6e, 0x74,
- 0x61, 0x6c, 0x6c, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x73, 0x65, 0x64,
- 0x65, 0x73, 0x63, 0x72, 0x69, 0x62, 0x65, 0x64, 0x20, 0x62, 0x79, 0x49, 0x6e,
- 0x20, 0x70, 0x72, 0x61, 0x63, 0x74, 0x69, 0x63, 0x65, 0x2c, 0x62, 0x72, 0x6f,
- 0x61, 0x64, 0x63, 0x61, 0x73, 0x74, 0x69, 0x6e, 0x67, 0x63, 0x68, 0x61, 0x72,
- 0x67, 0x65, 0x64, 0x20, 0x77, 0x69, 0x74, 0x68, 0x72, 0x65, 0x66, 0x6c, 0x65,
- 0x63, 0x74, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x73, 0x75, 0x62, 0x6a, 0x65, 0x63,
- 0x74, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x6d, 0x69, 0x6c, 0x69, 0x74, 0x61, 0x72,
- 0x79, 0x20, 0x61, 0x6e, 0x64, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x20, 0x70,
- 0x6f, 0x69, 0x6e, 0x74, 0x65, 0x63, 0x6f, 0x6e, 0x6f, 0x6d, 0x69, 0x63, 0x61,
- 0x6c, 0x6c, 0x79, 0x73, 0x65, 0x74, 0x54, 0x61, 0x72, 0x67, 0x65, 0x74, 0x69,
- 0x6e, 0x67, 0x61, 0x72, 0x65, 0x20, 0x61, 0x63, 0x74, 0x75, 0x61, 0x6c, 0x6c,
- 0x79, 0x76, 0x69, 0x63, 0x74, 0x6f, 0x72, 0x79, 0x20, 0x6f, 0x76, 0x65, 0x72,
- 0x28, 0x29, 0x3b, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x63,
- 0x6f, 0x6e, 0x74, 0x69, 0x6e, 0x75, 0x6f, 0x75, 0x73, 0x6c, 0x79, 0x72, 0x65,
- 0x71, 0x75, 0x69, 0x72, 0x65, 0x64, 0x20, 0x66, 0x6f, 0x72, 0x65, 0x76, 0x6f,
- 0x6c, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x72, 0x79, 0x61, 0x6e, 0x20, 0x65,
- 0x66, 0x66, 0x65, 0x63, 0x74, 0x69, 0x76, 0x65, 0x6e, 0x6f, 0x72, 0x74, 0x68,
- 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x2c, 0x20, 0x77, 0x68, 0x69, 0x63,
- 0x68, 0x20, 0x77, 0x61, 0x73, 0x20, 0x66, 0x72, 0x6f, 0x6e, 0x74, 0x20, 0x6f,
- 0x66, 0x20, 0x74, 0x68, 0x65, 0x6f, 0x72, 0x20, 0x6f, 0x74, 0x68, 0x65, 0x72,
- 0x77, 0x69, 0x73, 0x65, 0x73, 0x6f, 0x6d, 0x65, 0x20, 0x66, 0x6f, 0x72, 0x6d,
- 0x20, 0x6f, 0x66, 0x68, 0x61, 0x64, 0x20, 0x6e, 0x6f, 0x74, 0x20, 0x62, 0x65,
- 0x65, 0x6e, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x65, 0x64, 0x20, 0x62,
- 0x79, 0x69, 0x6e, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e,
- 0x70, 0x65, 0x72, 0x6d, 0x69, 0x74, 0x74, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x69,
- 0x6e, 0x63, 0x6c, 0x75, 0x64, 0x65, 0x73, 0x20, 0x74, 0x68, 0x65, 0x64, 0x65,
- 0x76, 0x65, 0x6c, 0x6f, 0x70, 0x6d, 0x65, 0x6e, 0x74, 0x2c, 0x65, 0x6e, 0x74,
- 0x65, 0x72, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x74, 0x6f, 0x74, 0x68, 0x65, 0x20,
- 0x70, 0x72, 0x65, 0x76, 0x69, 0x6f, 0x75, 0x73, 0x63, 0x6f, 0x6e, 0x73, 0x69,
- 0x73, 0x74, 0x65, 0x6e, 0x74, 0x6c, 0x79, 0x61, 0x72, 0x65, 0x20, 0x6b, 0x6e,
- 0x6f, 0x77, 0x6e, 0x20, 0x61, 0x73, 0x74, 0x68, 0x65, 0x20, 0x66, 0x69, 0x65,
- 0x6c, 0x64, 0x20, 0x6f, 0x66, 0x74, 0x68, 0x69, 0x73, 0x20, 0x74, 0x79, 0x70,
- 0x65, 0x20, 0x6f, 0x66, 0x67, 0x69, 0x76, 0x65, 0x6e, 0x20, 0x74, 0x6f, 0x20,
- 0x74, 0x68, 0x65, 0x74, 0x68, 0x65, 0x20, 0x74, 0x69, 0x74, 0x6c, 0x65, 0x20,
- 0x6f, 0x66, 0x63, 0x6f, 0x6e, 0x74, 0x61, 0x69, 0x6e, 0x73, 0x20, 0x74, 0x68,
- 0x65, 0x69, 0x6e, 0x73, 0x74, 0x61, 0x6e, 0x63, 0x65, 0x73, 0x20, 0x6f, 0x66,
- 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x6e, 0x6f, 0x72, 0x74, 0x68, 0x64,
- 0x75, 0x65, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x69, 0x72, 0x61, 0x72,
- 0x65, 0x20, 0x64, 0x65, 0x73, 0x69, 0x67, 0x6e, 0x65, 0x64, 0x63, 0x6f, 0x72,
- 0x70, 0x6f, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x77, 0x61, 0x73, 0x20,
- 0x74, 0x68, 0x61, 0x74, 0x20, 0x74, 0x68, 0x65, 0x6f, 0x6e, 0x65, 0x20, 0x6f,
- 0x66, 0x20, 0x74, 0x68, 0x65, 0x73, 0x65, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x70,
- 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x72, 0x73, 0x75, 0x63, 0x63, 0x65, 0x65, 0x64,
- 0x65, 0x64, 0x20, 0x69, 0x6e, 0x73, 0x75, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x20,
- 0x66, 0x72, 0x6f, 0x6d, 0x69, 0x6e, 0x20, 0x64, 0x69, 0x66, 0x66, 0x65, 0x72,
- 0x65, 0x6e, 0x74, 0x64, 0x6f, 0x6d, 0x69, 0x6e, 0x61, 0x74, 0x65, 0x64, 0x20,
- 0x62, 0x79, 0x64, 0x65, 0x73, 0x69, 0x67, 0x6e, 0x65, 0x64, 0x20, 0x66, 0x6f,
- 0x72, 0x6f, 0x77, 0x6e, 0x65, 0x72, 0x73, 0x68, 0x69, 0x70, 0x20, 0x6f, 0x66,
- 0x61, 0x6e, 0x64, 0x20, 0x70, 0x6f, 0x73, 0x73, 0x69, 0x62, 0x6c, 0x79, 0x73,
- 0x74, 0x61, 0x6e, 0x64, 0x61, 0x72, 0x64, 0x69, 0x7a, 0x65, 0x64, 0x72, 0x65,
- 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x54, 0x65, 0x78, 0x74, 0x77, 0x61, 0x73,
- 0x20, 0x69, 0x6e, 0x74, 0x65, 0x6e, 0x64, 0x65, 0x64, 0x72, 0x65, 0x63, 0x65,
- 0x69, 0x76, 0x65, 0x64, 0x20, 0x74, 0x68, 0x65, 0x61, 0x73, 0x73, 0x75, 0x6d,
- 0x65, 0x64, 0x20, 0x74, 0x68, 0x61, 0x74, 0x61, 0x72, 0x65, 0x61, 0x73, 0x20,
- 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x70, 0x72, 0x69, 0x6d, 0x61, 0x72, 0x69,
- 0x6c, 0x79, 0x20, 0x69, 0x6e, 0x74, 0x68, 0x65, 0x20, 0x62, 0x61, 0x73, 0x69,
- 0x73, 0x20, 0x6f, 0x66, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x73, 0x65,
- 0x6e, 0x73, 0x65, 0x61, 0x63, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x73, 0x20, 0x66,
- 0x6f, 0x72, 0x64, 0x65, 0x73, 0x74, 0x72, 0x6f, 0x79, 0x65, 0x64, 0x20, 0x62,
- 0x79, 0x61, 0x74, 0x20, 0x6c, 0x65, 0x61, 0x73, 0x74, 0x20, 0x74, 0x77, 0x6f,
- 0x77, 0x61, 0x73, 0x20, 0x64, 0x65, 0x63, 0x6c, 0x61, 0x72, 0x65, 0x64, 0x63,
- 0x6f, 0x75, 0x6c, 0x64, 0x20, 0x6e, 0x6f, 0x74, 0x20, 0x62, 0x65, 0x53, 0x65,
- 0x63, 0x72, 0x65, 0x74, 0x61, 0x72, 0x79, 0x20, 0x6f, 0x66, 0x61, 0x70, 0x70,
- 0x65, 0x61, 0x72, 0x20, 0x74, 0x6f, 0x20, 0x62, 0x65, 0x6d, 0x61, 0x72, 0x67,
- 0x69, 0x6e, 0x2d, 0x74, 0x6f, 0x70, 0x3a, 0x31, 0x2f, 0x5e, 0x5c, 0x73, 0x2b,
- 0x7c, 0x5c, 0x73, 0x2b, 0x24, 0x2f, 0x67, 0x65, 0x29, 0x7b, 0x74, 0x68, 0x72,
- 0x6f, 0x77, 0x20, 0x65, 0x7d, 0x3b, 0x74, 0x68, 0x65, 0x20, 0x73, 0x74, 0x61,
- 0x72, 0x74, 0x20, 0x6f, 0x66, 0x74, 0x77, 0x6f, 0x20, 0x73, 0x65, 0x70, 0x61,
- 0x72, 0x61, 0x74, 0x65, 0x6c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x20,
- 0x61, 0x6e, 0x64, 0x77, 0x68, 0x6f, 0x20, 0x68, 0x61, 0x64, 0x20, 0x62, 0x65,
- 0x65, 0x6e, 0x6f, 0x70, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f,
- 0x66, 0x64, 0x65, 0x61, 0x74, 0x68, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65,
- 0x72, 0x65, 0x61, 0x6c, 0x20, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x73, 0x09,
- 0x3c, 0x6c, 0x69, 0x6e, 0x6b, 0x20, 0x72, 0x65, 0x6c, 0x3d, 0x22, 0x70, 0x72,
- 0x6f, 0x76, 0x69, 0x64, 0x65, 0x64, 0x20, 0x74, 0x68, 0x65, 0x74, 0x68, 0x65,
- 0x20, 0x73, 0x74, 0x6f, 0x72, 0x79, 0x20, 0x6f, 0x66, 0x63, 0x6f, 0x6d, 0x70,
- 0x65, 0x74, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x65, 0x6e, 0x67, 0x6c, 0x69,
- 0x73, 0x68, 0x20, 0x28, 0x55, 0x4b, 0x29, 0x65, 0x6e, 0x67, 0x6c, 0x69, 0x73,
- 0x68, 0x20, 0x28, 0x55, 0x53, 0x29, 0xd0, 0x9c, 0xd0, 0xbe, 0xd0, 0xbd, 0xd0,
- 0xb3, 0xd0, 0xbe, 0xd0, 0xbb, 0xd0, 0xa1, 0xd1, 0x80, 0xd0, 0xbf, 0xd1, 0x81,
- 0xd0, 0xba, 0xd0, 0xb8, 0xd1, 0x81, 0xd1, 0x80, 0xd0, 0xbf, 0xd1, 0x81, 0xd0,
- 0xba, 0xd0, 0xb8, 0xd1, 0x81, 0xd1, 0x80, 0xd0, 0xbf, 0xd1, 0x81, 0xd0, 0xba,
- 0xd0, 0xbe, 0xd9, 0x84, 0xd8, 0xb9, 0xd8, 0xb1, 0xd8, 0xa8, 0xd9, 0x8a, 0xd8,
- 0xa9, 0xe6, 0xad, 0xa3, 0xe9, 0xab, 0x94, 0xe4, 0xb8, 0xad, 0xe6, 0x96, 0x87,
- 0xe7, 0xae, 0x80, 0xe4, 0xbd, 0x93, 0xe4, 0xb8, 0xad, 0xe6, 0x96, 0x87, 0xe7,
- 0xb9, 0x81, 0xe4, 0xbd, 0x93, 0xe4, 0xb8, 0xad, 0xe6, 0x96, 0x87, 0xe6, 0x9c,
- 0x89, 0xe9, 0x99, 0x90, 0xe5, 0x85, 0xac, 0xe5, 0x8f, 0xb8, 0xe4, 0xba, 0xba,
- 0xe6, 0xb0, 0x91, 0xe6, 0x94, 0xbf, 0xe5, 0xba, 0x9c, 0xe9, 0x98, 0xbf, 0xe9,
- 0x87, 0x8c, 0xe5, 0xb7, 0xb4, 0xe5, 0xb7, 0xb4, 0xe7, 0xa4, 0xbe, 0xe4, 0xbc,
- 0x9a, 0xe4, 0xb8, 0xbb, 0xe4, 0xb9, 0x89, 0xe6, 0x93, 0x8d, 0xe4, 0xbd, 0x9c,
- 0xe7, 0xb3, 0xbb, 0xe7, 0xbb, 0x9f, 0xe6, 0x94, 0xbf, 0xe7, 0xad, 0x96, 0xe6,
- 0xb3, 0x95, 0xe8, 0xa7, 0x84, 0x69, 0x6e, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x63,
- 0x69, 0xc3, 0xb3, 0x6e, 0x68, 0x65, 0x72, 0x72, 0x61, 0x6d, 0x69, 0x65, 0x6e,
- 0x74, 0x61, 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x72, 0xc3, 0xb3, 0x6e, 0x69,
- 0x63, 0x6f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x63, 0x69, 0xc3, 0xb3,
- 0x6e, 0x63, 0x6c, 0x61, 0x73, 0x69, 0x66, 0x69, 0x63, 0x61, 0x64, 0x6f, 0x73,
- 0x63, 0x6f, 0x6e, 0x6f, 0x63, 0x69, 0x6d, 0x69, 0x65, 0x6e, 0x74, 0x6f, 0x70,
- 0x75, 0x62, 0x6c, 0x69, 0x63, 0x61, 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x72, 0x65,
- 0x6c, 0x61, 0x63, 0x69, 0x6f, 0x6e, 0x61, 0x64, 0x61, 0x73, 0x69, 0x6e, 0x66,
- 0x6f, 0x72, 0x6d, 0xc3, 0xa1, 0x74, 0x69, 0x63, 0x61, 0x72, 0x65, 0x6c, 0x61,
- 0x63, 0x69, 0x6f, 0x6e, 0x61, 0x64, 0x6f, 0x73, 0x64, 0x65, 0x70, 0x61, 0x72,
- 0x74, 0x61, 0x6d, 0x65, 0x6e, 0x74, 0x6f, 0x74, 0x72, 0x61, 0x62, 0x61, 0x6a,
- 0x61, 0x64, 0x6f, 0x72, 0x65, 0x73, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x61,
- 0x6d, 0x65, 0x6e, 0x74, 0x65, 0x61, 0x79, 0x75, 0x6e, 0x74, 0x61, 0x6d, 0x69,
- 0x65, 0x6e, 0x74, 0x6f, 0x6d, 0x65, 0x72, 0x63, 0x61, 0x64, 0x6f, 0x4c, 0x69,
- 0x62, 0x72, 0x65, 0x63, 0x6f, 0x6e, 0x74, 0xc3, 0xa1, 0x63, 0x74, 0x65, 0x6e,
- 0x6f, 0x73, 0x68, 0x61, 0x62, 0x69, 0x74, 0x61, 0x63, 0x69, 0x6f, 0x6e, 0x65,
- 0x73, 0x63, 0x75, 0x6d, 0x70, 0x6c, 0x69, 0x6d, 0x69, 0x65, 0x6e, 0x74, 0x6f,
- 0x72, 0x65, 0x73, 0x74, 0x61, 0x75, 0x72, 0x61, 0x6e, 0x74, 0x65, 0x73, 0x64,
- 0x69, 0x73, 0x70, 0x6f, 0x73, 0x69, 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x63, 0x6f,
- 0x6e, 0x73, 0x65, 0x63, 0x75, 0x65, 0x6e, 0x63, 0x69, 0x61, 0x65, 0x6c, 0x65,
- 0x63, 0x74, 0x72, 0xc3, 0xb3, 0x6e, 0x69, 0x63, 0x61, 0x61, 0x70, 0x6c, 0x69,
- 0x63, 0x61, 0x63, 0x69, 0x6f, 0x6e, 0x65, 0x73, 0x64, 0x65, 0x73, 0x63, 0x6f,
- 0x6e, 0x65, 0x63, 0x74, 0x61, 0x64, 0x6f, 0x69, 0x6e, 0x73, 0x74, 0x61, 0x6c,
- 0x61, 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x72, 0x65, 0x61, 0x6c, 0x69, 0x7a, 0x61,
- 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x75, 0x74, 0x69, 0x6c, 0x69, 0x7a, 0x61, 0x63,
- 0x69, 0xc3, 0xb3, 0x6e, 0x65, 0x6e, 0x63, 0x69, 0x63, 0x6c, 0x6f, 0x70, 0x65,
- 0x64, 0x69, 0x61, 0x65, 0x6e, 0x66, 0x65, 0x72, 0x6d, 0x65, 0x64, 0x61, 0x64,
- 0x65, 0x73, 0x69, 0x6e, 0x73, 0x74, 0x72, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x6f,
- 0x73, 0x65, 0x78, 0x70, 0x65, 0x72, 0x69, 0x65, 0x6e, 0x63, 0x69, 0x61, 0x73,
- 0x69, 0x6e, 0x73, 0x74, 0x69, 0x74, 0x75, 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x70,
- 0x61, 0x72, 0x74, 0x69, 0x63, 0x75, 0x6c, 0x61, 0x72, 0x65, 0x73, 0x73, 0x75,
- 0x62, 0x63, 0x61, 0x74, 0x65, 0x67, 0x6f, 0x72, 0x69, 0x61, 0xd1, 0x82, 0xd0,
- 0xbe, 0xd0, 0xbb, 0xd1, 0x8c, 0xd0, 0xba, 0xd0, 0xbe, 0xd0, 0xa0, 0xd0, 0xbe,
- 0xd1, 0x81, 0xd1, 0x81, 0xd0, 0xb8, 0xd0, 0xb8, 0xd1, 0x80, 0xd0, 0xb0, 0xd0,
- 0xb1, 0xd0, 0xbe, 0xd1, 0x82, 0xd1, 0x8b, 0xd0, 0xb1, 0xd0, 0xbe, 0xd0, 0xbb,
- 0xd1, 0x8c, 0xd1, 0x88, 0xd0, 0xb5, 0xd0, 0xbf, 0xd1, 0x80, 0xd0, 0xbe, 0xd1,
- 0x81, 0xd1, 0x82, 0xd0, 0xbe, 0xd0, 0xbc, 0xd0, 0xbe, 0xd0, 0xb6, 0xd0, 0xb5,
- 0xd1, 0x82, 0xd0, 0xb5, 0xd0, 0xb4, 0xd1, 0x80, 0xd1, 0x83, 0xd0, 0xb3, 0xd0,
- 0xb8, 0xd1, 0x85, 0xd1, 0x81, 0xd0, 0xbb, 0xd1, 0x83, 0xd1, 0x87, 0xd0, 0xb0,
- 0xd0, 0xb5, 0xd1, 0x81, 0xd0, 0xb5, 0xd0, 0xb9, 0xd1, 0x87, 0xd0, 0xb0, 0xd1,
- 0x81, 0xd0, 0xb2, 0xd1, 0x81, 0xd0, 0xb5, 0xd0, 0xb3, 0xd0, 0xb4, 0xd0, 0xb0,
- 0xd0, 0xa0, 0xd0, 0xbe, 0xd1, 0x81, 0xd1, 0x81, 0xd0, 0xb8, 0xd1, 0x8f, 0xd0,
- 0x9c, 0xd0, 0xbe, 0xd1, 0x81, 0xd0, 0xba, 0xd0, 0xb2, 0xd0, 0xb5, 0xd0, 0xb4,
- 0xd1, 0x80, 0xd1, 0x83, 0xd0, 0xb3, 0xd0, 0xb8, 0xd0, 0xb5, 0xd0, 0xb3, 0xd0,
- 0xbe, 0xd1, 0x80, 0xd0, 0xbe, 0xd0, 0xb4, 0xd0, 0xb0, 0xd0, 0xb2, 0xd0, 0xbe,
- 0xd0, 0xbf, 0xd1, 0x80, 0xd0, 0xbe, 0xd1, 0x81, 0xd0, 0xb4, 0xd0, 0xb0, 0xd0,
- 0xbd, 0xd0, 0xbd, 0xd1, 0x8b, 0xd1, 0x85, 0xd0, 0xb4, 0xd0, 0xbe, 0xd0, 0xbb,
- 0xd0, 0xb6, 0xd0, 0xbd, 0xd1, 0x8b, 0xd0, 0xb8, 0xd0, 0xbc, 0xd0, 0xb5, 0xd0,
- 0xbd, 0xd0, 0xbd, 0xd0, 0xbe, 0xd0, 0x9c, 0xd0, 0xbe, 0xd1, 0x81, 0xd0, 0xba,
- 0xd0, 0xb2, 0xd1, 0x8b, 0xd1, 0x80, 0xd1, 0x83, 0xd0, 0xb1, 0xd0, 0xbb, 0xd0,
- 0xb5, 0xd0, 0xb9, 0xd0, 0x9c, 0xd0, 0xbe, 0xd1, 0x81, 0xd0, 0xba, 0xd0, 0xb2,
- 0xd0, 0xb0, 0xd1, 0x81, 0xd1, 0x82, 0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xbd, 0xd1,
- 0x8b, 0xd0, 0xbd, 0xd0, 0xb8, 0xd1, 0x87, 0xd0, 0xb5, 0xd0, 0xb3, 0xd0, 0xbe,
- 0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xb1, 0xd0, 0xbe, 0xd1, 0x82, 0xd0, 0xb5, 0xd0,
- 0xb4, 0xd0, 0xbe, 0xd0, 0xbb, 0xd0, 0xb6, 0xd0, 0xb5, 0xd0, 0xbd, 0xd1, 0x83,
- 0xd1, 0x81, 0xd0, 0xbb, 0xd1, 0x83, 0xd0, 0xb3, 0xd0, 0xb8, 0xd1, 0x82, 0xd0,
- 0xb5, 0xd0, 0xbf, 0xd0, 0xb5, 0xd1, 0x80, 0xd1, 0x8c, 0xd0, 0x9e, 0xd0, 0xb4,
- 0xd0, 0xbd, 0xd0, 0xb0, 0xd0, 0xba, 0xd0, 0xbe, 0xd0, 0xbf, 0xd0, 0xbe, 0xd1,
- 0x82, 0xd0, 0xbe, 0xd0, 0xbc, 0xd1, 0x83, 0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xb1,
- 0xd0, 0xbe, 0xd1, 0x82, 0xd1, 0x83, 0xd0, 0xb0, 0xd0, 0xbf, 0xd1, 0x80, 0xd0,
- 0xb5, 0xd0, 0xbb, 0xd1, 0x8f, 0xd0, 0xb2, 0xd0, 0xbe, 0xd0, 0xbe, 0xd0, 0xb1,
- 0xd1, 0x89, 0xd0, 0xb5, 0xd0, 0xbe, 0xd0, 0xb4, 0xd0, 0xbd, 0xd0, 0xbe, 0xd0,
- 0xb3, 0xd0, 0xbe, 0xd1, 0x81, 0xd0, 0xb2, 0xd0, 0xbe, 0xd0, 0xb5, 0xd0, 0xb3,
- 0xd0, 0xbe, 0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xb0, 0xd1, 0x82, 0xd1, 0x8c, 0xd0,
- 0xb8, 0xd0, 0xb4, 0xd1, 0x80, 0xd1, 0x83, 0xd0, 0xb3, 0xd0, 0xbe, 0xd0, 0xb9,
- 0xd1, 0x84, 0xd0, 0xbe, 0xd1, 0x80, 0xd1, 0x83, 0xd0, 0xbc, 0xd0, 0xb5, 0xd1,
- 0x85, 0xd0, 0xbe, 0xd1, 0x80, 0xd0, 0xbe, 0xd1, 0x88, 0xd0, 0xbe, 0xd0, 0xbf,
- 0xd1, 0x80, 0xd0, 0xbe, 0xd1, 0x82, 0xd0, 0xb8, 0xd0, 0xb2, 0xd1, 0x81, 0xd1,
- 0x81, 0xd1, 0x8b, 0xd0, 0xbb, 0xd0, 0xba, 0xd0, 0xb0, 0xd0, 0xba, 0xd0, 0xb0,
- 0xd0, 0xb6, 0xd0, 0xb4, 0xd1, 0x8b, 0xd0, 0xb9, 0xd0, 0xb2, 0xd0, 0xbb, 0xd0,
- 0xb0, 0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xb8, 0xd0, 0xb3, 0xd1, 0x80, 0xd1, 0x83,
- 0xd0, 0xbf, 0xd0, 0xbf, 0xd1, 0x8b, 0xd0, 0xb2, 0xd0, 0xbc, 0xd0, 0xb5, 0xd1,
- 0x81, 0xd1, 0x82, 0xd0, 0xb5, 0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xb1, 0xd0, 0xbe,
- 0xd1, 0x82, 0xd0, 0xb0, 0xd1, 0x81, 0xd0, 0xba, 0xd0, 0xb0, 0xd0, 0xb7, 0xd0,
- 0xb0, 0xd0, 0xbb, 0xd0, 0xbf, 0xd0, 0xb5, 0xd1, 0x80, 0xd0, 0xb2, 0xd1, 0x8b,
- 0xd0, 0xb9, 0xd0, 0xb4, 0xd0, 0xb5, 0xd0, 0xbb, 0xd0, 0xb0, 0xd1, 0x82, 0xd1,
- 0x8c, 0xd0, 0xb4, 0xd0, 0xb5, 0xd0, 0xbd, 0xd1, 0x8c, 0xd0, 0xb3, 0xd0, 0xb8,
- 0xd0, 0xbf, 0xd0, 0xb5, 0xd1, 0x80, 0xd0, 0xb8, 0xd0, 0xbe, 0xd0, 0xb4, 0xd0,
- 0xb1, 0xd0, 0xb8, 0xd0, 0xb7, 0xd0, 0xbd, 0xd0, 0xb5, 0xd1, 0x81, 0xd0, 0xbe,
- 0xd1, 0x81, 0xd0, 0xbd, 0xd0, 0xbe, 0xd0, 0xb2, 0xd0, 0xb5, 0xd0, 0xbc, 0xd0,
- 0xbe, 0xd0, 0xbc, 0xd0, 0xb5, 0xd0, 0xbd, 0xd1, 0x82, 0xd0, 0xba, 0xd1, 0x83,
- 0xd0, 0xbf, 0xd0, 0xb8, 0xd1, 0x82, 0xd1, 0x8c, 0xd0, 0xb4, 0xd0, 0xbe, 0xd0,
- 0xbb, 0xd0, 0xb6, 0xd0, 0xbd, 0xd0, 0xb0, 0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xbc,
- 0xd0, 0xba, 0xd0, 0xb0, 0xd1, 0x85, 0xd0, 0xbd, 0xd0, 0xb0, 0xd1, 0x87, 0xd0,
- 0xb0, 0xd0, 0xbb, 0xd0, 0xbe, 0xd0, 0xa0, 0xd0, 0xb0, 0xd0, 0xb1, 0xd0, 0xbe,
- 0xd1, 0x82, 0xd0, 0xb0, 0xd0, 0xa2, 0xd0, 0xbe, 0xd0, 0xbb, 0xd1, 0x8c, 0xd0,
- 0xba, 0xd0, 0xbe, 0xd1, 0x81, 0xd0, 0xbe, 0xd0, 0xb2, 0xd1, 0x81, 0xd0, 0xb5,
- 0xd0, 0xbc, 0xd0, 0xb2, 0xd1, 0x82, 0xd0, 0xbe, 0xd1, 0x80, 0xd0, 0xbe, 0xd0,
- 0xb9, 0xd0, 0xbd, 0xd0, 0xb0, 0xd1, 0x87, 0xd0, 0xb0, 0xd0, 0xbb, 0xd0, 0xb0,
- 0xd1, 0x81, 0xd0, 0xbf, 0xd0, 0xb8, 0xd1, 0x81, 0xd0, 0xbe, 0xd0, 0xba, 0xd1,
- 0x81, 0xd0, 0xbb, 0xd1, 0x83, 0xd0, 0xb6, 0xd0, 0xb1, 0xd1, 0x8b, 0xd1, 0x81,
- 0xd0, 0xb8, 0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xb5, 0xd0, 0xbc, 0xd0, 0xbf, 0xd0,
- 0xb5, 0xd1, 0x87, 0xd0, 0xb0, 0xd1, 0x82, 0xd0, 0xb8, 0xd0, 0xbd, 0xd0, 0xbe,
- 0xd0, 0xb2, 0xd0, 0xbe, 0xd0, 0xb3, 0xd0, 0xbe, 0xd0, 0xbf, 0xd0, 0xbe, 0xd0,
- 0xbc, 0xd0, 0xbe, 0xd1, 0x89, 0xd0, 0xb8, 0xd1, 0x81, 0xd0, 0xb0, 0xd0, 0xb9,
- 0xd1, 0x82, 0xd0, 0xbe, 0xd0, 0xb2, 0xd0, 0xbf, 0xd0, 0xbe, 0xd1, 0x87, 0xd0,
- 0xb5, 0xd0, 0xbc, 0xd1, 0x83, 0xd0, 0xbf, 0xd0, 0xbe, 0xd0, 0xbc, 0xd0, 0xbe,
- 0xd1, 0x89, 0xd1, 0x8c, 0xd0, 0xb4, 0xd0, 0xbe, 0xd0, 0xbb, 0xd0, 0xb6, 0xd0,
- 0xbd, 0xd0, 0xbe, 0xd1, 0x81, 0xd1, 0x81, 0xd1, 0x8b, 0xd0, 0xbb, 0xd0, 0xba,
- 0xd0, 0xb8, 0xd0, 0xb1, 0xd1, 0x8b, 0xd1, 0x81, 0xd1, 0x82, 0xd1, 0x80, 0xd0,
- 0xbe, 0xd0, 0xb4, 0xd0, 0xb0, 0xd0, 0xbd, 0xd0, 0xbd, 0xd1, 0x8b, 0xd0, 0xb5,
- 0xd0, 0xbc, 0xd0, 0xbd, 0xd0, 0xbe, 0xd0, 0xb3, 0xd0, 0xb8, 0xd0, 0xb5, 0xd0,
- 0xbf, 0xd1, 0x80, 0xd0, 0xbe, 0xd0, 0xb5, 0xd0, 0xba, 0xd1, 0x82, 0xd0, 0xa1,
- 0xd0, 0xb5, 0xd0, 0xb9, 0xd1, 0x87, 0xd0, 0xb0, 0xd1, 0x81, 0xd0, 0xbc, 0xd0,
- 0xbe, 0xd0, 0xb4, 0xd0, 0xb5, 0xd0, 0xbb, 0xd0, 0xb8, 0xd1, 0x82, 0xd0, 0xb0,
- 0xd0, 0xba, 0xd0, 0xbe, 0xd0, 0xb3, 0xd0, 0xbe, 0xd0, 0xbe, 0xd0, 0xbd, 0xd0,
- 0xbb, 0xd0, 0xb0, 0xd0, 0xb9, 0xd0, 0xbd, 0xd0, 0xb3, 0xd0, 0xbe, 0xd1, 0x80,
- 0xd0, 0xbe, 0xd0, 0xb4, 0xd0, 0xb5, 0xd0, 0xb2, 0xd0, 0xb5, 0xd1, 0x80, 0xd1,
- 0x81, 0xd0, 0xb8, 0xd1, 0x8f, 0xd1, 0x81, 0xd1, 0x82, 0xd1, 0x80, 0xd0, 0xb0,
- 0xd0, 0xbd, 0xd0, 0xb5, 0xd1, 0x84, 0xd0, 0xb8, 0xd0, 0xbb, 0xd1, 0x8c, 0xd0,
- 0xbc, 0xd1, 0x8b, 0xd1, 0x83, 0xd1, 0x80, 0xd0, 0xbe, 0xd0, 0xb2, 0xd0, 0xbd,
- 0xd1, 0x8f, 0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xb7, 0xd0, 0xbd, 0xd1, 0x8b, 0xd1,
- 0x85, 0xd0, 0xb8, 0xd1, 0x81, 0xd0, 0xba, 0xd0, 0xb0, 0xd1, 0x82, 0xd1, 0x8c,
- 0xd0, 0xbd, 0xd0, 0xb5, 0xd0, 0xb4, 0xd0, 0xb5, 0xd0, 0xbb, 0xd1, 0x8e, 0xd1,
- 0x8f, 0xd0, 0xbd, 0xd0, 0xb2, 0xd0, 0xb0, 0xd1, 0x80, 0xd1, 0x8f, 0xd0, 0xbc,
- 0xd0, 0xb5, 0xd0, 0xbd, 0xd1, 0x8c, 0xd1, 0x88, 0xd0, 0xb5, 0xd0, 0xbc, 0xd0,
- 0xbd, 0xd0, 0xbe, 0xd0, 0xb3, 0xd0, 0xb8, 0xd1, 0x85, 0xd0, 0xb4, 0xd0, 0xb0,
- 0xd0, 0xbd, 0xd0, 0xbd, 0xd0, 0xbe, 0xd0, 0xb9, 0xd0, 0xb7, 0xd0, 0xbd, 0xd0,
- 0xb0, 0xd1, 0x87, 0xd0, 0xb8, 0xd1, 0x82, 0xd0, 0xbd, 0xd0, 0xb5, 0xd0, 0xbb,
- 0xd1, 0x8c, 0xd0, 0xb7, 0xd1, 0x8f, 0xd1, 0x84, 0xd0, 0xbe, 0xd1, 0x80, 0xd1,
- 0x83, 0xd0, 0xbc, 0xd0, 0xb0, 0xd0, 0xa2, 0xd0, 0xb5, 0xd0, 0xbf, 0xd0, 0xb5,
- 0xd1, 0x80, 0xd1, 0x8c, 0xd0, 0xbc, 0xd0, 0xb5, 0xd1, 0x81, 0xd1, 0x8f, 0xd1,
- 0x86, 0xd0, 0xb0, 0xd0, 0xb7, 0xd0, 0xb0, 0xd1, 0x89, 0xd0, 0xb8, 0xd1, 0x82,
- 0xd1, 0x8b, 0xd0, 0x9b, 0xd1, 0x83, 0xd1, 0x87, 0xd1, 0x88, 0xd0, 0xb8, 0xd0,
- 0xb5, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0x82,
- 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x87, 0xe0,
- 0xa4, 0x85, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x87, 0xe0, 0xa4,
- 0x95, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x95,
- 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0x85, 0xe0,
- 0xa4, 0xa8, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0x95, 0xe0, 0xa5,
- 0x8d, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0xbe,
- 0xe0, 0xa4, 0x87, 0xe0, 0xa4, 0xa1, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xbe, 0xe0,
- 0xa4, 0xb0, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4,
- 0xb8, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xa6, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xaf,
- 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xb2, 0xe0,
- 0xa5, 0x87, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0x82, 0xe0, 0xa4,
- 0xb9, 0xe0, 0xa4, 0xad, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xa4,
- 0xe0, 0xa4, 0x85, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x80, 0xe0,
- 0xa4, 0xb5, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x87, 0xe0, 0xa4,
- 0xb8, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x95,
- 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xae, 0xe0,
- 0xa5, 0x87, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb9, 0xe0, 0xa5,
- 0x8b, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0x95,
- 0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xb9, 0xe0,
- 0xa5, 0x81, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4,
- 0x87, 0xe0, 0xa4, 0x9f, 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x97,
- 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa8, 0xe0,
- 0xa5, 0x87, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4,
- 0x9f, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xbe,
- 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xbe, 0xe0,
- 0xa4, 0x89, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x87, 0xe0, 0xa4,
- 0xaf, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x81, 0xe0, 0xa4, 0xb8,
- 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xb8, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xad, 0xe0,
- 0xa4, 0xbe, 0xe0, 0xa4, 0xb7, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x86, 0xe0, 0xa4,
- 0xaa, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xbf,
- 0xe0, 0xa4, 0xaf, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb6, 0xe0, 0xa5, 0x81, 0xe0,
- 0xa4, 0xb0, 0xe0, 0xa5, 0x82, 0xe0, 0xa4, 0x87, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4,
- 0x95, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x98, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0x9f,
- 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xae, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb0, 0xe0,
- 0xa5, 0x80, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4,
- 0xbe, 0xe0, 0xa4, 0xae, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xbe,
- 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xb0, 0xe0,
- 0xa4, 0x85, 0xe0, 0xa4, 0xa7, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0x95, 0xe0, 0xa4,
- 0x85, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb8,
- 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xae, 0xe0,
- 0xa5, 0x81, 0xe0, 0xa4, 0x9d, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x95, 0xe0, 0xa4,
- 0xbe, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xa3, 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x8b,
- 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xa1, 0xe0,
- 0xa4, 0xbc, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4,
- 0xbe, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x9f,
- 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xb6, 0xe0, 0xa4, 0xac, 0xe0, 0xa5, 0x8d, 0xe0,
- 0xa4, 0xa6, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4,
- 0xbe, 0xe0, 0xa4, 0x9c, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xa8,
- 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xbe, 0xe0,
- 0xa4, 0x95, 0xe0, 0xa5, 0x88, 0xe0, 0xa4, 0xb8, 0xe0, 0xa5, 0x87, 0xe0, 0xa4,
- 0x86, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb5,
- 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xa6, 0xe0,
- 0xa5, 0x87, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xaa, 0xe0, 0xa5,
- 0x82, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xbe,
- 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0x89, 0xe0, 0xa4, 0xb8, 0xe0,
- 0xa4, 0x95, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4,
- 0x97, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xac, 0xe0, 0xa5, 0x88, 0xe0, 0xa4, 0xa0,
- 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0x86, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0x95, 0xe0,
- 0xa5, 0x80, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4,
- 0xb7, 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xb5,
- 0xe0, 0xa4, 0x86, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x8b, 0xe0,
- 0xa4, 0x9c, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4,
- 0x9c, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb8,
- 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xb9, 0xe0,
- 0xa4, 0xae, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0x89, 0xe0, 0xa4,
- 0xa8, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xbe,
- 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x82, 0xe0, 0xa4, 0xa6, 0xe0, 0xa4, 0xb0, 0xe0,
- 0xa5, 0x8d, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xb8, 0xe0, 0xa5, 0x82, 0xe0, 0xa4,
- 0x9a, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0x82,
- 0xe0, 0xa4, 0xa6, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xbe, 0xe0,
- 0xa4, 0xb2, 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4,
- 0xbe, 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x80,
- 0xe0, 0xa4, 0x9c, 0xe0, 0xa5, 0x88, 0xe0, 0xa4, 0xb8, 0xe0, 0xa5, 0x87, 0xe0,
- 0xa4, 0xb5, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4,
- 0x9c, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa8,
- 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x9c, 0xe0,
- 0xa4, 0xbe, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0x98, 0xe0, 0xa4,
- 0xbe, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xbf,
- 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x80, 0xe0,
- 0xa4, 0x9a, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4,
- 0x82, 0xe0, 0xa4, 0x9a, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x8d,
- 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0x97, 0xe0, 0xa5, 0x82, 0xe0, 0xa4, 0x97, 0xe0,
- 0xa4, 0xb2, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa4, 0xe0, 0xa5,
- 0x87, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xb0,
- 0xe0, 0xa4, 0x86, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x87, 0xe0,
- 0xa4, 0xb5, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4,
- 0x87, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb8,
- 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xb0, 0xe0,
- 0xa4, 0xb9, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x87, 0xe0, 0xa4,
- 0xb8, 0xe0, 0xa4, 0xb8, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xb9,
- 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xa1, 0xe0,
- 0xa4, 0xbc, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x98, 0xe0, 0xa4, 0x9f, 0xe0, 0xa4,
- 0xa8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xbe,
- 0xe0, 0xa4, 0xb6, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x82, 0xe0,
- 0xa4, 0x9a, 0xe0, 0xa4, 0xb6, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5,
- 0x80, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xa1, 0xe0, 0xa4, 0xbc, 0xe0, 0xa5, 0x80,
- 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x87, 0xe0,
- 0xa4, 0xb8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x88, 0xe0, 0xa4, 0x9f, 0xe0, 0xa4,
- 0xb6, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xa6, 0xe0, 0xa4, 0xb8,
- 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0x9c, 0xe0,
- 0xa4, 0xbe, 0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4,
- 0xbe, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0x9c,
- 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0x9f, 0xe0,
- 0xa4, 0xa8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0x96, 0xe0, 0xa4,
- 0xa8, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xa1, 0xe0, 0xa4, 0xbc,
- 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xb2, 0xe0,
- 0xa4, 0xbe, 0xe0, 0xa4, 0x89, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0x95, 0xe0, 0xa5,
- 0x80, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xb2,
- 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xbe, 0xe0,
- 0xa4, 0x96, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4,
- 0x85, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xa5, 0xe0, 0xa4, 0x9c,
- 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xa6, 0xe0,
- 0xa5, 0x87, 0xe0, 0xa4, 0x96, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4,
- 0xb9, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xbf,
- 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xbf, 0xe0,
- 0xa4, 0xa8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xac, 0xe0, 0xa5, 0x88, 0xe0, 0xa4,
- 0x82, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x80,
- 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xa8, 0xe0,
- 0xa4, 0xbe, 0xe0, 0xa4, 0xa6, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4,
- 0xbe, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x87,
- 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xab, 0xe0, 0xa5, 0x80, 0xe0,
- 0xa4, 0x9c, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4,
- 0xa4, 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xae,
- 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0xb5, 0xe0,
- 0xa4, 0xb9, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5,
- 0x8b, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xbc, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xbf,
- 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0x86, 0xe0, 0xa4, 0xb0, 0xe0,
- 0xa5, 0x8b, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xb8, 0xe0, 0xa5, 0x87, 0xe0, 0xa4,
- 0xa8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa6,
- 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xa8, 0xe0,
- 0xa5, 0x87, 0xe0, 0xa4, 0x96, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4,
- 0xbe, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xac,
- 0xe0, 0xa4, 0x89, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xbe, 0xe0,
- 0xa4, 0x9c, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xac, 0xe0, 0xa4,
- 0xaa, 0xe0, 0xa5, 0x82, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xac,
- 0xe0, 0xa4, 0xa1, 0xe0, 0xa4, 0xbc, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb8, 0xe0,
- 0xa5, 0x8c, 0xe0, 0xa4, 0xa6, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb6, 0xe0, 0xa5,
- 0x87, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xbf,
- 0xe0, 0xa4, 0xaf, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xb9, 0xe0,
- 0xa4, 0xbe, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0x85, 0xe0, 0xa4, 0x95, 0xe0, 0xa4,
- 0xb8, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xbe,
- 0xe0, 0xa4, 0x8f, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xbe, 0xe0,
- 0xa4, 0x82, 0xe0, 0xa4, 0xb8, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xa5, 0xe0, 0xa4,
- 0xb2, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x87,
- 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x96, 0xe0, 0xa4, 0x95, 0xe0,
- 0xa4, 0xb5, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xb7, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4,
- 0x95, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xb8,
- 0xe0, 0xa4, 0xae, 0xe0, 0xa5, 0x82, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xa5, 0xe0,
- 0xa4, 0xbe, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xbe, 0xd8, 0xaa, 0xd8, 0xb3, 0xd8,
- 0xaa, 0xd8, 0xb7, 0xd9, 0x8a, 0xd8, 0xb9, 0xd9, 0x85, 0xd8, 0xb4, 0xd8, 0xa7,
- 0xd8, 0xb1, 0xd9, 0x83, 0xd8, 0xa9, 0xd8, 0xa8, 0xd9, 0x88, 0xd8, 0xa7, 0xd8,
- 0xb3, 0xd8, 0xb7, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb5, 0xd9, 0x81,
- 0xd8, 0xad, 0xd8, 0xa9, 0xd9, 0x85, 0xd9, 0x88, 0xd8, 0xa7, 0xd8, 0xb6, 0xd9,
- 0x8a, 0xd8, 0xb9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xae, 0xd8, 0xa7, 0xd8, 0xb5,
- 0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x85, 0xd8, 0xb2, 0xd9, 0x8a, 0xd8,
- 0xaf, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb9, 0xd8, 0xa7, 0xd9, 0x85, 0xd8, 0xa9,
- 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x83, 0xd8, 0xa7, 0xd8, 0xaa, 0xd8, 0xa8, 0xd8,
- 0xa7, 0xd9, 0x84, 0xd8, 0xb1, 0xd8, 0xaf, 0xd9, 0x88, 0xd8, 0xaf, 0xd8, 0xa8,
- 0xd8, 0xb1, 0xd9, 0x86, 0xd8, 0xa7, 0xd9, 0x85, 0xd8, 0xac, 0xd8, 0xa7, 0xd9,
- 0x84, 0xd8, 0xaf, 0xd9, 0x88, 0xd9, 0x84, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84,
- 0xd8, 0xb9, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x85, 0xd8, 0xa7, 0xd9, 0x84, 0xd9,
- 0x85, 0xd9, 0x88, 0xd9, 0x82, 0xd8, 0xb9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb9,
- 0xd8, 0xb1, 0xd8, 0xa8, 0xd9, 0x8a, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb3, 0xd8,
- 0xb1, 0xd9, 0x8a, 0xd8, 0xb9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xac, 0xd9, 0x88,
- 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb0, 0xd9, 0x87, 0xd8,
- 0xa7, 0xd8, 0xa8, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xad, 0xd9, 0x8a, 0xd8, 0xa7,
- 0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xad, 0xd9, 0x82, 0xd9, 0x88, 0xd9,
- 0x82, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x83, 0xd8, 0xb1, 0xd9, 0x8a, 0xd9, 0x85,
- 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb9, 0xd8, 0xb1, 0xd8, 0xa7, 0xd9, 0x82, 0xd9,
- 0x85, 0xd8, 0xad, 0xd9, 0x81, 0xd9, 0x88, 0xd8, 0xb8, 0xd8, 0xa9, 0xd8, 0xa7,
- 0xd9, 0x84, 0xd8, 0xab, 0xd8, 0xa7, 0xd9, 0x86, 0xd9, 0x8a, 0xd9, 0x85, 0xd8,
- 0xb4, 0xd8, 0xa7, 0xd9, 0x87, 0xd8, 0xaf, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84,
- 0xd9, 0x85, 0xd8, 0xb1, 0xd8, 0xa3, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84, 0xd9,
- 0x82, 0xd8, 0xb1, 0xd8, 0xa2, 0xd9, 0x86, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb4,
- 0xd8, 0xa8, 0xd8, 0xa7, 0xd8, 0xa8, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xad, 0xd9,
- 0x88, 0xd8, 0xa7, 0xd8, 0xb1, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xac, 0xd8, 0xaf,
- 0xd9, 0x8a, 0xd8, 0xaf, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa3, 0xd8, 0xb3, 0xd8,
- 0xb1, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb9, 0xd9, 0x84, 0xd9, 0x88,
- 0xd9, 0x85, 0xd9, 0x85, 0xd8, 0xac, 0xd9, 0x85, 0xd9, 0x88, 0xd8, 0xb9, 0xd8,
- 0xa9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb1, 0xd8, 0xad, 0xd9, 0x85, 0xd9, 0x86,
- 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x86, 0xd9, 0x82, 0xd8, 0xa7, 0xd8, 0xb7, 0xd9,
- 0x81, 0xd9, 0x84, 0xd8, 0xb3, 0xd8, 0xb7, 0xd9, 0x8a, 0xd9, 0x86, 0xd8, 0xa7,
- 0xd9, 0x84, 0xd9, 0x83, 0xd9, 0x88, 0xd9, 0x8a, 0xd8, 0xaa, 0xd8, 0xa7, 0xd9,
- 0x84, 0xd8, 0xaf, 0xd9, 0x86, 0xd9, 0x8a, 0xd8, 0xa7, 0xd8, 0xa8, 0xd8, 0xb1,
- 0xd9, 0x83, 0xd8, 0xa7, 0xd8, 0xaa, 0xd9, 0x87, 0xd8, 0xa7, 0xd9, 0x84, 0xd8,
- 0xb1, 0xd9, 0x8a, 0xd8, 0xa7, 0xd8, 0xb6, 0xd8, 0xaa, 0xd8, 0xad, 0xd9, 0x8a,
- 0xd8, 0xa7, 0xd8, 0xaa, 0xd9, 0x8a, 0xd8, 0xa8, 0xd8, 0xaa, 0xd9, 0x88, 0xd9,
- 0x82, 0xd9, 0x8a, 0xd8, 0xaa, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa3, 0xd9, 0x88,
- 0xd9, 0x84, 0xd9, 0x89, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa8, 0xd8, 0xb1, 0xd9,
- 0x8a, 0xd8, 0xaf, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x83, 0xd9, 0x84, 0xd8, 0xa7,
- 0xd9, 0x85, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb1, 0xd8, 0xa7, 0xd8, 0xa8, 0xd8,
- 0xb7, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb4, 0xd8, 0xae, 0xd8, 0xb5, 0xd9, 0x8a,
- 0xd8, 0xb3, 0xd9, 0x8a, 0xd8, 0xa7, 0xd8, 0xb1, 0xd8, 0xa7, 0xd8, 0xaa, 0xd8,
- 0xa7, 0xd9, 0x84, 0xd8, 0xab, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xab, 0xd8, 0xa7,
- 0xd9, 0x84, 0xd8, 0xb5, 0xd9, 0x84, 0xd8, 0xa7, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9,
- 0x84, 0xd8, 0xad, 0xd8, 0xaf, 0xd9, 0x8a, 0xd8, 0xab, 0xd8, 0xa7, 0xd9, 0x84,
- 0xd8, 0xb2, 0xd9, 0x88, 0xd8, 0xa7, 0xd8, 0xb1, 0xd8, 0xa7, 0xd9, 0x84, 0xd8,
- 0xae, 0xd9, 0x84, 0xd9, 0x8a, 0xd8, 0xac, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xac,
- 0xd9, 0x85, 0xd9, 0x8a, 0xd8, 0xb9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb9, 0xd8,
- 0xa7, 0xd9, 0x85, 0xd9, 0x87, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xac, 0xd9, 0x85,
- 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb3, 0xd8, 0xa7, 0xd8,
- 0xb9, 0xd8, 0xa9, 0xd9, 0x85, 0xd8, 0xb4, 0xd8, 0xa7, 0xd9, 0x87, 0xd8, 0xaf,
- 0xd9, 0x87, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb1, 0xd8, 0xa6, 0xd9, 0x8a, 0xd8,
- 0xb3, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xaf, 0xd8, 0xae, 0xd9, 0x88, 0xd9, 0x84,
- 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x81, 0xd9, 0x86, 0xd9, 0x8a, 0xd8, 0xa9, 0xd8,
- 0xa7, 0xd9, 0x84, 0xd9, 0x83, 0xd8, 0xaa, 0xd8, 0xa7, 0xd8, 0xa8, 0xd8, 0xa7,
- 0xd9, 0x84, 0xd8, 0xaf, 0xd9, 0x88, 0xd8, 0xb1, 0xd9, 0x8a, 0xd8, 0xa7, 0xd9,
- 0x84, 0xd8, 0xaf, 0xd8, 0xb1, 0xd9, 0x88, 0xd8, 0xb3, 0xd8, 0xa7, 0xd8, 0xb3,
- 0xd8, 0xaa, 0xd8, 0xba, 0xd8, 0xb1, 0xd9, 0x82, 0xd8, 0xaa, 0xd8, 0xb5, 0xd8,
- 0xa7, 0xd9, 0x85, 0xd9, 0x8a, 0xd9, 0x85, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa8,
- 0xd9, 0x86, 0xd8, 0xa7, 0xd8, 0xaa, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb9, 0xd8,
- 0xb8, 0xd9, 0x8a, 0xd9, 0x85, 0x65, 0x6e, 0x74, 0x65, 0x72, 0x74, 0x61, 0x69,
- 0x6e, 0x6d, 0x65, 0x6e, 0x74, 0x75, 0x6e, 0x64, 0x65, 0x72, 0x73, 0x74, 0x61,
- 0x6e, 0x64, 0x69, 0x6e, 0x67, 0x20, 0x3d, 0x20, 0x66, 0x75, 0x6e, 0x63, 0x74,
- 0x69, 0x6f, 0x6e, 0x28, 0x29, 0x2e, 0x6a, 0x70, 0x67, 0x22, 0x20, 0x77, 0x69,
- 0x64, 0x74, 0x68, 0x3d, 0x22, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x75, 0x72,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x70, 0x6e, 0x67, 0x22, 0x20, 0x77, 0x69,
- 0x64, 0x74, 0x68, 0x3d, 0x22, 0x3c, 0x62, 0x6f, 0x64, 0x79, 0x20, 0x63, 0x6c,
- 0x61, 0x73, 0x73, 0x3d, 0x22, 0x4d, 0x61, 0x74, 0x68, 0x2e, 0x72, 0x61, 0x6e,
- 0x64, 0x6f, 0x6d, 0x28, 0x29, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6d, 0x70, 0x6f,
- 0x72, 0x61, 0x72, 0x79, 0x20, 0x55, 0x6e, 0x69, 0x74, 0x65, 0x64, 0x20, 0x53,
- 0x74, 0x61, 0x74, 0x65, 0x73, 0x63, 0x69, 0x72, 0x63, 0x75, 0x6d, 0x73, 0x74,
- 0x61, 0x6e, 0x63, 0x65, 0x73, 0x2e, 0x61, 0x70, 0x70, 0x65, 0x6e, 0x64, 0x43,
- 0x68, 0x69, 0x6c, 0x64, 0x28, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61,
- 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x3c, 0x73, 0x70, 0x61, 0x6e, 0x20, 0x63, 0x6c,
- 0x61, 0x73, 0x73, 0x3d, 0x22, 0x22, 0x3e, 0x3c, 0x69, 0x6d, 0x67, 0x20, 0x73,
- 0x72, 0x63, 0x3d, 0x22, 0x2f, 0x64, 0x69, 0x73, 0x74, 0x69, 0x6e, 0x67, 0x75,
- 0x69, 0x73, 0x68, 0x65, 0x64, 0x74, 0x68, 0x6f, 0x75, 0x73, 0x61, 0x6e, 0x64,
- 0x73, 0x20, 0x6f, 0x66, 0x20, 0x63, 0x6f, 0x6d, 0x6d, 0x75, 0x6e, 0x69, 0x63,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x63, 0x6c, 0x65, 0x61, 0x72, 0x22, 0x3e, 0x3c,
- 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x69, 0x6e, 0x76, 0x65, 0x73, 0x74, 0x69, 0x67,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x66, 0x61, 0x76, 0x69, 0x63, 0x6f, 0x6e, 0x2e,
- 0x69, 0x63, 0x6f, 0x22, 0x20, 0x6d, 0x61, 0x72, 0x67, 0x69, 0x6e, 0x2d, 0x72,
- 0x69, 0x67, 0x68, 0x74, 0x3a, 0x62, 0x61, 0x73, 0x65, 0x64, 0x20, 0x6f, 0x6e,
- 0x20, 0x74, 0x68, 0x65, 0x20, 0x4d, 0x61, 0x73, 0x73, 0x61, 0x63, 0x68, 0x75,
- 0x73, 0x65, 0x74, 0x74, 0x73, 0x74, 0x61, 0x62, 0x6c, 0x65, 0x20, 0x62, 0x6f,
- 0x72, 0x64, 0x65, 0x72, 0x3d, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x74,
- 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x61, 0x6c, 0x73, 0x6f, 0x20, 0x6b, 0x6e, 0x6f,
- 0x77, 0x6e, 0x20, 0x61, 0x73, 0x70, 0x72, 0x6f, 0x6e, 0x75, 0x6e, 0x63, 0x69,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x62, 0x61, 0x63, 0x6b, 0x67, 0x72, 0x6f, 0x75,
- 0x6e, 0x64, 0x3a, 0x23, 0x66, 0x70, 0x61, 0x64, 0x64, 0x69, 0x6e, 0x67, 0x2d,
- 0x6c, 0x65, 0x66, 0x74, 0x3a, 0x46, 0x6f, 0x72, 0x20, 0x65, 0x78, 0x61, 0x6d,
- 0x70, 0x6c, 0x65, 0x2c, 0x20, 0x6d, 0x69, 0x73, 0x63, 0x65, 0x6c, 0x6c, 0x61,
- 0x6e, 0x65, 0x6f, 0x75, 0x73, 0x26, 0x6c, 0x74, 0x3b, 0x2f, 0x6d, 0x61, 0x74,
- 0x68, 0x26, 0x67, 0x74, 0x3b, 0x70, 0x73, 0x79, 0x63, 0x68, 0x6f, 0x6c, 0x6f,
- 0x67, 0x69, 0x63, 0x61, 0x6c, 0x69, 0x6e, 0x20, 0x70, 0x61, 0x72, 0x74, 0x69,
- 0x63, 0x75, 0x6c, 0x61, 0x72, 0x65, 0x61, 0x72, 0x63, 0x68, 0x22, 0x20, 0x74,
- 0x79, 0x70, 0x65, 0x3d, 0x22, 0x66, 0x6f, 0x72, 0x6d, 0x20, 0x6d, 0x65, 0x74,
- 0x68, 0x6f, 0x64, 0x3d, 0x22, 0x61, 0x73, 0x20, 0x6f, 0x70, 0x70, 0x6f, 0x73,
- 0x65, 0x64, 0x20, 0x74, 0x6f, 0x53, 0x75, 0x70, 0x72, 0x65, 0x6d, 0x65, 0x20,
- 0x43, 0x6f, 0x75, 0x72, 0x74, 0x6f, 0x63, 0x63, 0x61, 0x73, 0x69, 0x6f, 0x6e,
- 0x61, 0x6c, 0x6c, 0x79, 0x20, 0x41, 0x64, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e,
- 0x61, 0x6c, 0x6c, 0x79, 0x2c, 0x4e, 0x6f, 0x72, 0x74, 0x68, 0x20, 0x41, 0x6d,
- 0x65, 0x72, 0x69, 0x63, 0x61, 0x70, 0x78, 0x3b, 0x62, 0x61, 0x63, 0x6b, 0x67,
- 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x6f, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x75, 0x6e,
- 0x69, 0x74, 0x69, 0x65, 0x73, 0x45, 0x6e, 0x74, 0x65, 0x72, 0x74, 0x61, 0x69,
- 0x6e, 0x6d, 0x65, 0x6e, 0x74, 0x2e, 0x74, 0x6f, 0x4c, 0x6f, 0x77, 0x65, 0x72,
- 0x43, 0x61, 0x73, 0x65, 0x28, 0x6d, 0x61, 0x6e, 0x75, 0x66, 0x61, 0x63, 0x74,
- 0x75, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x72, 0x6f, 0x66, 0x65, 0x73, 0x73, 0x69,
- 0x6f, 0x6e, 0x61, 0x6c, 0x20, 0x63, 0x6f, 0x6d, 0x62, 0x69, 0x6e, 0x65, 0x64,
- 0x20, 0x77, 0x69, 0x74, 0x68, 0x46, 0x6f, 0x72, 0x20, 0x69, 0x6e, 0x73, 0x74,
- 0x61, 0x6e, 0x63, 0x65, 0x2c, 0x63, 0x6f, 0x6e, 0x73, 0x69, 0x73, 0x74, 0x69,
- 0x6e, 0x67, 0x20, 0x6f, 0x66, 0x22, 0x20, 0x6d, 0x61, 0x78, 0x6c, 0x65, 0x6e,
- 0x67, 0x74, 0x68, 0x3d, 0x22, 0x72, 0x65, 0x74, 0x75, 0x72, 0x6e, 0x20, 0x66,
- 0x61, 0x6c, 0x73, 0x65, 0x3b, 0x63, 0x6f, 0x6e, 0x73, 0x63, 0x69, 0x6f, 0x75,
- 0x73, 0x6e, 0x65, 0x73, 0x73, 0x4d, 0x65, 0x64, 0x69, 0x74, 0x65, 0x72, 0x72,
- 0x61, 0x6e, 0x65, 0x61, 0x6e, 0x65, 0x78, 0x74, 0x72, 0x61, 0x6f, 0x72, 0x64,
- 0x69, 0x6e, 0x61, 0x72, 0x79, 0x61, 0x73, 0x73, 0x61, 0x73, 0x73, 0x69, 0x6e,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x75, 0x62, 0x73, 0x65, 0x71, 0x75, 0x65,
- 0x6e, 0x74, 0x6c, 0x79, 0x20, 0x62, 0x75, 0x74, 0x74, 0x6f, 0x6e, 0x20, 0x74,
- 0x79, 0x70, 0x65, 0x3d, 0x22, 0x74, 0x68, 0x65, 0x20, 0x6e, 0x75, 0x6d, 0x62,
- 0x65, 0x72, 0x20, 0x6f, 0x66, 0x74, 0x68, 0x65, 0x20, 0x6f, 0x72, 0x69, 0x67,
- 0x69, 0x6e, 0x61, 0x6c, 0x20, 0x63, 0x6f, 0x6d, 0x70, 0x72, 0x65, 0x68, 0x65,
- 0x6e, 0x73, 0x69, 0x76, 0x65, 0x72, 0x65, 0x66, 0x65, 0x72, 0x73, 0x20, 0x74,
- 0x6f, 0x20, 0x74, 0x68, 0x65, 0x3c, 0x2f, 0x75, 0x6c, 0x3e, 0x0a, 0x3c, 0x2f,
- 0x64, 0x69, 0x76, 0x3e, 0x0a, 0x70, 0x68, 0x69, 0x6c, 0x6f, 0x73, 0x6f, 0x70,
- 0x68, 0x69, 0x63, 0x61, 0x6c, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e,
- 0x2e, 0x68, 0x72, 0x65, 0x66, 0x77, 0x61, 0x73, 0x20, 0x70, 0x75, 0x62, 0x6c,
- 0x69, 0x73, 0x68, 0x65, 0x64, 0x53, 0x61, 0x6e, 0x20, 0x46, 0x72, 0x61, 0x6e,
- 0x63, 0x69, 0x73, 0x63, 0x6f, 0x28, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f,
- 0x6e, 0x28, 0x29, 0x7b, 0x0a, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x69, 0x64, 0x3d,
- 0x22, 0x6d, 0x61, 0x69, 0x6e, 0x73, 0x6f, 0x70, 0x68, 0x69, 0x73, 0x74, 0x69,
- 0x63, 0x61, 0x74, 0x65, 0x64, 0x6d, 0x61, 0x74, 0x68, 0x65, 0x6d, 0x61, 0x74,
- 0x69, 0x63, 0x61, 0x6c, 0x20, 0x2f, 0x68, 0x65, 0x61, 0x64, 0x3e, 0x0d, 0x0a,
- 0x3c, 0x62, 0x6f, 0x64, 0x79, 0x73, 0x75, 0x67, 0x67, 0x65, 0x73, 0x74, 0x73,
- 0x20, 0x74, 0x68, 0x61, 0x74, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x63, 0x6f, 0x6e, 0x63, 0x65, 0x6e, 0x74, 0x72,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x72, 0x65, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e,
- 0x73, 0x68, 0x69, 0x70, 0x73, 0x6d, 0x61, 0x79, 0x20, 0x68, 0x61, 0x76, 0x65,
- 0x20, 0x62, 0x65, 0x65, 0x6e, 0x28, 0x66, 0x6f, 0x72, 0x20, 0x65, 0x78, 0x61,
- 0x6d, 0x70, 0x6c, 0x65, 0x2c, 0x54, 0x68, 0x69, 0x73, 0x20, 0x61, 0x72, 0x74,
- 0x69, 0x63, 0x6c, 0x65, 0x20, 0x69, 0x6e, 0x20, 0x73, 0x6f, 0x6d, 0x65, 0x20,
- 0x63, 0x61, 0x73, 0x65, 0x73, 0x70, 0x61, 0x72, 0x74, 0x73, 0x20, 0x6f, 0x66,
- 0x20, 0x74, 0x68, 0x65, 0x20, 0x64, 0x65, 0x66, 0x69, 0x6e, 0x69, 0x74, 0x69,
- 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x47, 0x72, 0x65, 0x61, 0x74, 0x20, 0x42, 0x72,
- 0x69, 0x74, 0x61, 0x69, 0x6e, 0x20, 0x63, 0x65, 0x6c, 0x6c, 0x70, 0x61, 0x64,
- 0x64, 0x69, 0x6e, 0x67, 0x3d, 0x65, 0x71, 0x75, 0x69, 0x76, 0x61, 0x6c, 0x65,
- 0x6e, 0x74, 0x20, 0x74, 0x6f, 0x70, 0x6c, 0x61, 0x63, 0x65, 0x68, 0x6f, 0x6c,
- 0x64, 0x65, 0x72, 0x3d, 0x22, 0x3b, 0x20, 0x66, 0x6f, 0x6e, 0x74, 0x2d, 0x73,
- 0x69, 0x7a, 0x65, 0x3a, 0x20, 0x6a, 0x75, 0x73, 0x74, 0x69, 0x66, 0x69, 0x63,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x62, 0x65, 0x6c, 0x69, 0x65, 0x76, 0x65, 0x64,
- 0x20, 0x74, 0x68, 0x61, 0x74, 0x73, 0x75, 0x66, 0x66, 0x65, 0x72, 0x65, 0x64,
- 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x61, 0x74, 0x74, 0x65, 0x6d, 0x70, 0x74, 0x65,
- 0x64, 0x20, 0x74, 0x6f, 0x20, 0x6c, 0x65, 0x61, 0x64, 0x65, 0x72, 0x20, 0x6f,
- 0x66, 0x20, 0x74, 0x68, 0x65, 0x63, 0x72, 0x69, 0x70, 0x74, 0x22, 0x20, 0x73,
- 0x72, 0x63, 0x3d, 0x22, 0x2f, 0x28, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f,
- 0x6e, 0x28, 0x29, 0x20, 0x7b, 0x61, 0x72, 0x65, 0x20, 0x61, 0x76, 0x61, 0x69,
- 0x6c, 0x61, 0x62, 0x6c, 0x65, 0x0a, 0x09, 0x3c, 0x6c, 0x69, 0x6e, 0x6b, 0x20,
- 0x72, 0x65, 0x6c, 0x3d, 0x22, 0x20, 0x73, 0x72, 0x63, 0x3d, 0x27, 0x68, 0x74,
- 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x65, 0x73, 0x74,
- 0x65, 0x64, 0x20, 0x69, 0x6e, 0x63, 0x6f, 0x6e, 0x76, 0x65, 0x6e, 0x74, 0x69,
- 0x6f, 0x6e, 0x61, 0x6c, 0x20, 0x22, 0x20, 0x61, 0x6c, 0x74, 0x3d, 0x22, 0x22,
- 0x20, 0x2f, 0x3e, 0x3c, 0x2f, 0x61, 0x72, 0x65, 0x20, 0x67, 0x65, 0x6e, 0x65,
- 0x72, 0x61, 0x6c, 0x6c, 0x79, 0x68, 0x61, 0x73, 0x20, 0x61, 0x6c, 0x73, 0x6f,
- 0x20, 0x62, 0x65, 0x65, 0x6e, 0x6d, 0x6f, 0x73, 0x74, 0x20, 0x70, 0x6f, 0x70,
- 0x75, 0x6c, 0x61, 0x72, 0x20, 0x63, 0x6f, 0x72, 0x72, 0x65, 0x73, 0x70, 0x6f,
- 0x6e, 0x64, 0x69, 0x6e, 0x67, 0x63, 0x72, 0x65, 0x64, 0x69, 0x74, 0x65, 0x64,
- 0x20, 0x77, 0x69, 0x74, 0x68, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x62, 0x6f,
- 0x72, 0x64, 0x65, 0x72, 0x3a, 0x3c, 0x2f, 0x61, 0x3e, 0x3c, 0x2f, 0x73, 0x70,
- 0x61, 0x6e, 0x3e, 0x3c, 0x2f, 0x2e, 0x67, 0x69, 0x66, 0x22, 0x20, 0x77, 0x69,
- 0x64, 0x74, 0x68, 0x3d, 0x22, 0x3c, 0x69, 0x66, 0x72, 0x61, 0x6d, 0x65, 0x20,
- 0x73, 0x72, 0x63, 0x3d, 0x22, 0x74, 0x61, 0x62, 0x6c, 0x65, 0x20, 0x63, 0x6c,
- 0x61, 0x73, 0x73, 0x3d, 0x22, 0x69, 0x6e, 0x6c, 0x69, 0x6e, 0x65, 0x2d, 0x62,
- 0x6c, 0x6f, 0x63, 0x6b, 0x3b, 0x61, 0x63, 0x63, 0x6f, 0x72, 0x64, 0x69, 0x6e,
- 0x67, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x6f, 0x67, 0x65, 0x74, 0x68, 0x65, 0x72,
- 0x20, 0x77, 0x69, 0x74, 0x68, 0x61, 0x70, 0x70, 0x72, 0x6f, 0x78, 0x69, 0x6d,
- 0x61, 0x74, 0x65, 0x6c, 0x79, 0x70, 0x61, 0x72, 0x6c, 0x69, 0x61, 0x6d, 0x65,
- 0x6e, 0x74, 0x61, 0x72, 0x79, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x61, 0x6e, 0x64,
- 0x20, 0x6d, 0x6f, 0x72, 0x65, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x3a,
- 0x6e, 0x6f, 0x6e, 0x65, 0x3b, 0x74, 0x72, 0x61, 0x64, 0x69, 0x74, 0x69, 0x6f,
- 0x6e, 0x61, 0x6c, 0x6c, 0x79, 0x70, 0x72, 0x65, 0x64, 0x6f, 0x6d, 0x69, 0x6e,
- 0x61, 0x6e, 0x74, 0x6c, 0x79, 0x26, 0x6e, 0x62, 0x73, 0x70, 0x3b, 0x7c, 0x26,
- 0x6e, 0x62, 0x73, 0x70, 0x3b, 0x26, 0x6e, 0x62, 0x73, 0x70, 0x3b, 0x3c, 0x2f,
- 0x73, 0x70, 0x61, 0x6e, 0x3e, 0x20, 0x63, 0x65, 0x6c, 0x6c, 0x73, 0x70, 0x61,
- 0x63, 0x69, 0x6e, 0x67, 0x3d, 0x3c, 0x69, 0x6e, 0x70, 0x75, 0x74, 0x20, 0x6e,
- 0x61, 0x6d, 0x65, 0x3d, 0x22, 0x6f, 0x72, 0x22, 0x20, 0x63, 0x6f, 0x6e, 0x74,
- 0x65, 0x6e, 0x74, 0x3d, 0x22, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x76, 0x65,
- 0x72, 0x73, 0x69, 0x61, 0x6c, 0x70, 0x72, 0x6f, 0x70, 0x65, 0x72, 0x74, 0x79,
- 0x3d, 0x22, 0x6f, 0x67, 0x3a, 0x2f, 0x78, 0x2d, 0x73, 0x68, 0x6f, 0x63, 0x6b,
- 0x77, 0x61, 0x76, 0x65, 0x2d, 0x64, 0x65, 0x6d, 0x6f, 0x6e, 0x73, 0x74, 0x72,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x75, 0x72, 0x72, 0x6f, 0x75, 0x6e, 0x64,
- 0x65, 0x64, 0x20, 0x62, 0x79, 0x4e, 0x65, 0x76, 0x65, 0x72, 0x74, 0x68, 0x65,
- 0x6c, 0x65, 0x73, 0x73, 0x2c, 0x77, 0x61, 0x73, 0x20, 0x74, 0x68, 0x65, 0x20,
- 0x66, 0x69, 0x72, 0x73, 0x74, 0x63, 0x6f, 0x6e, 0x73, 0x69, 0x64, 0x65, 0x72,
- 0x61, 0x62, 0x6c, 0x65, 0x20, 0x41, 0x6c, 0x74, 0x68, 0x6f, 0x75, 0x67, 0x68,
- 0x20, 0x74, 0x68, 0x65, 0x20, 0x63, 0x6f, 0x6c, 0x6c, 0x61, 0x62, 0x6f, 0x72,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x68, 0x6f, 0x75, 0x6c, 0x64, 0x20, 0x6e,
- 0x6f, 0x74, 0x20, 0x62, 0x65, 0x70, 0x72, 0x6f, 0x70, 0x6f, 0x72, 0x74, 0x69,
- 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x3c, 0x73, 0x70, 0x61, 0x6e, 0x20, 0x73, 0x74,
- 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x6b, 0x6e, 0x6f, 0x77, 0x6e, 0x20, 0x61, 0x73,
- 0x20, 0x74, 0x68, 0x65, 0x20, 0x73, 0x68, 0x6f, 0x72, 0x74, 0x6c, 0x79, 0x20,
- 0x61, 0x66, 0x74, 0x65, 0x72, 0x66, 0x6f, 0x72, 0x20, 0x69, 0x6e, 0x73, 0x74,
- 0x61, 0x6e, 0x63, 0x65, 0x2c, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x62, 0x65,
- 0x64, 0x20, 0x61, 0x73, 0x20, 0x2f, 0x68, 0x65, 0x61, 0x64, 0x3e, 0x0a, 0x3c,
- 0x62, 0x6f, 0x64, 0x79, 0x20, 0x73, 0x74, 0x61, 0x72, 0x74, 0x69, 0x6e, 0x67,
- 0x20, 0x77, 0x69, 0x74, 0x68, 0x69, 0x6e, 0x63, 0x72, 0x65, 0x61, 0x73, 0x69,
- 0x6e, 0x67, 0x6c, 0x79, 0x20, 0x74, 0x68, 0x65, 0x20, 0x66, 0x61, 0x63, 0x74,
- 0x20, 0x74, 0x68, 0x61, 0x74, 0x64, 0x69, 0x73, 0x63, 0x75, 0x73, 0x73, 0x69,
- 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x6d, 0x69, 0x64, 0x64, 0x6c, 0x65, 0x20, 0x6f,
- 0x66, 0x20, 0x74, 0x68, 0x65, 0x61, 0x6e, 0x20, 0x69, 0x6e, 0x64, 0x69, 0x76,
- 0x69, 0x64, 0x75, 0x61, 0x6c, 0x64, 0x69, 0x66, 0x66, 0x69, 0x63, 0x75, 0x6c,
- 0x74, 0x20, 0x74, 0x6f, 0x20, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x20, 0x6f, 0x66,
- 0x20, 0x76, 0x69, 0x65, 0x77, 0x68, 0x6f, 0x6d, 0x6f, 0x73, 0x65, 0x78, 0x75,
- 0x61, 0x6c, 0x69, 0x74, 0x79, 0x61, 0x63, 0x63, 0x65, 0x70, 0x74, 0x61, 0x6e,
- 0x63, 0x65, 0x20, 0x6f, 0x66, 0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e, 0x3e, 0x3c,
- 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x6d, 0x61, 0x6e, 0x75, 0x66, 0x61, 0x63, 0x74,
- 0x75, 0x72, 0x65, 0x72, 0x73, 0x6f, 0x72, 0x69, 0x67, 0x69, 0x6e, 0x20, 0x6f,
- 0x66, 0x20, 0x74, 0x68, 0x65, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x6c, 0x79,
- 0x20, 0x75, 0x73, 0x65, 0x64, 0x69, 0x6d, 0x70, 0x6f, 0x72, 0x74, 0x61, 0x6e,
- 0x63, 0x65, 0x20, 0x6f, 0x66, 0x64, 0x65, 0x6e, 0x6f, 0x6d, 0x69, 0x6e, 0x61,
- 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x62, 0x61, 0x63, 0x6b, 0x67, 0x72, 0x6f, 0x75,
- 0x6e, 0x64, 0x3a, 0x20, 0x23, 0x6c, 0x65, 0x6e, 0x67, 0x74, 0x68, 0x20, 0x6f,
- 0x66, 0x20, 0x74, 0x68, 0x65, 0x64, 0x65, 0x74, 0x65, 0x72, 0x6d, 0x69, 0x6e,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x20, 0x73, 0x69, 0x67, 0x6e, 0x69, 0x66,
- 0x69, 0x63, 0x61, 0x6e, 0x74, 0x22, 0x20, 0x62, 0x6f, 0x72, 0x64, 0x65, 0x72,
- 0x3d, 0x22, 0x30, 0x22, 0x3e, 0x72, 0x65, 0x76, 0x6f, 0x6c, 0x75, 0x74, 0x69,
- 0x6f, 0x6e, 0x61, 0x72, 0x79, 0x70, 0x72, 0x69, 0x6e, 0x63, 0x69, 0x70, 0x6c,
- 0x65, 0x73, 0x20, 0x6f, 0x66, 0x69, 0x73, 0x20, 0x63, 0x6f, 0x6e, 0x73, 0x69,
- 0x64, 0x65, 0x72, 0x65, 0x64, 0x77, 0x61, 0x73, 0x20, 0x64, 0x65, 0x76, 0x65,
- 0x6c, 0x6f, 0x70, 0x65, 0x64, 0x49, 0x6e, 0x64, 0x6f, 0x2d, 0x45, 0x75, 0x72,
- 0x6f, 0x70, 0x65, 0x61, 0x6e, 0x76, 0x75, 0x6c, 0x6e, 0x65, 0x72, 0x61, 0x62,
- 0x6c, 0x65, 0x20, 0x74, 0x6f, 0x70, 0x72, 0x6f, 0x70, 0x6f, 0x6e, 0x65, 0x6e,
- 0x74, 0x73, 0x20, 0x6f, 0x66, 0x61, 0x72, 0x65, 0x20, 0x73, 0x6f, 0x6d, 0x65,
- 0x74, 0x69, 0x6d, 0x65, 0x73, 0x63, 0x6c, 0x6f, 0x73, 0x65, 0x72, 0x20, 0x74,
- 0x6f, 0x20, 0x74, 0x68, 0x65, 0x4e, 0x65, 0x77, 0x20, 0x59, 0x6f, 0x72, 0x6b,
- 0x20, 0x43, 0x69, 0x74, 0x79, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x22, 0x73,
- 0x65, 0x61, 0x72, 0x63, 0x68, 0x61, 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74,
- 0x65, 0x64, 0x20, 0x74, 0x6f, 0x63, 0x6f, 0x75, 0x72, 0x73, 0x65, 0x20, 0x6f,
- 0x66, 0x20, 0x74, 0x68, 0x65, 0x6d, 0x61, 0x74, 0x68, 0x65, 0x6d, 0x61, 0x74,
- 0x69, 0x63, 0x69, 0x61, 0x6e, 0x62, 0x79, 0x20, 0x74, 0x68, 0x65, 0x20, 0x65,
- 0x6e, 0x64, 0x20, 0x6f, 0x66, 0x61, 0x74, 0x20, 0x74, 0x68, 0x65, 0x20, 0x65,
- 0x6e, 0x64, 0x20, 0x6f, 0x66, 0x22, 0x20, 0x62, 0x6f, 0x72, 0x64, 0x65, 0x72,
- 0x3d, 0x22, 0x30, 0x22, 0x20, 0x74, 0x65, 0x63, 0x68, 0x6e, 0x6f, 0x6c, 0x6f,
- 0x67, 0x69, 0x63, 0x61, 0x6c, 0x2e, 0x72, 0x65, 0x6d, 0x6f, 0x76, 0x65, 0x43,
- 0x6c, 0x61, 0x73, 0x73, 0x28, 0x62, 0x72, 0x61, 0x6e, 0x63, 0x68, 0x20, 0x6f,
- 0x66, 0x20, 0x74, 0x68, 0x65, 0x65, 0x76, 0x69, 0x64, 0x65, 0x6e, 0x63, 0x65,
- 0x20, 0x74, 0x68, 0x61, 0x74, 0x21, 0x5b, 0x65, 0x6e, 0x64, 0x69, 0x66, 0x5d,
- 0x2d, 0x2d, 0x3e, 0x0d, 0x0a, 0x49, 0x6e, 0x73, 0x74, 0x69, 0x74, 0x75, 0x74,
- 0x65, 0x20, 0x6f, 0x66, 0x20, 0x69, 0x6e, 0x74, 0x6f, 0x20, 0x61, 0x20, 0x73,
- 0x69, 0x6e, 0x67, 0x6c, 0x65, 0x72, 0x65, 0x73, 0x70, 0x65, 0x63, 0x74, 0x69,
- 0x76, 0x65, 0x6c, 0x79, 0x2e, 0x61, 0x6e, 0x64, 0x20, 0x74, 0x68, 0x65, 0x72,
- 0x65, 0x66, 0x6f, 0x72, 0x65, 0x70, 0x72, 0x6f, 0x70, 0x65, 0x72, 0x74, 0x69,
- 0x65, 0x73, 0x20, 0x6f, 0x66, 0x69, 0x73, 0x20, 0x6c, 0x6f, 0x63, 0x61, 0x74,
- 0x65, 0x64, 0x20, 0x69, 0x6e, 0x73, 0x6f, 0x6d, 0x65, 0x20, 0x6f, 0x66, 0x20,
- 0x77, 0x68, 0x69, 0x63, 0x68, 0x54, 0x68, 0x65, 0x72, 0x65, 0x20, 0x69, 0x73,
- 0x20, 0x61, 0x6c, 0x73, 0x6f, 0x63, 0x6f, 0x6e, 0x74, 0x69, 0x6e, 0x75, 0x65,
- 0x64, 0x20, 0x74, 0x6f, 0x20, 0x61, 0x70, 0x70, 0x65, 0x61, 0x72, 0x61, 0x6e,
- 0x63, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x26, 0x61, 0x6d, 0x70, 0x3b, 0x6e, 0x64,
- 0x61, 0x73, 0x68, 0x3b, 0x20, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x62, 0x65,
- 0x73, 0x20, 0x74, 0x68, 0x65, 0x63, 0x6f, 0x6e, 0x73, 0x69, 0x64, 0x65, 0x72,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x75, 0x74, 0x68, 0x6f, 0x72, 0x20, 0x6f,
- 0x66, 0x20, 0x74, 0x68, 0x65, 0x69, 0x6e, 0x64, 0x65, 0x70, 0x65, 0x6e, 0x64,
- 0x65, 0x6e, 0x74, 0x6c, 0x79, 0x65, 0x71, 0x75, 0x69, 0x70, 0x70, 0x65, 0x64,
- 0x20, 0x77, 0x69, 0x74, 0x68, 0x64, 0x6f, 0x65, 0x73, 0x20, 0x6e, 0x6f, 0x74,
- 0x20, 0x68, 0x61, 0x76, 0x65, 0x3c, 0x2f, 0x61, 0x3e, 0x3c, 0x61, 0x20, 0x68,
- 0x72, 0x65, 0x66, 0x3d, 0x22, 0x63, 0x6f, 0x6e, 0x66, 0x75, 0x73, 0x65, 0x64,
- 0x20, 0x77, 0x69, 0x74, 0x68, 0x3c, 0x6c, 0x69, 0x6e, 0x6b, 0x20, 0x68, 0x72,
- 0x65, 0x66, 0x3d, 0x22, 0x2f, 0x61, 0x74, 0x20, 0x74, 0x68, 0x65, 0x20, 0x61,
- 0x67, 0x65, 0x20, 0x6f, 0x66, 0x61, 0x70, 0x70, 0x65, 0x61, 0x72, 0x20, 0x69,
- 0x6e, 0x20, 0x74, 0x68, 0x65, 0x54, 0x68, 0x65, 0x73, 0x65, 0x20, 0x69, 0x6e,
- 0x63, 0x6c, 0x75, 0x64, 0x65, 0x72, 0x65, 0x67, 0x61, 0x72, 0x64, 0x6c, 0x65,
- 0x73, 0x73, 0x20, 0x6f, 0x66, 0x63, 0x6f, 0x75, 0x6c, 0x64, 0x20, 0x62, 0x65,
- 0x20, 0x75, 0x73, 0x65, 0x64, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x26,
- 0x71, 0x75, 0x6f, 0x74, 0x3b, 0x73, 0x65, 0x76, 0x65, 0x72, 0x61, 0x6c, 0x20,
- 0x74, 0x69, 0x6d, 0x65, 0x73, 0x72, 0x65, 0x70, 0x72, 0x65, 0x73, 0x65, 0x6e,
- 0x74, 0x20, 0x74, 0x68, 0x65, 0x62, 0x6f, 0x64, 0x79, 0x3e, 0x0a, 0x3c, 0x2f,
- 0x68, 0x74, 0x6d, 0x6c, 0x3e, 0x74, 0x68, 0x6f, 0x75, 0x67, 0x68, 0x74, 0x20,
- 0x74, 0x6f, 0x20, 0x62, 0x65, 0x70, 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x74, 0x69,
- 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x70, 0x6f, 0x73, 0x73, 0x69, 0x62, 0x69, 0x6c,
- 0x69, 0x74, 0x69, 0x65, 0x73, 0x70, 0x65, 0x72, 0x63, 0x65, 0x6e, 0x74, 0x61,
- 0x67, 0x65, 0x20, 0x6f, 0x66, 0x61, 0x63, 0x63, 0x65, 0x73, 0x73, 0x20, 0x74,
- 0x6f, 0x20, 0x74, 0x68, 0x65, 0x61, 0x6e, 0x20, 0x61, 0x74, 0x74, 0x65, 0x6d,
- 0x70, 0x74, 0x20, 0x74, 0x6f, 0x70, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x74, 0x69,
- 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x6a, 0x71, 0x75, 0x65, 0x72, 0x79, 0x2f, 0x6a,
- 0x71, 0x75, 0x65, 0x72, 0x79, 0x74, 0x77, 0x6f, 0x20, 0x64, 0x69, 0x66, 0x66,
- 0x65, 0x72, 0x65, 0x6e, 0x74, 0x62, 0x65, 0x6c, 0x6f, 0x6e, 0x67, 0x20, 0x74,
- 0x6f, 0x20, 0x74, 0x68, 0x65, 0x65, 0x73, 0x74, 0x61, 0x62, 0x6c, 0x69, 0x73,
- 0x68, 0x6d, 0x65, 0x6e, 0x74, 0x72, 0x65, 0x70, 0x6c, 0x61, 0x63, 0x69, 0x6e,
- 0x67, 0x20, 0x74, 0x68, 0x65, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
- 0x69, 0x6f, 0x6e, 0x22, 0x20, 0x64, 0x65, 0x74, 0x65, 0x72, 0x6d, 0x69, 0x6e,
- 0x65, 0x20, 0x74, 0x68, 0x65, 0x61, 0x76, 0x61, 0x69, 0x6c, 0x61, 0x62, 0x6c,
- 0x65, 0x20, 0x66, 0x6f, 0x72, 0x41, 0x63, 0x63, 0x6f, 0x72, 0x64, 0x69, 0x6e,
- 0x67, 0x20, 0x74, 0x6f, 0x20, 0x77, 0x69, 0x64, 0x65, 0x20, 0x72, 0x61, 0x6e,
- 0x67, 0x65, 0x20, 0x6f, 0x66, 0x09, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x63, 0x6c,
- 0x61, 0x73, 0x73, 0x3d, 0x22, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x63, 0x6f, 0x6d,
- 0x6d, 0x6f, 0x6e, 0x6c, 0x79, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x73, 0x61,
- 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e,
- 0x61, 0x6c, 0x69, 0x74, 0x79, 0x77, 0x61, 0x73, 0x20, 0x63, 0x6f, 0x6d, 0x70,
- 0x6c, 0x65, 0x74, 0x65, 0x64, 0x20, 0x26, 0x61, 0x6d, 0x70, 0x3b, 0x6d, 0x64,
- 0x61, 0x73, 0x68, 0x3b, 0x20, 0x70, 0x61, 0x72, 0x74, 0x69, 0x63, 0x69, 0x70,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x74, 0x68, 0x65, 0x20, 0x63, 0x68, 0x61, 0x72,
- 0x61, 0x63, 0x74, 0x65, 0x72, 0x61, 0x6e, 0x20, 0x61, 0x64, 0x64, 0x69, 0x74,
- 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x61, 0x70, 0x70, 0x65, 0x61, 0x72, 0x73, 0x20,
- 0x74, 0x6f, 0x20, 0x62, 0x65, 0x66, 0x61, 0x63, 0x74, 0x20, 0x74, 0x68, 0x61,
- 0x74, 0x20, 0x74, 0x68, 0x65, 0x61, 0x6e, 0x20, 0x65, 0x78, 0x61, 0x6d, 0x70,
- 0x6c, 0x65, 0x20, 0x6f, 0x66, 0x73, 0x69, 0x67, 0x6e, 0x69, 0x66, 0x69, 0x63,
- 0x61, 0x6e, 0x74, 0x6c, 0x79, 0x6f, 0x6e, 0x6d, 0x6f, 0x75, 0x73, 0x65, 0x6f,
- 0x76, 0x65, 0x72, 0x3d, 0x22, 0x62, 0x65, 0x63, 0x61, 0x75, 0x73, 0x65, 0x20,
- 0x74, 0x68, 0x65, 0x79, 0x20, 0x61, 0x73, 0x79, 0x6e, 0x63, 0x20, 0x3d, 0x20,
- 0x74, 0x72, 0x75, 0x65, 0x3b, 0x70, 0x72, 0x6f, 0x62, 0x6c, 0x65, 0x6d, 0x73,
- 0x20, 0x77, 0x69, 0x74, 0x68, 0x73, 0x65, 0x65, 0x6d, 0x73, 0x20, 0x74, 0x6f,
- 0x20, 0x68, 0x61, 0x76, 0x65, 0x74, 0x68, 0x65, 0x20, 0x72, 0x65, 0x73, 0x75,
- 0x6c, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x73, 0x72, 0x63, 0x3d, 0x22, 0x68, 0x74,
- 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x66, 0x61, 0x6d, 0x69, 0x6c, 0x69, 0x61, 0x72,
- 0x20, 0x77, 0x69, 0x74, 0x68, 0x70, 0x6f, 0x73, 0x73, 0x65, 0x73, 0x73, 0x69,
- 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e,
- 0x20, 0x28, 0x29, 0x20, 0x7b, 0x74, 0x6f, 0x6f, 0x6b, 0x20, 0x70, 0x6c, 0x61,
- 0x63, 0x65, 0x20, 0x69, 0x6e, 0x61, 0x6e, 0x64, 0x20, 0x73, 0x6f, 0x6d, 0x65,
- 0x74, 0x69, 0x6d, 0x65, 0x73, 0x73, 0x75, 0x62, 0x73, 0x74, 0x61, 0x6e, 0x74,
- 0x69, 0x61, 0x6c, 0x6c, 0x79, 0x3c, 0x73, 0x70, 0x61, 0x6e, 0x3e, 0x3c, 0x2f,
- 0x73, 0x70, 0x61, 0x6e, 0x3e, 0x69, 0x73, 0x20, 0x6f, 0x66, 0x74, 0x65, 0x6e,
- 0x20, 0x75, 0x73, 0x65, 0x64, 0x69, 0x6e, 0x20, 0x61, 0x6e, 0x20, 0x61, 0x74,
- 0x74, 0x65, 0x6d, 0x70, 0x74, 0x67, 0x72, 0x65, 0x61, 0x74, 0x20, 0x64, 0x65,
- 0x61, 0x6c, 0x20, 0x6f, 0x66, 0x45, 0x6e, 0x76, 0x69, 0x72, 0x6f, 0x6e, 0x6d,
- 0x65, 0x6e, 0x74, 0x61, 0x6c, 0x73, 0x75, 0x63, 0x63, 0x65, 0x73, 0x73, 0x66,
- 0x75, 0x6c, 0x6c, 0x79, 0x20, 0x76, 0x69, 0x72, 0x74, 0x75, 0x61, 0x6c, 0x6c,
- 0x79, 0x20, 0x61, 0x6c, 0x6c, 0x32, 0x30, 0x74, 0x68, 0x20, 0x63, 0x65, 0x6e,
- 0x74, 0x75, 0x72, 0x79, 0x2c, 0x70, 0x72, 0x6f, 0x66, 0x65, 0x73, 0x73, 0x69,
- 0x6f, 0x6e, 0x61, 0x6c, 0x73, 0x6e, 0x65, 0x63, 0x65, 0x73, 0x73, 0x61, 0x72,
- 0x79, 0x20, 0x74, 0x6f, 0x20, 0x64, 0x65, 0x74, 0x65, 0x72, 0x6d, 0x69, 0x6e,
- 0x65, 0x64, 0x20, 0x62, 0x79, 0x63, 0x6f, 0x6d, 0x70, 0x61, 0x74, 0x69, 0x62,
- 0x69, 0x6c, 0x69, 0x74, 0x79, 0x62, 0x65, 0x63, 0x61, 0x75, 0x73, 0x65, 0x20,
- 0x69, 0x74, 0x20, 0x69, 0x73, 0x44, 0x69, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x61,
- 0x72, 0x79, 0x20, 0x6f, 0x66, 0x6d, 0x6f, 0x64, 0x69, 0x66, 0x69, 0x63, 0x61,
- 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x54, 0x68, 0x65, 0x20, 0x66, 0x6f, 0x6c, 0x6c,
- 0x6f, 0x77, 0x69, 0x6e, 0x67, 0x6d, 0x61, 0x79, 0x20, 0x72, 0x65, 0x66, 0x65,
- 0x72, 0x20, 0x74, 0x6f, 0x3a, 0x43, 0x6f, 0x6e, 0x73, 0x65, 0x71, 0x75, 0x65,
- 0x6e, 0x74, 0x6c, 0x79, 0x2c, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x74,
- 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x61, 0x6c, 0x74, 0x68, 0x6f, 0x75, 0x67, 0x68,
- 0x20, 0x73, 0x6f, 0x6d, 0x65, 0x74, 0x68, 0x61, 0x74, 0x20, 0x77, 0x6f, 0x75,
- 0x6c, 0x64, 0x20, 0x62, 0x65, 0x77, 0x6f, 0x72, 0x6c, 0x64, 0x27, 0x73, 0x20,
- 0x66, 0x69, 0x72, 0x73, 0x74, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x69, 0x66, 0x69,
- 0x65, 0x64, 0x20, 0x61, 0x73, 0x62, 0x6f, 0x74, 0x74, 0x6f, 0x6d, 0x20, 0x6f,
- 0x66, 0x20, 0x74, 0x68, 0x65, 0x28, 0x70, 0x61, 0x72, 0x74, 0x69, 0x63, 0x75,
- 0x6c, 0x61, 0x72, 0x6c, 0x79, 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3d, 0x22, 0x6c,
- 0x65, 0x66, 0x74, 0x22, 0x20, 0x6d, 0x6f, 0x73, 0x74, 0x20, 0x63, 0x6f, 0x6d,
- 0x6d, 0x6f, 0x6e, 0x6c, 0x79, 0x62, 0x61, 0x73, 0x69, 0x73, 0x20, 0x66, 0x6f,
- 0x72, 0x20, 0x74, 0x68, 0x65, 0x66, 0x6f, 0x75, 0x6e, 0x64, 0x61, 0x74, 0x69,
- 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x69, 0x62, 0x75,
- 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x70, 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x72, 0x69,
- 0x74, 0x79, 0x20, 0x6f, 0x66, 0x63, 0x65, 0x6e, 0x74, 0x65, 0x72, 0x20, 0x6f,
- 0x66, 0x20, 0x74, 0x68, 0x65, 0x74, 0x6f, 0x20, 0x72, 0x65, 0x64, 0x75, 0x63,
- 0x65, 0x20, 0x74, 0x68, 0x65, 0x6a, 0x75, 0x72, 0x69, 0x73, 0x64, 0x69, 0x63,
- 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x61, 0x70, 0x70, 0x72, 0x6f, 0x78, 0x69, 0x6d,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x6e, 0x6d, 0x6f, 0x75, 0x73, 0x65,
- 0x6f, 0x75, 0x74, 0x3d, 0x22, 0x4e, 0x65, 0x77, 0x20, 0x54, 0x65, 0x73, 0x74,
- 0x61, 0x6d, 0x65, 0x6e, 0x74, 0x63, 0x6f, 0x6c, 0x6c, 0x65, 0x63, 0x74, 0x69,
- 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e, 0x3e, 0x3c,
- 0x2f, 0x61, 0x3e, 0x3c, 0x2f, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x55,
- 0x6e, 0x69, 0x74, 0x65, 0x64, 0x66, 0x69, 0x6c, 0x6d, 0x20, 0x64, 0x69, 0x72,
- 0x65, 0x63, 0x74, 0x6f, 0x72, 0x2d, 0x73, 0x74, 0x72, 0x69, 0x63, 0x74, 0x2e,
- 0x64, 0x74, 0x64, 0x22, 0x3e, 0x68, 0x61, 0x73, 0x20, 0x62, 0x65, 0x65, 0x6e,
- 0x20, 0x75, 0x73, 0x65, 0x64, 0x72, 0x65, 0x74, 0x75, 0x72, 0x6e, 0x20, 0x74,
- 0x6f, 0x20, 0x74, 0x68, 0x65, 0x61, 0x6c, 0x74, 0x68, 0x6f, 0x75, 0x67, 0x68,
- 0x20, 0x74, 0x68, 0x69, 0x73, 0x63, 0x68, 0x61, 0x6e, 0x67, 0x65, 0x20, 0x69,
- 0x6e, 0x20, 0x74, 0x68, 0x65, 0x73, 0x65, 0x76, 0x65, 0x72, 0x61, 0x6c, 0x20,
- 0x6f, 0x74, 0x68, 0x65, 0x72, 0x62, 0x75, 0x74, 0x20, 0x74, 0x68, 0x65, 0x72,
- 0x65, 0x20, 0x61, 0x72, 0x65, 0x75, 0x6e, 0x70, 0x72, 0x65, 0x63, 0x65, 0x64,
- 0x65, 0x6e, 0x74, 0x65, 0x64, 0x69, 0x73, 0x20, 0x73, 0x69, 0x6d, 0x69, 0x6c,
- 0x61, 0x72, 0x20, 0x74, 0x6f, 0x65, 0x73, 0x70, 0x65, 0x63, 0x69, 0x61, 0x6c,
- 0x6c, 0x79, 0x20, 0x69, 0x6e, 0x77, 0x65, 0x69, 0x67, 0x68, 0x74, 0x3a, 0x20,
- 0x62, 0x6f, 0x6c, 0x64, 0x3b, 0x69, 0x73, 0x20, 0x63, 0x61, 0x6c, 0x6c, 0x65,
- 0x64, 0x20, 0x74, 0x68, 0x65, 0x63, 0x6f, 0x6d, 0x70, 0x75, 0x74, 0x61, 0x74,
- 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x69, 0x6e, 0x64, 0x69, 0x63, 0x61, 0x74, 0x65,
- 0x20, 0x74, 0x68, 0x61, 0x74, 0x72, 0x65, 0x73, 0x74, 0x72, 0x69, 0x63, 0x74,
- 0x65, 0x64, 0x20, 0x74, 0x6f, 0x09, 0x3c, 0x6d, 0x65, 0x74, 0x61, 0x20, 0x6e,
- 0x61, 0x6d, 0x65, 0x3d, 0x22, 0x61, 0x72, 0x65, 0x20, 0x74, 0x79, 0x70, 0x69,
- 0x63, 0x61, 0x6c, 0x6c, 0x79, 0x63, 0x6f, 0x6e, 0x66, 0x6c, 0x69, 0x63, 0x74,
- 0x20, 0x77, 0x69, 0x74, 0x68, 0x48, 0x6f, 0x77, 0x65, 0x76, 0x65, 0x72, 0x2c,
- 0x20, 0x74, 0x68, 0x65, 0x20, 0x41, 0x6e, 0x20, 0x65, 0x78, 0x61, 0x6d, 0x70,
- 0x6c, 0x65, 0x20, 0x6f, 0x66, 0x63, 0x6f, 0x6d, 0x70, 0x61, 0x72, 0x65, 0x64,
- 0x20, 0x77, 0x69, 0x74, 0x68, 0x71, 0x75, 0x61, 0x6e, 0x74, 0x69, 0x74, 0x69,
- 0x65, 0x73, 0x20, 0x6f, 0x66, 0x72, 0x61, 0x74, 0x68, 0x65, 0x72, 0x20, 0x74,
- 0x68, 0x61, 0x6e, 0x20, 0x61, 0x63, 0x6f, 0x6e, 0x73, 0x74, 0x65, 0x6c, 0x6c,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x65, 0x73, 0x73, 0x61, 0x72,
- 0x79, 0x20, 0x66, 0x6f, 0x72, 0x72, 0x65, 0x70, 0x6f, 0x72, 0x74, 0x65, 0x64,
- 0x20, 0x74, 0x68, 0x61, 0x74, 0x73, 0x70, 0x65, 0x63, 0x69, 0x66, 0x69, 0x63,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x70, 0x6f, 0x6c, 0x69, 0x74, 0x69, 0x63, 0x61,
- 0x6c, 0x20, 0x61, 0x6e, 0x64, 0x26, 0x6e, 0x62, 0x73, 0x70, 0x3b, 0x26, 0x6e,
- 0x62, 0x73, 0x70, 0x3b, 0x3c, 0x72, 0x65, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63,
- 0x65, 0x73, 0x20, 0x74, 0x6f, 0x74, 0x68, 0x65, 0x20, 0x73, 0x61, 0x6d, 0x65,
- 0x20, 0x79, 0x65, 0x61, 0x72, 0x47, 0x6f, 0x76, 0x65, 0x72, 0x6e, 0x6d, 0x65,
- 0x6e, 0x74, 0x20, 0x6f, 0x66, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69,
- 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x68, 0x61, 0x76, 0x65, 0x20, 0x6e, 0x6f, 0x74,
- 0x20, 0x62, 0x65, 0x65, 0x6e, 0x73, 0x65, 0x76, 0x65, 0x72, 0x61, 0x6c, 0x20,
- 0x79, 0x65, 0x61, 0x72, 0x73, 0x63, 0x6f, 0x6d, 0x6d, 0x69, 0x74, 0x6d, 0x65,
- 0x6e, 0x74, 0x20, 0x74, 0x6f, 0x09, 0x09, 0x3c, 0x75, 0x6c, 0x20, 0x63, 0x6c,
- 0x61, 0x73, 0x73, 0x3d, 0x22, 0x76, 0x69, 0x73, 0x75, 0x61, 0x6c, 0x69, 0x7a,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x31, 0x39, 0x74, 0x68, 0x20, 0x63, 0x65, 0x6e,
- 0x74, 0x75, 0x72, 0x79, 0x2c, 0x70, 0x72, 0x61, 0x63, 0x74, 0x69, 0x74, 0x69,
- 0x6f, 0x6e, 0x65, 0x72, 0x73, 0x74, 0x68, 0x61, 0x74, 0x20, 0x68, 0x65, 0x20,
- 0x77, 0x6f, 0x75, 0x6c, 0x64, 0x61, 0x6e, 0x64, 0x20, 0x63, 0x6f, 0x6e, 0x74,
- 0x69, 0x6e, 0x75, 0x65, 0x64, 0x6f, 0x63, 0x63, 0x75, 0x70, 0x61, 0x74, 0x69,
- 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x69, 0x73, 0x20, 0x64, 0x65, 0x66, 0x69, 0x6e,
- 0x65, 0x64, 0x20, 0x61, 0x73, 0x63, 0x65, 0x6e, 0x74, 0x72, 0x65, 0x20, 0x6f,
- 0x66, 0x20, 0x74, 0x68, 0x65, 0x74, 0x68, 0x65, 0x20, 0x61, 0x6d, 0x6f, 0x75,
- 0x6e, 0x74, 0x20, 0x6f, 0x66, 0x3e, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x73, 0x74,
- 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x65, 0x71, 0x75, 0x69, 0x76, 0x61, 0x6c, 0x65,
- 0x6e, 0x74, 0x20, 0x6f, 0x66, 0x64, 0x69, 0x66, 0x66, 0x65, 0x72, 0x65, 0x6e,
- 0x74, 0x69, 0x61, 0x74, 0x65, 0x62, 0x72, 0x6f, 0x75, 0x67, 0x68, 0x74, 0x20,
- 0x61, 0x62, 0x6f, 0x75, 0x74, 0x6d, 0x61, 0x72, 0x67, 0x69, 0x6e, 0x2d, 0x6c,
- 0x65, 0x66, 0x74, 0x3a, 0x20, 0x61, 0x75, 0x74, 0x6f, 0x6d, 0x61, 0x74, 0x69,
- 0x63, 0x61, 0x6c, 0x6c, 0x79, 0x74, 0x68, 0x6f, 0x75, 0x67, 0x68, 0x74, 0x20,
- 0x6f, 0x66, 0x20, 0x61, 0x73, 0x53, 0x6f, 0x6d, 0x65, 0x20, 0x6f, 0x66, 0x20,
- 0x74, 0x68, 0x65, 0x73, 0x65, 0x0a, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x63, 0x6c,
- 0x61, 0x73, 0x73, 0x3d, 0x22, 0x69, 0x6e, 0x70, 0x75, 0x74, 0x20, 0x63, 0x6c,
- 0x61, 0x73, 0x73, 0x3d, 0x22, 0x72, 0x65, 0x70, 0x6c, 0x61, 0x63, 0x65, 0x64,
- 0x20, 0x77, 0x69, 0x74, 0x68, 0x69, 0x73, 0x20, 0x6f, 0x6e, 0x65, 0x20, 0x6f,
- 0x66, 0x20, 0x74, 0x68, 0x65, 0x65, 0x64, 0x75, 0x63, 0x61, 0x74, 0x69, 0x6f,
- 0x6e, 0x20, 0x61, 0x6e, 0x64, 0x69, 0x6e, 0x66, 0x6c, 0x75, 0x65, 0x6e, 0x63,
- 0x65, 0x64, 0x20, 0x62, 0x79, 0x72, 0x65, 0x70, 0x75, 0x74, 0x61, 0x74, 0x69,
- 0x6f, 0x6e, 0x20, 0x61, 0x73, 0x0a, 0x3c, 0x6d, 0x65, 0x74, 0x61, 0x20, 0x6e,
- 0x61, 0x6d, 0x65, 0x3d, 0x22, 0x61, 0x63, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x64,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0a, 0x3c,
- 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x6c, 0x61, 0x72, 0x67, 0x65, 0x20, 0x70, 0x61,
- 0x72, 0x74, 0x20, 0x6f, 0x66, 0x49, 0x6e, 0x73, 0x74, 0x69, 0x74, 0x75, 0x74,
- 0x65, 0x20, 0x66, 0x6f, 0x72, 0x74, 0x68, 0x65, 0x20, 0x73, 0x6f, 0x2d, 0x63,
- 0x61, 0x6c, 0x6c, 0x65, 0x64, 0x20, 0x61, 0x67, 0x61, 0x69, 0x6e, 0x73, 0x74,
- 0x20, 0x74, 0x68, 0x65, 0x20, 0x49, 0x6e, 0x20, 0x74, 0x68, 0x69, 0x73, 0x20,
- 0x63, 0x61, 0x73, 0x65, 0x2c, 0x77, 0x61, 0x73, 0x20, 0x61, 0x70, 0x70, 0x6f,
- 0x69, 0x6e, 0x74, 0x65, 0x64, 0x63, 0x6c, 0x61, 0x69, 0x6d, 0x65, 0x64, 0x20,
- 0x74, 0x6f, 0x20, 0x62, 0x65, 0x48, 0x6f, 0x77, 0x65, 0x76, 0x65, 0x72, 0x2c,
- 0x20, 0x74, 0x68, 0x69, 0x73, 0x44, 0x65, 0x70, 0x61, 0x72, 0x74, 0x6d, 0x65,
- 0x6e, 0x74, 0x20, 0x6f, 0x66, 0x74, 0x68, 0x65, 0x20, 0x72, 0x65, 0x6d, 0x61,
- 0x69, 0x6e, 0x69, 0x6e, 0x67, 0x65, 0x66, 0x66, 0x65, 0x63, 0x74, 0x20, 0x6f,
- 0x6e, 0x20, 0x74, 0x68, 0x65, 0x70, 0x61, 0x72, 0x74, 0x69, 0x63, 0x75, 0x6c,
- 0x61, 0x72, 0x6c, 0x79, 0x20, 0x64, 0x65, 0x61, 0x6c, 0x20, 0x77, 0x69, 0x74,
- 0x68, 0x20, 0x74, 0x68, 0x65, 0x0a, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x73, 0x74,
- 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x61, 0x6c, 0x6d, 0x6f, 0x73, 0x74, 0x20, 0x61,
- 0x6c, 0x77, 0x61, 0x79, 0x73, 0x61, 0x72, 0x65, 0x20, 0x63, 0x75, 0x72, 0x72,
- 0x65, 0x6e, 0x74, 0x6c, 0x79, 0x65, 0x78, 0x70, 0x72, 0x65, 0x73, 0x73, 0x69,
- 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x70, 0x68, 0x69, 0x6c, 0x6f, 0x73, 0x6f, 0x70,
- 0x68, 0x79, 0x20, 0x6f, 0x66, 0x66, 0x6f, 0x72, 0x20, 0x6d, 0x6f, 0x72, 0x65,
- 0x20, 0x74, 0x68, 0x61, 0x6e, 0x63, 0x69, 0x76, 0x69, 0x6c, 0x69, 0x7a, 0x61,
- 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x6f, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x69,
- 0x73, 0x6c, 0x61, 0x6e, 0x64, 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x65, 0x64,
- 0x49, 0x6e, 0x64, 0x65, 0x78, 0x63, 0x61, 0x6e, 0x20, 0x72, 0x65, 0x73, 0x75,
- 0x6c, 0x74, 0x20, 0x69, 0x6e, 0x22, 0x20, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3d,
- 0x22, 0x22, 0x20, 0x2f, 0x3e, 0x74, 0x68, 0x65, 0x20, 0x73, 0x74, 0x72, 0x75,
- 0x63, 0x74, 0x75, 0x72, 0x65, 0x20, 0x2f, 0x3e, 0x3c, 0x2f, 0x61, 0x3e, 0x3c,
- 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x4d, 0x61, 0x6e, 0x79, 0x20, 0x6f, 0x66, 0x20,
- 0x74, 0x68, 0x65, 0x73, 0x65, 0x63, 0x61, 0x75, 0x73, 0x65, 0x64, 0x20, 0x62,
- 0x79, 0x20, 0x74, 0x68, 0x65, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x55,
- 0x6e, 0x69, 0x74, 0x65, 0x64, 0x73, 0x70, 0x61, 0x6e, 0x20, 0x63, 0x6c, 0x61,
- 0x73, 0x73, 0x3d, 0x22, 0x6d, 0x63, 0x61, 0x6e, 0x20, 0x62, 0x65, 0x20, 0x74,
- 0x72, 0x61, 0x63, 0x65, 0x64, 0x69, 0x73, 0x20, 0x72, 0x65, 0x6c, 0x61, 0x74,
- 0x65, 0x64, 0x20, 0x74, 0x6f, 0x62, 0x65, 0x63, 0x61, 0x6d, 0x65, 0x20, 0x6f,
- 0x6e, 0x65, 0x20, 0x6f, 0x66, 0x69, 0x73, 0x20, 0x66, 0x72, 0x65, 0x71, 0x75,
- 0x65, 0x6e, 0x74, 0x6c, 0x79, 0x6c, 0x69, 0x76, 0x69, 0x6e, 0x67, 0x20, 0x69,
- 0x6e, 0x20, 0x74, 0x68, 0x65, 0x74, 0x68, 0x65, 0x6f, 0x72, 0x65, 0x74, 0x69,
- 0x63, 0x61, 0x6c, 0x6c, 0x79, 0x46, 0x6f, 0x6c, 0x6c, 0x6f, 0x77, 0x69, 0x6e,
- 0x67, 0x20, 0x74, 0x68, 0x65, 0x52, 0x65, 0x76, 0x6f, 0x6c, 0x75, 0x74, 0x69,
- 0x6f, 0x6e, 0x61, 0x72, 0x79, 0x67, 0x6f, 0x76, 0x65, 0x72, 0x6e, 0x6d, 0x65,
- 0x6e, 0x74, 0x20, 0x69, 0x6e, 0x69, 0x73, 0x20, 0x64, 0x65, 0x74, 0x65, 0x72,
- 0x6d, 0x69, 0x6e, 0x65, 0x64, 0x74, 0x68, 0x65, 0x20, 0x70, 0x6f, 0x6c, 0x69,
- 0x74, 0x69, 0x63, 0x61, 0x6c, 0x69, 0x6e, 0x74, 0x72, 0x6f, 0x64, 0x75, 0x63,
- 0x65, 0x64, 0x20, 0x69, 0x6e, 0x73, 0x75, 0x66, 0x66, 0x69, 0x63, 0x69, 0x65,
- 0x6e, 0x74, 0x20, 0x74, 0x6f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
- 0x69, 0x6f, 0x6e, 0x22, 0x3e, 0x73, 0x68, 0x6f, 0x72, 0x74, 0x20, 0x73, 0x74,
- 0x6f, 0x72, 0x69, 0x65, 0x73, 0x73, 0x65, 0x70, 0x61, 0x72, 0x61, 0x74, 0x69,
- 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x61, 0x73, 0x20, 0x74, 0x6f, 0x20, 0x77, 0x68,
- 0x65, 0x74, 0x68, 0x65, 0x72, 0x6b, 0x6e, 0x6f, 0x77, 0x6e, 0x20, 0x66, 0x6f,
- 0x72, 0x20, 0x69, 0x74, 0x73, 0x77, 0x61, 0x73, 0x20, 0x69, 0x6e, 0x69, 0x74,
- 0x69, 0x61, 0x6c, 0x6c, 0x79, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x3a,
- 0x62, 0x6c, 0x6f, 0x63, 0x6b, 0x69, 0x73, 0x20, 0x61, 0x6e, 0x20, 0x65, 0x78,
- 0x61, 0x6d, 0x70, 0x6c, 0x65, 0x74, 0x68, 0x65, 0x20, 0x70, 0x72, 0x69, 0x6e,
- 0x63, 0x69, 0x70, 0x61, 0x6c, 0x63, 0x6f, 0x6e, 0x73, 0x69, 0x73, 0x74, 0x73,
- 0x20, 0x6f, 0x66, 0x20, 0x61, 0x72, 0x65, 0x63, 0x6f, 0x67, 0x6e, 0x69, 0x7a,
- 0x65, 0x64, 0x20, 0x61, 0x73, 0x2f, 0x62, 0x6f, 0x64, 0x79, 0x3e, 0x3c, 0x2f,
- 0x68, 0x74, 0x6d, 0x6c, 0x3e, 0x61, 0x20, 0x73, 0x75, 0x62, 0x73, 0x74, 0x61,
- 0x6e, 0x74, 0x69, 0x61, 0x6c, 0x72, 0x65, 0x63, 0x6f, 0x6e, 0x73, 0x74, 0x72,
- 0x75, 0x63, 0x74, 0x65, 0x64, 0x68, 0x65, 0x61, 0x64, 0x20, 0x6f, 0x66, 0x20,
- 0x73, 0x74, 0x61, 0x74, 0x65, 0x72, 0x65, 0x73, 0x69, 0x73, 0x74, 0x61, 0x6e,
- 0x63, 0x65, 0x20, 0x74, 0x6f, 0x75, 0x6e, 0x64, 0x65, 0x72, 0x67, 0x72, 0x61,
- 0x64, 0x75, 0x61, 0x74, 0x65, 0x54, 0x68, 0x65, 0x72, 0x65, 0x20, 0x61, 0x72,
- 0x65, 0x20, 0x74, 0x77, 0x6f, 0x67, 0x72, 0x61, 0x76, 0x69, 0x74, 0x61, 0x74,
- 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x61, 0x72, 0x65, 0x20, 0x64, 0x65, 0x73, 0x63,
- 0x72, 0x69, 0x62, 0x65, 0x64, 0x69, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f,
- 0x6e, 0x61, 0x6c, 0x6c, 0x79, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x20, 0x61,
- 0x73, 0x20, 0x74, 0x68, 0x65, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x68,
- 0x65, 0x61, 0x64, 0x65, 0x72, 0x6f, 0x70, 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69,
- 0x6f, 0x6e, 0x20, 0x74, 0x6f, 0x66, 0x75, 0x6e, 0x64, 0x61, 0x6d, 0x65, 0x6e,
- 0x74, 0x61, 0x6c, 0x6c, 0x79, 0x64, 0x6f, 0x6d, 0x69, 0x6e, 0x61, 0x74, 0x65,
- 0x64, 0x20, 0x74, 0x68, 0x65, 0x61, 0x6e, 0x64, 0x20, 0x74, 0x68, 0x65, 0x20,
- 0x6f, 0x74, 0x68, 0x65, 0x72, 0x61, 0x6c, 0x6c, 0x69, 0x61, 0x6e, 0x63, 0x65,
- 0x20, 0x77, 0x69, 0x74, 0x68, 0x77, 0x61, 0x73, 0x20, 0x66, 0x6f, 0x72, 0x63,
- 0x65, 0x64, 0x20, 0x74, 0x6f, 0x72, 0x65, 0x73, 0x70, 0x65, 0x63, 0x74, 0x69,
- 0x76, 0x65, 0x6c, 0x79, 0x2c, 0x61, 0x6e, 0x64, 0x20, 0x70, 0x6f, 0x6c, 0x69,
- 0x74, 0x69, 0x63, 0x61, 0x6c, 0x69, 0x6e, 0x20, 0x73, 0x75, 0x70, 0x70, 0x6f,
- 0x72, 0x74, 0x20, 0x6f, 0x66, 0x70, 0x65, 0x6f, 0x70, 0x6c, 0x65, 0x20, 0x69,
- 0x6e, 0x20, 0x74, 0x68, 0x65, 0x32, 0x30, 0x74, 0x68, 0x20, 0x63, 0x65, 0x6e,
- 0x74, 0x75, 0x72, 0x79, 0x2e, 0x61, 0x6e, 0x64, 0x20, 0x70, 0x75, 0x62, 0x6c,
- 0x69, 0x73, 0x68, 0x65, 0x64, 0x6c, 0x6f, 0x61, 0x64, 0x43, 0x68, 0x61, 0x72,
- 0x74, 0x62, 0x65, 0x61, 0x74, 0x74, 0x6f, 0x20, 0x75, 0x6e, 0x64, 0x65, 0x72,
- 0x73, 0x74, 0x61, 0x6e, 0x64, 0x6d, 0x65, 0x6d, 0x62, 0x65, 0x72, 0x20, 0x73,
- 0x74, 0x61, 0x74, 0x65, 0x73, 0x65, 0x6e, 0x76, 0x69, 0x72, 0x6f, 0x6e, 0x6d,
- 0x65, 0x6e, 0x74, 0x61, 0x6c, 0x66, 0x69, 0x72, 0x73, 0x74, 0x20, 0x68, 0x61,
- 0x6c, 0x66, 0x20, 0x6f, 0x66, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x72, 0x69, 0x65,
- 0x73, 0x20, 0x61, 0x6e, 0x64, 0x61, 0x72, 0x63, 0x68, 0x69, 0x74, 0x65, 0x63,
- 0x74, 0x75, 0x72, 0x61, 0x6c, 0x62, 0x65, 0x20, 0x63, 0x6f, 0x6e, 0x73, 0x69,
- 0x64, 0x65, 0x72, 0x65, 0x64, 0x63, 0x68, 0x61, 0x72, 0x61, 0x63, 0x74, 0x65,
- 0x72, 0x69, 0x7a, 0x65, 0x64, 0x63, 0x6c, 0x65, 0x61, 0x72, 0x49, 0x6e, 0x74,
- 0x65, 0x72, 0x76, 0x61, 0x6c, 0x61, 0x75, 0x74, 0x68, 0x6f, 0x72, 0x69, 0x74,
- 0x61, 0x74, 0x69, 0x76, 0x65, 0x46, 0x65, 0x64, 0x65, 0x72, 0x61, 0x74, 0x69,
- 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x77, 0x61, 0x73, 0x20, 0x73, 0x75, 0x63, 0x63,
- 0x65, 0x65, 0x64, 0x65, 0x64, 0x61, 0x6e, 0x64, 0x20, 0x74, 0x68, 0x65, 0x72,
- 0x65, 0x20, 0x61, 0x72, 0x65, 0x61, 0x20, 0x63, 0x6f, 0x6e, 0x73, 0x65, 0x71,
- 0x75, 0x65, 0x6e, 0x63, 0x65, 0x74, 0x68, 0x65, 0x20, 0x50, 0x72, 0x65, 0x73,
- 0x69, 0x64, 0x65, 0x6e, 0x74, 0x61, 0x6c, 0x73, 0x6f, 0x20, 0x69, 0x6e, 0x63,
- 0x6c, 0x75, 0x64, 0x65, 0x64, 0x66, 0x72, 0x65, 0x65, 0x20, 0x73, 0x6f, 0x66,
- 0x74, 0x77, 0x61, 0x72, 0x65, 0x73, 0x75, 0x63, 0x63, 0x65, 0x73, 0x73, 0x69,
- 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x64, 0x65, 0x76, 0x65, 0x6c, 0x6f, 0x70, 0x65,
- 0x64, 0x20, 0x74, 0x68, 0x65, 0x77, 0x61, 0x73, 0x20, 0x64, 0x65, 0x73, 0x74,
- 0x72, 0x6f, 0x79, 0x65, 0x64, 0x61, 0x77, 0x61, 0x79, 0x20, 0x66, 0x72, 0x6f,
- 0x6d, 0x20, 0x74, 0x68, 0x65, 0x3b, 0x0a, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69,
- 0x70, 0x74, 0x3e, 0x0a, 0x3c, 0x61, 0x6c, 0x74, 0x68, 0x6f, 0x75, 0x67, 0x68,
- 0x20, 0x74, 0x68, 0x65, 0x79, 0x66, 0x6f, 0x6c, 0x6c, 0x6f, 0x77, 0x65, 0x64,
- 0x20, 0x62, 0x79, 0x20, 0x61, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x70, 0x6f, 0x77,
- 0x65, 0x72, 0x66, 0x75, 0x6c, 0x72, 0x65, 0x73, 0x75, 0x6c, 0x74, 0x65, 0x64,
- 0x20, 0x69, 0x6e, 0x20, 0x61, 0x55, 0x6e, 0x69, 0x76, 0x65, 0x72, 0x73, 0x69,
- 0x74, 0x79, 0x20, 0x6f, 0x66, 0x48, 0x6f, 0x77, 0x65, 0x76, 0x65, 0x72, 0x2c,
- 0x20, 0x6d, 0x61, 0x6e, 0x79, 0x74, 0x68, 0x65, 0x20, 0x70, 0x72, 0x65, 0x73,
- 0x69, 0x64, 0x65, 0x6e, 0x74, 0x48, 0x6f, 0x77, 0x65, 0x76, 0x65, 0x72, 0x2c,
- 0x20, 0x73, 0x6f, 0x6d, 0x65, 0x69, 0x73, 0x20, 0x74, 0x68, 0x6f, 0x75, 0x67,
- 0x68, 0x74, 0x20, 0x74, 0x6f, 0x75, 0x6e, 0x74, 0x69, 0x6c, 0x20, 0x74, 0x68,
- 0x65, 0x20, 0x65, 0x6e, 0x64, 0x77, 0x61, 0x73, 0x20, 0x61, 0x6e, 0x6e, 0x6f,
- 0x75, 0x6e, 0x63, 0x65, 0x64, 0x61, 0x72, 0x65, 0x20, 0x69, 0x6d, 0x70, 0x6f,
- 0x72, 0x74, 0x61, 0x6e, 0x74, 0x61, 0x6c, 0x73, 0x6f, 0x20, 0x69, 0x6e, 0x63,
- 0x6c, 0x75, 0x64, 0x65, 0x73, 0x3e, 0x3c, 0x69, 0x6e, 0x70, 0x75, 0x74, 0x20,
- 0x74, 0x79, 0x70, 0x65, 0x3d, 0x74, 0x68, 0x65, 0x20, 0x63, 0x65, 0x6e, 0x74,
- 0x65, 0x72, 0x20, 0x6f, 0x66, 0x20, 0x44, 0x4f, 0x20, 0x4e, 0x4f, 0x54, 0x20,
- 0x41, 0x4c, 0x54, 0x45, 0x52, 0x75, 0x73, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x20,
- 0x72, 0x65, 0x66, 0x65, 0x72, 0x74, 0x68, 0x65, 0x6d, 0x65, 0x73, 0x2f, 0x3f,
- 0x73, 0x6f, 0x72, 0x74, 0x3d, 0x74, 0x68, 0x61, 0x74, 0x20, 0x68, 0x61, 0x64,
- 0x20, 0x62, 0x65, 0x65, 0x6e, 0x74, 0x68, 0x65, 0x20, 0x62, 0x61, 0x73, 0x69,
- 0x73, 0x20, 0x66, 0x6f, 0x72, 0x68, 0x61, 0x73, 0x20, 0x64, 0x65, 0x76, 0x65,
- 0x6c, 0x6f, 0x70, 0x65, 0x64, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x73,
- 0x75, 0x6d, 0x6d, 0x65, 0x72, 0x63, 0x6f, 0x6d, 0x70, 0x61, 0x72, 0x61, 0x74,
- 0x69, 0x76, 0x65, 0x6c, 0x79, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x62, 0x65,
- 0x64, 0x20, 0x74, 0x68, 0x65, 0x73, 0x75, 0x63, 0x68, 0x20, 0x61, 0x73, 0x20,
- 0x74, 0x68, 0x6f, 0x73, 0x65, 0x74, 0x68, 0x65, 0x20, 0x72, 0x65, 0x73, 0x75,
- 0x6c, 0x74, 0x69, 0x6e, 0x67, 0x69, 0x73, 0x20, 0x69, 0x6d, 0x70, 0x6f, 0x73,
- 0x73, 0x69, 0x62, 0x6c, 0x65, 0x76, 0x61, 0x72, 0x69, 0x6f, 0x75, 0x73, 0x20,
- 0x6f, 0x74, 0x68, 0x65, 0x72, 0x53, 0x6f, 0x75, 0x74, 0x68, 0x20, 0x41, 0x66,
- 0x72, 0x69, 0x63, 0x61, 0x6e, 0x68, 0x61, 0x76, 0x65, 0x20, 0x74, 0x68, 0x65,
- 0x20, 0x73, 0x61, 0x6d, 0x65, 0x65, 0x66, 0x66, 0x65, 0x63, 0x74, 0x69, 0x76,
- 0x65, 0x6e, 0x65, 0x73, 0x73, 0x69, 0x6e, 0x20, 0x77, 0x68, 0x69, 0x63, 0x68,
- 0x20, 0x63, 0x61, 0x73, 0x65, 0x3b, 0x20, 0x74, 0x65, 0x78, 0x74, 0x2d, 0x61,
- 0x6c, 0x69, 0x67, 0x6e, 0x3a, 0x73, 0x74, 0x72, 0x75, 0x63, 0x74, 0x75, 0x72,
- 0x65, 0x20, 0x61, 0x6e, 0x64, 0x3b, 0x20, 0x62, 0x61, 0x63, 0x6b, 0x67, 0x72,
- 0x6f, 0x75, 0x6e, 0x64, 0x3a, 0x72, 0x65, 0x67, 0x61, 0x72, 0x64, 0x69, 0x6e,
- 0x67, 0x20, 0x74, 0x68, 0x65, 0x73, 0x75, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x65,
- 0x64, 0x20, 0x74, 0x68, 0x65, 0x69, 0x73, 0x20, 0x61, 0x6c, 0x73, 0x6f, 0x20,
- 0x6b, 0x6e, 0x6f, 0x77, 0x6e, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x6d,
- 0x61, 0x72, 0x67, 0x69, 0x6e, 0x69, 0x6e, 0x63, 0x6c, 0x75, 0x64, 0x69, 0x6e,
- 0x67, 0x20, 0x74, 0x68, 0x65, 0x62, 0x61, 0x68, 0x61, 0x73, 0x61, 0x20, 0x4d,
- 0x65, 0x6c, 0x61, 0x79, 0x75, 0x6e, 0x6f, 0x72, 0x73, 0x6b, 0x20, 0x62, 0x6f,
- 0x6b, 0x6d, 0xc3, 0xa5, 0x6c, 0x6e, 0x6f, 0x72, 0x73, 0x6b, 0x20, 0x6e, 0x79,
- 0x6e, 0x6f, 0x72, 0x73, 0x6b, 0x73, 0x6c, 0x6f, 0x76, 0x65, 0x6e, 0xc5, 0xa1,
- 0xc4, 0x8d, 0x69, 0x6e, 0x61, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x63,
- 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x63, 0x61, 0x6c, 0x69, 0x66, 0x69, 0x63, 0x61,
- 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x63, 0x6f, 0x6d, 0x75, 0x6e, 0x69, 0x63, 0x61,
- 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x63, 0x6f, 0x6e, 0x73, 0x74, 0x72, 0x75, 0x63,
- 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x22, 0x3e, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x63,
- 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x64, 0x69, 0x73, 0x61, 0x6d, 0x62, 0x69,
- 0x67, 0x75, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x44, 0x6f, 0x6d, 0x61, 0x69, 0x6e,
- 0x4e, 0x61, 0x6d, 0x65, 0x27, 0x2c, 0x20, 0x27, 0x61, 0x64, 0x6d, 0x69, 0x6e,
- 0x69, 0x73, 0x74, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x69, 0x6d, 0x75,
- 0x6c, 0x74, 0x61, 0x6e, 0x65, 0x6f, 0x75, 0x73, 0x6c, 0x79, 0x74, 0x72, 0x61,
- 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x49, 0x6e,
- 0x74, 0x65, 0x72, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x20, 0x6d,
- 0x61, 0x72, 0x67, 0x69, 0x6e, 0x2d, 0x62, 0x6f, 0x74, 0x74, 0x6f, 0x6d, 0x3a,
- 0x72, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x69, 0x62, 0x69, 0x6c, 0x69, 0x74,
- 0x79, 0x3c, 0x21, 0x5b, 0x65, 0x6e, 0x64, 0x69, 0x66, 0x5d, 0x2d, 0x2d, 0x3e,
- 0x0a, 0x3c, 0x2f, 0x3e, 0x3c, 0x6d, 0x65, 0x74, 0x61, 0x20, 0x6e, 0x61, 0x6d,
- 0x65, 0x3d, 0x22, 0x69, 0x6d, 0x70, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x61,
- 0x74, 0x69, 0x6f, 0x6e, 0x69, 0x6e, 0x66, 0x72, 0x61, 0x73, 0x74, 0x72, 0x75,
- 0x63, 0x74, 0x75, 0x72, 0x65, 0x72, 0x65, 0x70, 0x72, 0x65, 0x73, 0x65, 0x6e,
- 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x62, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x2d,
- 0x62, 0x6f, 0x74, 0x74, 0x6f, 0x6d, 0x3a, 0x3c, 0x2f, 0x68, 0x65, 0x61, 0x64,
- 0x3e, 0x0a, 0x3c, 0x62, 0x6f, 0x64, 0x79, 0x3e, 0x3d, 0x68, 0x74, 0x74, 0x70,
- 0x25, 0x33, 0x41, 0x25, 0x32, 0x46, 0x25, 0x32, 0x46, 0x3c, 0x66, 0x6f, 0x72,
- 0x6d, 0x20, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x3d, 0x22, 0x6d, 0x65, 0x74,
- 0x68, 0x6f, 0x64, 0x3d, 0x22, 0x70, 0x6f, 0x73, 0x74, 0x22, 0x20, 0x2f, 0x66,
- 0x61, 0x76, 0x69, 0x63, 0x6f, 0x6e, 0x2e, 0x69, 0x63, 0x6f, 0x22, 0x20, 0x7d,
- 0x29, 0x3b, 0x0a, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x0a,
- 0x2e, 0x73, 0x65, 0x74, 0x41, 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x65,
- 0x28, 0x41, 0x64, 0x6d, 0x69, 0x6e, 0x69, 0x73, 0x74, 0x72, 0x61, 0x74, 0x69,
- 0x6f, 0x6e, 0x3d, 0x20, 0x6e, 0x65, 0x77, 0x20, 0x41, 0x72, 0x72, 0x61, 0x79,
- 0x28, 0x29, 0x3b, 0x3c, 0x21, 0x5b, 0x65, 0x6e, 0x64, 0x69, 0x66, 0x5d, 0x2d,
- 0x2d, 0x3e, 0x0d, 0x0a, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x3a, 0x62,
- 0x6c, 0x6f, 0x63, 0x6b, 0x3b, 0x55, 0x6e, 0x66, 0x6f, 0x72, 0x74, 0x75, 0x6e,
- 0x61, 0x74, 0x65, 0x6c, 0x79, 0x2c, 0x22, 0x3e, 0x26, 0x6e, 0x62, 0x73, 0x70,
- 0x3b, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x2f, 0x66, 0x61, 0x76, 0x69, 0x63,
- 0x6f, 0x6e, 0x2e, 0x69, 0x63, 0x6f, 0x22, 0x3e, 0x3d, 0x27, 0x73, 0x74, 0x79,
- 0x6c, 0x65, 0x73, 0x68, 0x65, 0x65, 0x74, 0x27, 0x20, 0x69, 0x64, 0x65, 0x6e,
- 0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2c, 0x20, 0x66,
- 0x6f, 0x72, 0x20, 0x65, 0x78, 0x61, 0x6d, 0x70, 0x6c, 0x65, 0x2c, 0x3c, 0x6c,
- 0x69, 0x3e, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x2f, 0x61,
- 0x6e, 0x20, 0x61, 0x6c, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x74, 0x69, 0x76, 0x65,
- 0x61, 0x73, 0x20, 0x61, 0x20, 0x72, 0x65, 0x73, 0x75, 0x6c, 0x74, 0x20, 0x6f,
- 0x66, 0x70, 0x74, 0x22, 0x3e, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
- 0x3e, 0x0a, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x73, 0x75, 0x62, 0x6d, 0x69,
- 0x74, 0x22, 0x20, 0x0a, 0x28, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e,
- 0x28, 0x29, 0x20, 0x7b, 0x72, 0x65, 0x63, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x64,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x66, 0x6f, 0x72, 0x6d, 0x20, 0x61, 0x63, 0x74,
- 0x69, 0x6f, 0x6e, 0x3d, 0x22, 0x2f, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x66, 0x6f,
- 0x72, 0x6d, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x72, 0x65, 0x63, 0x6f, 0x6e, 0x73,
- 0x74, 0x72, 0x75, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x73, 0x74, 0x79, 0x6c,
- 0x65, 0x2e, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x20, 0x41, 0x63, 0x63,
- 0x6f, 0x72, 0x64, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x6f, 0x20, 0x68, 0x69, 0x64,
- 0x64, 0x65, 0x6e, 0x22, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x22, 0x61, 0x6c,
- 0x6f, 0x6e, 0x67, 0x20, 0x77, 0x69, 0x74, 0x68, 0x20, 0x74, 0x68, 0x65, 0x64,
- 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x2e, 0x62, 0x6f, 0x64, 0x79, 0x2e,
- 0x61, 0x70, 0x70, 0x72, 0x6f, 0x78, 0x69, 0x6d, 0x61, 0x74, 0x65, 0x6c, 0x79,
- 0x20, 0x43, 0x6f, 0x6d, 0x6d, 0x75, 0x6e, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f,
- 0x6e, 0x73, 0x70, 0x6f, 0x73, 0x74, 0x22, 0x20, 0x61, 0x63, 0x74, 0x69, 0x6f,
- 0x6e, 0x3d, 0x22, 0x6d, 0x65, 0x61, 0x6e, 0x69, 0x6e, 0x67, 0x20, 0x26, 0x71,
- 0x75, 0x6f, 0x74, 0x3b, 0x2d, 0x2d, 0x3c, 0x21, 0x5b, 0x65, 0x6e, 0x64, 0x69,
- 0x66, 0x5d, 0x2d, 0x2d, 0x3e, 0x50, 0x72, 0x69, 0x6d, 0x65, 0x20, 0x4d, 0x69,
- 0x6e, 0x69, 0x73, 0x74, 0x65, 0x72, 0x63, 0x68, 0x61, 0x72, 0x61, 0x63, 0x74,
- 0x65, 0x72, 0x69, 0x73, 0x74, 0x69, 0x63, 0x3c, 0x2f, 0x61, 0x3e, 0x20, 0x3c,
- 0x61, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x74, 0x68, 0x65, 0x20, 0x68,
- 0x69, 0x73, 0x74, 0x6f, 0x72, 0x79, 0x20, 0x6f, 0x66, 0x20, 0x6f, 0x6e, 0x6d,
- 0x6f, 0x75, 0x73, 0x65, 0x6f, 0x76, 0x65, 0x72, 0x3d, 0x22, 0x74, 0x68, 0x65,
- 0x20, 0x67, 0x6f, 0x76, 0x65, 0x72, 0x6e, 0x6d, 0x65, 0x6e, 0x74, 0x68, 0x72,
- 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77,
- 0x61, 0x73, 0x20, 0x6f, 0x72, 0x69, 0x67, 0x69, 0x6e, 0x61, 0x6c, 0x6c, 0x79,
- 0x77, 0x61, 0x73, 0x20, 0x69, 0x6e, 0x74, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x65,
- 0x64, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69,
- 0x6f, 0x6e, 0x72, 0x65, 0x70, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x74, 0x61, 0x74,
- 0x69, 0x76, 0x65, 0x61, 0x72, 0x65, 0x20, 0x63, 0x6f, 0x6e, 0x73, 0x69, 0x64,
- 0x65, 0x72, 0x65, 0x64, 0x3c, 0x21, 0x5b, 0x65, 0x6e, 0x64, 0x69, 0x66, 0x5d,
- 0x2d, 0x2d, 0x3e, 0x0a, 0x0a, 0x64, 0x65, 0x70, 0x65, 0x6e, 0x64, 0x73, 0x20,
- 0x6f, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x55, 0x6e, 0x69, 0x76, 0x65, 0x72, 0x73,
- 0x69, 0x74, 0x79, 0x20, 0x6f, 0x66, 0x20, 0x69, 0x6e, 0x20, 0x63, 0x6f, 0x6e,
- 0x74, 0x72, 0x61, 0x73, 0x74, 0x20, 0x74, 0x6f, 0x20, 0x70, 0x6c, 0x61, 0x63,
- 0x65, 0x68, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x3d, 0x22, 0x69, 0x6e, 0x20, 0x74,
- 0x68, 0x65, 0x20, 0x63, 0x61, 0x73, 0x65, 0x20, 0x6f, 0x66, 0x69, 0x6e, 0x74,
- 0x65, 0x72, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x20, 0x63, 0x6f,
- 0x6e, 0x73, 0x74, 0x69, 0x74, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x73,
- 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x62, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x2d,
- 0x3a, 0x20, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x28, 0x29, 0x20,
- 0x7b, 0x42, 0x65, 0x63, 0x61, 0x75, 0x73, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x74,
- 0x68, 0x65, 0x2d, 0x73, 0x74, 0x72, 0x69, 0x63, 0x74, 0x2e, 0x64, 0x74, 0x64,
- 0x22, 0x3e, 0x0a, 0x3c, 0x74, 0x61, 0x62, 0x6c, 0x65, 0x20, 0x63, 0x6c, 0x61,
- 0x73, 0x73, 0x3d, 0x22, 0x61, 0x63, 0x63, 0x6f, 0x6d, 0x70, 0x61, 0x6e, 0x69,
- 0x65, 0x64, 0x20, 0x62, 0x79, 0x61, 0x63, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x20,
- 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x3c, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
- 0x20, 0x73, 0x72, 0x63, 0x3d, 0x22, 0x2f, 0x6e, 0x61, 0x74, 0x75, 0x72, 0x65,
- 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x74, 0x68, 0x65, 0x20, 0x70,
- 0x65, 0x6f, 0x70, 0x6c, 0x65, 0x20, 0x69, 0x6e, 0x20, 0x69, 0x6e, 0x20, 0x61,
- 0x64, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x74, 0x6f, 0x73, 0x29, 0x3b,
- 0x20, 0x6a, 0x73, 0x2e, 0x69, 0x64, 0x20, 0x3d, 0x20, 0x69, 0x64, 0x22, 0x20,
- 0x77, 0x69, 0x64, 0x74, 0x68, 0x3d, 0x22, 0x31, 0x30, 0x30, 0x25, 0x22, 0x72,
- 0x65, 0x67, 0x61, 0x72, 0x64, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65, 0x20,
- 0x52, 0x6f, 0x6d, 0x61, 0x6e, 0x20, 0x43, 0x61, 0x74, 0x68, 0x6f, 0x6c, 0x69,
- 0x63, 0x61, 0x6e, 0x20, 0x69, 0x6e, 0x64, 0x65, 0x70, 0x65, 0x6e, 0x64, 0x65,
- 0x6e, 0x74, 0x66, 0x6f, 0x6c, 0x6c, 0x6f, 0x77, 0x69, 0x6e, 0x67, 0x20, 0x74,
- 0x68, 0x65, 0x20, 0x2e, 0x67, 0x69, 0x66, 0x22, 0x20, 0x77, 0x69, 0x64, 0x74,
- 0x68, 0x3d, 0x22, 0x31, 0x74, 0x68, 0x65, 0x20, 0x66, 0x6f, 0x6c, 0x6c, 0x6f,
- 0x77, 0x69, 0x6e, 0x67, 0x20, 0x64, 0x69, 0x73, 0x63, 0x72, 0x69, 0x6d, 0x69,
- 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x72, 0x63, 0x68, 0x61, 0x65, 0x6f,
- 0x6c, 0x6f, 0x67, 0x69, 0x63, 0x61, 0x6c, 0x70, 0x72, 0x69, 0x6d, 0x65, 0x20,
- 0x6d, 0x69, 0x6e, 0x69, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x6a, 0x73, 0x22, 0x3e,
- 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x63, 0x6f, 0x6d, 0x62,
- 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x20, 0x6d, 0x61,
- 0x72, 0x67, 0x69, 0x6e, 0x77, 0x69, 0x64, 0x74, 0x68, 0x3d, 0x22, 0x63, 0x72,
- 0x65, 0x61, 0x74, 0x65, 0x45, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x28, 0x77,
- 0x2e, 0x61, 0x74, 0x74, 0x61, 0x63, 0x68, 0x45, 0x76, 0x65, 0x6e, 0x74, 0x28,
- 0x3c, 0x2f, 0x61, 0x3e, 0x3c, 0x2f, 0x74, 0x64, 0x3e, 0x3c, 0x2f, 0x74, 0x72,
- 0x3e, 0x73, 0x72, 0x63, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f,
- 0x2f, 0x61, 0x49, 0x6e, 0x20, 0x70, 0x61, 0x72, 0x74, 0x69, 0x63, 0x75, 0x6c,
- 0x61, 0x72, 0x2c, 0x20, 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3d, 0x22, 0x6c, 0x65,
- 0x66, 0x74, 0x22, 0x20, 0x43, 0x7a, 0x65, 0x63, 0x68, 0x20, 0x52, 0x65, 0x70,
- 0x75, 0x62, 0x6c, 0x69, 0x63, 0x55, 0x6e, 0x69, 0x74, 0x65, 0x64, 0x20, 0x4b,
- 0x69, 0x6e, 0x67, 0x64, 0x6f, 0x6d, 0x63, 0x6f, 0x72, 0x72, 0x65, 0x73, 0x70,
- 0x6f, 0x6e, 0x64, 0x65, 0x6e, 0x63, 0x65, 0x63, 0x6f, 0x6e, 0x63, 0x6c, 0x75,
- 0x64, 0x65, 0x64, 0x20, 0x74, 0x68, 0x61, 0x74, 0x2e, 0x68, 0x74, 0x6d, 0x6c,
- 0x22, 0x20, 0x74, 0x69, 0x74, 0x6c, 0x65, 0x3d, 0x22, 0x28, 0x66, 0x75, 0x6e,
- 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x28, 0x29, 0x20, 0x7b, 0x63, 0x6f, 0x6d,
- 0x65, 0x73, 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x20, 0x74, 0x68, 0x65, 0x61, 0x70,
- 0x70, 0x6c, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x3c,
- 0x73, 0x70, 0x61, 0x6e, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x73,
- 0x62, 0x65, 0x6c, 0x69, 0x65, 0x76, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x20, 0x62,
- 0x65, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x28, 0x27, 0x73, 0x63, 0x72, 0x69, 0x70,
- 0x74, 0x27, 0x3c, 0x2f, 0x61, 0x3e, 0x0a, 0x3c, 0x2f, 0x6c, 0x69, 0x3e, 0x0a,
- 0x3c, 0x6c, 0x69, 0x76, 0x65, 0x72, 0x79, 0x20, 0x64, 0x69, 0x66, 0x66, 0x65,
- 0x72, 0x65, 0x6e, 0x74, 0x3e, 0x3c, 0x73, 0x70, 0x61, 0x6e, 0x20, 0x63, 0x6c,
- 0x61, 0x73, 0x73, 0x3d, 0x22, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x76,
- 0x61, 0x6c, 0x75, 0x65, 0x3d, 0x22, 0x28, 0x61, 0x6c, 0x73, 0x6f, 0x20, 0x6b,
- 0x6e, 0x6f, 0x77, 0x6e, 0x20, 0x61, 0x73, 0x09, 0x3c, 0x6c, 0x69, 0x3e, 0x3c,
- 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x3e, 0x3c, 0x69, 0x6e, 0x70,
- 0x75, 0x74, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x22, 0x73, 0x65, 0x70, 0x61,
- 0x72, 0x61, 0x74, 0x65, 0x64, 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x72, 0x65, 0x66,
- 0x65, 0x72, 0x72, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x20, 0x61, 0x73, 0x20, 0x76,
- 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3d, 0x22, 0x74, 0x6f, 0x70, 0x22, 0x3e, 0x66,
- 0x6f, 0x75, 0x6e, 0x64, 0x65, 0x72, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65,
- 0x61, 0x74, 0x74, 0x65, 0x6d, 0x70, 0x74, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x6f,
- 0x20, 0x63, 0x61, 0x72, 0x62, 0x6f, 0x6e, 0x20, 0x64, 0x69, 0x6f, 0x78, 0x69,
- 0x64, 0x65, 0x0a, 0x0a, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73,
- 0x73, 0x3d, 0x22, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x73, 0x65, 0x61,
- 0x72, 0x63, 0x68, 0x2d, 0x2f, 0x62, 0x6f, 0x64, 0x79, 0x3e, 0x0a, 0x3c, 0x2f,
- 0x68, 0x74, 0x6d, 0x6c, 0x3e, 0x6f, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x75, 0x6e,
- 0x69, 0x74, 0x79, 0x20, 0x74, 0x6f, 0x63, 0x6f, 0x6d, 0x6d, 0x75, 0x6e, 0x69,
- 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x3c, 0x2f, 0x68, 0x65, 0x61, 0x64,
- 0x3e, 0x0d, 0x0a, 0x3c, 0x62, 0x6f, 0x64, 0x79, 0x20, 0x73, 0x74, 0x79, 0x6c,
- 0x65, 0x3d, 0x22, 0x77, 0x69, 0x64, 0x74, 0x68, 0x3a, 0x54, 0x69, 0xe1, 0xba,
- 0xbf, 0x6e, 0x67, 0x20, 0x56, 0x69, 0xe1, 0xbb, 0x87, 0x74, 0x63, 0x68, 0x61,
- 0x6e, 0x67, 0x65, 0x73, 0x20, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x62, 0x6f,
- 0x72, 0x64, 0x65, 0x72, 0x2d, 0x63, 0x6f, 0x6c, 0x6f, 0x72, 0x3a, 0x23, 0x30,
- 0x22, 0x20, 0x62, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x3d, 0x22, 0x30, 0x22, 0x20,
- 0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e, 0x3e, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e,
- 0x3c, 0x77, 0x61, 0x73, 0x20, 0x64, 0x69, 0x73, 0x63, 0x6f, 0x76, 0x65, 0x72,
- 0x65, 0x64, 0x22, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x74, 0x65, 0x78,
- 0x74, 0x22, 0x20, 0x29, 0x3b, 0x0a, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70,
- 0x74, 0x3e, 0x0a, 0x0a, 0x44, 0x65, 0x70, 0x61, 0x72, 0x74, 0x6d, 0x65, 0x6e,
- 0x74, 0x20, 0x6f, 0x66, 0x20, 0x65, 0x63, 0x63, 0x6c, 0x65, 0x73, 0x69, 0x61,
- 0x73, 0x74, 0x69, 0x63, 0x61, 0x6c, 0x74, 0x68, 0x65, 0x72, 0x65, 0x20, 0x68,
- 0x61, 0x73, 0x20, 0x62, 0x65, 0x65, 0x6e, 0x72, 0x65, 0x73, 0x75, 0x6c, 0x74,
- 0x69, 0x6e, 0x67, 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x3c, 0x2f, 0x62, 0x6f, 0x64,
- 0x79, 0x3e, 0x3c, 0x2f, 0x68, 0x74, 0x6d, 0x6c, 0x3e, 0x68, 0x61, 0x73, 0x20,
- 0x6e, 0x65, 0x76, 0x65, 0x72, 0x20, 0x62, 0x65, 0x65, 0x6e, 0x74, 0x68, 0x65,
- 0x20, 0x66, 0x69, 0x72, 0x73, 0x74, 0x20, 0x74, 0x69, 0x6d, 0x65, 0x69, 0x6e,
- 0x20, 0x72, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x20, 0x74, 0x6f, 0x61,
- 0x75, 0x74, 0x6f, 0x6d, 0x61, 0x74, 0x69, 0x63, 0x61, 0x6c, 0x6c, 0x79, 0x20,
- 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0a, 0x0a, 0x3c, 0x64, 0x69, 0x76, 0x20,
- 0x69, 0x77, 0x61, 0x73, 0x20, 0x63, 0x6f, 0x6e, 0x73, 0x69, 0x64, 0x65, 0x72,
- 0x65, 0x64, 0x70, 0x65, 0x72, 0x63, 0x65, 0x6e, 0x74, 0x20, 0x6f, 0x66, 0x20,
- 0x74, 0x68, 0x65, 0x22, 0x20, 0x2f, 0x3e, 0x3c, 0x2f, 0x61, 0x3e, 0x3c, 0x2f,
- 0x64, 0x69, 0x76, 0x3e, 0x63, 0x6f, 0x6c, 0x6c, 0x65, 0x63, 0x74, 0x69, 0x6f,
- 0x6e, 0x20, 0x6f, 0x66, 0x20, 0x64, 0x65, 0x73, 0x63, 0x65, 0x6e, 0x64, 0x65,
- 0x64, 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x73, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e,
- 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x61, 0x63, 0x63, 0x65, 0x70, 0x74,
- 0x2d, 0x63, 0x68, 0x61, 0x72, 0x73, 0x65, 0x74, 0x74, 0x6f, 0x20, 0x62, 0x65,
- 0x20, 0x63, 0x6f, 0x6e, 0x66, 0x75, 0x73, 0x65, 0x64, 0x6d, 0x65, 0x6d, 0x62,
- 0x65, 0x72, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x70, 0x61, 0x64,
- 0x64, 0x69, 0x6e, 0x67, 0x2d, 0x72, 0x69, 0x67, 0x68, 0x74, 0x3a, 0x74, 0x72,
- 0x61, 0x6e, 0x73, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x69,
- 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e,
- 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x27, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f,
- 0x2f, 0x77, 0x68, 0x65, 0x74, 0x68, 0x65, 0x72, 0x20, 0x6f, 0x72, 0x20, 0x6e,
- 0x6f, 0x74, 0x54, 0x68, 0x65, 0x72, 0x65, 0x20, 0x61, 0x72, 0x65, 0x20, 0x61,
- 0x6c, 0x73, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x65, 0x20, 0x61, 0x72, 0x65, 0x20,
- 0x6d, 0x61, 0x6e, 0x79, 0x61, 0x20, 0x73, 0x6d, 0x61, 0x6c, 0x6c, 0x20, 0x6e,
- 0x75, 0x6d, 0x62, 0x65, 0x72, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x20, 0x70, 0x61,
- 0x72, 0x74, 0x73, 0x20, 0x6f, 0x66, 0x69, 0x6d, 0x70, 0x6f, 0x73, 0x73, 0x69,
- 0x62, 0x6c, 0x65, 0x20, 0x74, 0x6f, 0x20, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73,
- 0x3d, 0x22, 0x62, 0x75, 0x74, 0x74, 0x6f, 0x6e, 0x6c, 0x6f, 0x63, 0x61, 0x74,
- 0x65, 0x64, 0x20, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x2e, 0x20, 0x48, 0x6f,
- 0x77, 0x65, 0x76, 0x65, 0x72, 0x2c, 0x20, 0x74, 0x68, 0x65, 0x61, 0x6e, 0x64,
- 0x20, 0x65, 0x76, 0x65, 0x6e, 0x74, 0x75, 0x61, 0x6c, 0x6c, 0x79, 0x41, 0x74,
- 0x20, 0x74, 0x68, 0x65, 0x20, 0x65, 0x6e, 0x64, 0x20, 0x6f, 0x66, 0x20, 0x62,
- 0x65, 0x63, 0x61, 0x75, 0x73, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x69, 0x74, 0x73,
- 0x72, 0x65, 0x70, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x74, 0x73, 0x20, 0x74, 0x68,
- 0x65, 0x3c, 0x66, 0x6f, 0x72, 0x6d, 0x20, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e,
- 0x3d, 0x22, 0x20, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x3d, 0x22, 0x70, 0x6f,
- 0x73, 0x74, 0x22, 0x69, 0x74, 0x20, 0x69, 0x73, 0x20, 0x70, 0x6f, 0x73, 0x73,
- 0x69, 0x62, 0x6c, 0x65, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x6c, 0x69, 0x6b, 0x65,
- 0x6c, 0x79, 0x20, 0x74, 0x6f, 0x61, 0x6e, 0x20, 0x69, 0x6e, 0x63, 0x72, 0x65,
- 0x61, 0x73, 0x65, 0x20, 0x69, 0x6e, 0x68, 0x61, 0x76, 0x65, 0x20, 0x61, 0x6c,
- 0x73, 0x6f, 0x20, 0x62, 0x65, 0x65, 0x6e, 0x63, 0x6f, 0x72, 0x72, 0x65, 0x73,
- 0x70, 0x6f, 0x6e, 0x64, 0x73, 0x20, 0x74, 0x6f, 0x61, 0x6e, 0x6e, 0x6f, 0x75,
- 0x6e, 0x63, 0x65, 0x64, 0x20, 0x74, 0x68, 0x61, 0x74, 0x61, 0x6c, 0x69, 0x67,
- 0x6e, 0x3d, 0x22, 0x72, 0x69, 0x67, 0x68, 0x74, 0x22, 0x3e, 0x6d, 0x61, 0x6e,
- 0x79, 0x20, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x72, 0x69, 0x65, 0x73, 0x66, 0x6f,
- 0x72, 0x20, 0x6d, 0x61, 0x6e, 0x79, 0x20, 0x79, 0x65, 0x61, 0x72, 0x73, 0x65,
- 0x61, 0x72, 0x6c, 0x69, 0x65, 0x73, 0x74, 0x20, 0x6b, 0x6e, 0x6f, 0x77, 0x6e,
- 0x62, 0x65, 0x63, 0x61, 0x75, 0x73, 0x65, 0x20, 0x69, 0x74, 0x20, 0x77, 0x61,
- 0x73, 0x70, 0x74, 0x22, 0x3e, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
- 0x3e, 0x0d, 0x20, 0x76, 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3d, 0x22, 0x74, 0x6f,
- 0x70, 0x22, 0x20, 0x69, 0x6e, 0x68, 0x61, 0x62, 0x69, 0x74, 0x61, 0x6e, 0x74,
- 0x73, 0x20, 0x6f, 0x66, 0x66, 0x6f, 0x6c, 0x6c, 0x6f, 0x77, 0x69, 0x6e, 0x67,
- 0x20, 0x79, 0x65, 0x61, 0x72, 0x0d, 0x0a, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x63,
- 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x6d, 0x69, 0x6c, 0x6c, 0x69, 0x6f, 0x6e,
- 0x20, 0x70, 0x65, 0x6f, 0x70, 0x6c, 0x65, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x6f,
- 0x76, 0x65, 0x72, 0x73, 0x69, 0x61, 0x6c, 0x20, 0x63, 0x6f, 0x6e, 0x63, 0x65,
- 0x72, 0x6e, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65, 0x61, 0x72, 0x67, 0x75,
- 0x65, 0x20, 0x74, 0x68, 0x61, 0x74, 0x20, 0x74, 0x68, 0x65, 0x67, 0x6f, 0x76,
- 0x65, 0x72, 0x6e, 0x6d, 0x65, 0x6e, 0x74, 0x20, 0x61, 0x6e, 0x64, 0x61, 0x20,
- 0x72, 0x65, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63, 0x65, 0x20, 0x74, 0x6f, 0x74,
- 0x72, 0x61, 0x6e, 0x73, 0x66, 0x65, 0x72, 0x72, 0x65, 0x64, 0x20, 0x74, 0x6f,
- 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x62, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68,
- 0x65, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x63, 0x6f, 0x6c, 0x6f,
- 0x72, 0x3a, 0x61, 0x6c, 0x74, 0x68, 0x6f, 0x75, 0x67, 0x68, 0x20, 0x74, 0x68,
- 0x65, 0x72, 0x65, 0x62, 0x65, 0x73, 0x74, 0x20, 0x6b, 0x6e, 0x6f, 0x77, 0x6e,
- 0x20, 0x66, 0x6f, 0x72, 0x73, 0x75, 0x62, 0x6d, 0x69, 0x74, 0x22, 0x20, 0x6e,
- 0x61, 0x6d, 0x65, 0x3d, 0x22, 0x6d, 0x75, 0x6c, 0x74, 0x69, 0x70, 0x6c, 0x69,
- 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x74, 0x68,
- 0x61, 0x6e, 0x20, 0x6f, 0x6e, 0x65, 0x20, 0x72, 0x65, 0x63, 0x6f, 0x67, 0x6e,
- 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x43, 0x6f, 0x75, 0x6e, 0x63,
- 0x69, 0x6c, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x65, 0x64, 0x69, 0x74,
- 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x20, 0x3c,
- 0x6d, 0x65, 0x74, 0x61, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x22, 0x45, 0x6e,
- 0x74, 0x65, 0x72, 0x74, 0x61, 0x69, 0x6e, 0x6d, 0x65, 0x6e, 0x74, 0x20, 0x61,
- 0x77, 0x61, 0x79, 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x20, 0x74, 0x68, 0x65, 0x20,
- 0x3b, 0x6d, 0x61, 0x72, 0x67, 0x69, 0x6e, 0x2d, 0x72, 0x69, 0x67, 0x68, 0x74,
- 0x3a, 0x61, 0x74, 0x20, 0x74, 0x68, 0x65, 0x20, 0x74, 0x69, 0x6d, 0x65, 0x20,
- 0x6f, 0x66, 0x69, 0x6e, 0x76, 0x65, 0x73, 0x74, 0x69, 0x67, 0x61, 0x74, 0x69,
- 0x6f, 0x6e, 0x73, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x65, 0x64, 0x20,
- 0x77, 0x69, 0x74, 0x68, 0x61, 0x6e, 0x64, 0x20, 0x6d, 0x61, 0x6e, 0x79, 0x20,
- 0x6f, 0x74, 0x68, 0x65, 0x72, 0x61, 0x6c, 0x74, 0x68, 0x6f, 0x75, 0x67, 0x68,
- 0x20, 0x69, 0x74, 0x20, 0x69, 0x73, 0x62, 0x65, 0x67, 0x69, 0x6e, 0x6e, 0x69,
- 0x6e, 0x67, 0x20, 0x77, 0x69, 0x74, 0x68, 0x20, 0x3c, 0x73, 0x70, 0x61, 0x6e,
- 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x64, 0x65, 0x73, 0x63, 0x65,
- 0x6e, 0x64, 0x61, 0x6e, 0x74, 0x73, 0x20, 0x6f, 0x66, 0x3c, 0x73, 0x70, 0x61,
- 0x6e, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x69, 0x20, 0x61, 0x6c,
- 0x69, 0x67, 0x6e, 0x3d, 0x22, 0x72, 0x69, 0x67, 0x68, 0x74, 0x22, 0x3c, 0x2f,
- 0x68, 0x65, 0x61, 0x64, 0x3e, 0x0a, 0x3c, 0x62, 0x6f, 0x64, 0x79, 0x20, 0x61,
- 0x73, 0x70, 0x65, 0x63, 0x74, 0x73, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65,
- 0x68, 0x61, 0x73, 0x20, 0x73, 0x69, 0x6e, 0x63, 0x65, 0x20, 0x62, 0x65, 0x65,
- 0x6e, 0x45, 0x75, 0x72, 0x6f, 0x70, 0x65, 0x61, 0x6e, 0x20, 0x55, 0x6e, 0x69,
- 0x6f, 0x6e, 0x72, 0x65, 0x6d, 0x69, 0x6e, 0x69, 0x73, 0x63, 0x65, 0x6e, 0x74,
- 0x20, 0x6f, 0x66, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x64, 0x69, 0x66, 0x66, 0x69,
- 0x63, 0x75, 0x6c, 0x74, 0x56, 0x69, 0x63, 0x65, 0x20, 0x50, 0x72, 0x65, 0x73,
- 0x69, 0x64, 0x65, 0x6e, 0x74, 0x63, 0x6f, 0x6d, 0x70, 0x6f, 0x73, 0x69, 0x74,
- 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x70, 0x61, 0x73, 0x73, 0x65, 0x64, 0x20,
- 0x74, 0x68, 0x72, 0x6f, 0x75, 0x67, 0x68, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x69,
- 0x6d, 0x70, 0x6f, 0x72, 0x74, 0x61, 0x6e, 0x74, 0x66, 0x6f, 0x6e, 0x74, 0x2d,
- 0x73, 0x69, 0x7a, 0x65, 0x3a, 0x31, 0x31, 0x70, 0x78, 0x65, 0x78, 0x70, 0x6c,
- 0x61, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x74, 0x68, 0x65,
- 0x20, 0x63, 0x6f, 0x6e, 0x63, 0x65, 0x70, 0x74, 0x20, 0x6f, 0x66, 0x77, 0x72,
- 0x69, 0x74, 0x74, 0x65, 0x6e, 0x20, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x09,
- 0x3c, 0x73, 0x70, 0x61, 0x6e, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22,
- 0x69, 0x73, 0x20, 0x6f, 0x6e, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65,
- 0x20, 0x72, 0x65, 0x73, 0x65, 0x6d, 0x62, 0x6c, 0x61, 0x6e, 0x63, 0x65, 0x20,
- 0x74, 0x6f, 0x6f, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x67, 0x72, 0x6f, 0x75,
- 0x6e, 0x64, 0x73, 0x77, 0x68, 0x69, 0x63, 0x68, 0x20, 0x63, 0x6f, 0x6e, 0x74,
- 0x61, 0x69, 0x6e, 0x73, 0x69, 0x6e, 0x63, 0x6c, 0x75, 0x64, 0x69, 0x6e, 0x67,
- 0x20, 0x74, 0x68, 0x65, 0x20, 0x64, 0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, 0x20,
- 0x62, 0x79, 0x20, 0x74, 0x68, 0x65, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x63, 0x61,
- 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x6d, 0x65, 0x61, 0x6e, 0x73, 0x20,
- 0x74, 0x68, 0x61, 0x74, 0x20, 0x74, 0x68, 0x65, 0x6f, 0x75, 0x74, 0x73, 0x69,
- 0x64, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x73, 0x75, 0x70, 0x70,
- 0x6f, 0x72, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x3c, 0x69, 0x6e,
- 0x70, 0x75, 0x74, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x3c, 0x73,
- 0x70, 0x61, 0x6e, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x74, 0x28,
- 0x4d, 0x61, 0x74, 0x68, 0x2e, 0x72, 0x61, 0x6e, 0x64, 0x6f, 0x6d, 0x28, 0x29,
- 0x6d, 0x6f, 0x73, 0x74, 0x20, 0x70, 0x72, 0x6f, 0x6d, 0x69, 0x6e, 0x65, 0x6e,
- 0x74, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x20,
- 0x6f, 0x66, 0x43, 0x6f, 0x6e, 0x73, 0x74, 0x61, 0x6e, 0x74, 0x69, 0x6e, 0x6f,
- 0x70, 0x6c, 0x65, 0x77, 0x65, 0x72, 0x65, 0x20, 0x70, 0x75, 0x62, 0x6c, 0x69,
- 0x73, 0x68, 0x65, 0x64, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73,
- 0x73, 0x3d, 0x22, 0x73, 0x65, 0x61, 0x70, 0x70, 0x65, 0x61, 0x72, 0x73, 0x20,
- 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x31, 0x22, 0x20, 0x68, 0x65, 0x69, 0x67,
- 0x68, 0x74, 0x3d, 0x22, 0x31, 0x22, 0x20, 0x6d, 0x6f, 0x73, 0x74, 0x20, 0x69,
- 0x6d, 0x70, 0x6f, 0x72, 0x74, 0x61, 0x6e, 0x74, 0x77, 0x68, 0x69, 0x63, 0x68,
- 0x20, 0x69, 0x6e, 0x63, 0x6c, 0x75, 0x64, 0x65, 0x73, 0x77, 0x68, 0x69, 0x63,
- 0x68, 0x20, 0x68, 0x61, 0x64, 0x20, 0x62, 0x65, 0x65, 0x6e, 0x64, 0x65, 0x73,
- 0x74, 0x72, 0x75, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x74, 0x68,
- 0x65, 0x20, 0x70, 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x0a,
- 0x09, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22,
- 0x70, 0x6f, 0x73, 0x73, 0x69, 0x62, 0x69, 0x6c, 0x69, 0x74, 0x79, 0x20, 0x6f,
- 0x66, 0x73, 0x6f, 0x6d, 0x65, 0x74, 0x69, 0x6d, 0x65, 0x73, 0x20, 0x75, 0x73,
- 0x65, 0x64, 0x61, 0x70, 0x70, 0x65, 0x61, 0x72, 0x20, 0x74, 0x6f, 0x20, 0x68,
- 0x61, 0x76, 0x65, 0x73, 0x75, 0x63, 0x63, 0x65, 0x73, 0x73, 0x20, 0x6f, 0x66,
- 0x20, 0x74, 0x68, 0x65, 0x69, 0x6e, 0x74, 0x65, 0x6e, 0x64, 0x65, 0x64, 0x20,
- 0x74, 0x6f, 0x20, 0x62, 0x65, 0x70, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x74, 0x20,
- 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22,
- 0x63, 0x6c, 0x65, 0x61, 0x72, 0x3a, 0x62, 0x0d, 0x0a, 0x3c, 0x2f, 0x73, 0x63,
- 0x72, 0x69, 0x70, 0x74, 0x3e, 0x0d, 0x0a, 0x3c, 0x77, 0x61, 0x73, 0x20, 0x66,
- 0x6f, 0x75, 0x6e, 0x64, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x69, 0x6e, 0x74, 0x65,
- 0x72, 0x76, 0x69, 0x65, 0x77, 0x20, 0x77, 0x69, 0x74, 0x68, 0x5f, 0x69, 0x64,
- 0x22, 0x20, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x3d, 0x22, 0x63, 0x61,
- 0x70, 0x69, 0x74, 0x61, 0x6c, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x0d,
- 0x0a, 0x3c, 0x6c, 0x69, 0x6e, 0x6b, 0x20, 0x72, 0x65, 0x6c, 0x3d, 0x22, 0x73,
- 0x72, 0x65, 0x6c, 0x65, 0x61, 0x73, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68,
- 0x65, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x20, 0x6f, 0x75, 0x74, 0x20, 0x74, 0x68,
- 0x61, 0x74, 0x78, 0x4d, 0x4c, 0x48, 0x74, 0x74, 0x70, 0x52, 0x65, 0x71, 0x75,
- 0x65, 0x73, 0x74, 0x61, 0x6e, 0x64, 0x20, 0x73, 0x75, 0x62, 0x73, 0x65, 0x71,
- 0x75, 0x65, 0x6e, 0x74, 0x73, 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x20, 0x6c, 0x61,
- 0x72, 0x67, 0x65, 0x73, 0x74, 0x76, 0x65, 0x72, 0x79, 0x20, 0x69, 0x6d, 0x70,
- 0x6f, 0x72, 0x74, 0x61, 0x6e, 0x74, 0x73, 0x70, 0x65, 0x63, 0x69, 0x66, 0x69,
- 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x73, 0x75, 0x72, 0x66, 0x61, 0x63,
- 0x65, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x61, 0x70, 0x70, 0x6c, 0x69,
- 0x65, 0x64, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x66, 0x6f, 0x72, 0x65,
- 0x69, 0x67, 0x6e, 0x20, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x5f, 0x73, 0x65,
- 0x74, 0x44, 0x6f, 0x6d, 0x61, 0x69, 0x6e, 0x4e, 0x61, 0x6d, 0x65, 0x65, 0x73,
- 0x74, 0x61, 0x62, 0x6c, 0x69, 0x73, 0x68, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x69,
- 0x73, 0x20, 0x62, 0x65, 0x6c, 0x69, 0x65, 0x76, 0x65, 0x64, 0x20, 0x74, 0x6f,
- 0x49, 0x6e, 0x20, 0x61, 0x64, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x74,
- 0x6f, 0x6d, 0x65, 0x61, 0x6e, 0x69, 0x6e, 0x67, 0x20, 0x6f, 0x66, 0x20, 0x74,
- 0x68, 0x65, 0x69, 0x73, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x20, 0x61, 0x66,
- 0x74, 0x65, 0x72, 0x74, 0x6f, 0x20, 0x70, 0x72, 0x6f, 0x74, 0x65, 0x63, 0x74,
- 0x20, 0x74, 0x68, 0x65, 0x69, 0x73, 0x20, 0x72, 0x65, 0x70, 0x72, 0x65, 0x73,
- 0x65, 0x6e, 0x74, 0x65, 0x64, 0x44, 0x65, 0x63, 0x6c, 0x61, 0x72, 0x61, 0x74,
- 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x65, 0x66,
- 0x66, 0x69, 0x63, 0x69, 0x65, 0x6e, 0x74, 0x43, 0x6c, 0x61, 0x73, 0x73, 0x69,
- 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x6f, 0x74, 0x68, 0x65, 0x72,
- 0x20, 0x66, 0x6f, 0x72, 0x6d, 0x73, 0x20, 0x6f, 0x66, 0x68, 0x65, 0x20, 0x72,
- 0x65, 0x74, 0x75, 0x72, 0x6e, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x3c, 0x73, 0x70,
- 0x61, 0x6e, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x63, 0x70, 0x65,
- 0x72, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x6e, 0x63, 0x65, 0x20, 0x6f, 0x66, 0x28,
- 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x28, 0x29, 0x20, 0x7b, 0x0d,
- 0x69, 0x66, 0x20, 0x61, 0x6e, 0x64, 0x20, 0x6f, 0x6e, 0x6c, 0x79, 0x20, 0x69,
- 0x66, 0x72, 0x65, 0x67, 0x69, 0x6f, 0x6e, 0x73, 0x20, 0x6f, 0x66, 0x20, 0x74,
- 0x68, 0x65, 0x6c, 0x65, 0x61, 0x64, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x6f, 0x20,
- 0x74, 0x68, 0x65, 0x72, 0x65, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x20,
- 0x77, 0x69, 0x74, 0x68, 0x55, 0x6e, 0x69, 0x74, 0x65, 0x64, 0x20, 0x4e, 0x61,
- 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x68,
- 0x65, 0x69, 0x67, 0x68, 0x74, 0x3a, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x20, 0x74,
- 0x68, 0x61, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x79, 0x70, 0x65, 0x22, 0x20, 0x63,
- 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x3d, 0x22, 0x41, 0x73, 0x73, 0x6f, 0x63,
- 0x69, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x0a, 0x3c, 0x2f, 0x68,
- 0x65, 0x61, 0x64, 0x3e, 0x0a, 0x3c, 0x62, 0x6f, 0x64, 0x79, 0x6c, 0x6f, 0x63,
- 0x61, 0x74, 0x65, 0x64, 0x20, 0x6f, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x69, 0x73,
- 0x20, 0x72, 0x65, 0x66, 0x65, 0x72, 0x72, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x28,
- 0x69, 0x6e, 0x63, 0x6c, 0x75, 0x64, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65,
- 0x63, 0x6f, 0x6e, 0x63, 0x65, 0x6e, 0x74, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e,
- 0x73, 0x74, 0x68, 0x65, 0x20, 0x69, 0x6e, 0x64, 0x69, 0x76, 0x69, 0x64, 0x75,
- 0x61, 0x6c, 0x61, 0x6d, 0x6f, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65, 0x20, 0x6d,
- 0x6f, 0x73, 0x74, 0x74, 0x68, 0x61, 0x6e, 0x20, 0x61, 0x6e, 0x79, 0x20, 0x6f,
- 0x74, 0x68, 0x65, 0x72, 0x2f, 0x3e, 0x0a, 0x3c, 0x6c, 0x69, 0x6e, 0x6b, 0x20,
- 0x72, 0x65, 0x6c, 0x3d, 0x22, 0x20, 0x72, 0x65, 0x74, 0x75, 0x72, 0x6e, 0x20,
- 0x66, 0x61, 0x6c, 0x73, 0x65, 0x3b, 0x74, 0x68, 0x65, 0x20, 0x70, 0x75, 0x72,
- 0x70, 0x6f, 0x73, 0x65, 0x20, 0x6f, 0x66, 0x74, 0x68, 0x65, 0x20, 0x61, 0x62,
- 0x69, 0x6c, 0x69, 0x74, 0x79, 0x20, 0x74, 0x6f, 0x3b, 0x63, 0x6f, 0x6c, 0x6f,
- 0x72, 0x3a, 0x23, 0x66, 0x66, 0x66, 0x7d, 0x0a, 0x2e, 0x0a, 0x3c, 0x73, 0x70,
- 0x61, 0x6e, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x74, 0x68, 0x65,
- 0x20, 0x73, 0x75, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x20, 0x6f, 0x66, 0x64, 0x65,
- 0x66, 0x69, 0x6e, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x20, 0x6f, 0x66, 0x3e,
- 0x0d, 0x0a, 0x3c, 0x6c, 0x69, 0x6e, 0x6b, 0x20, 0x72, 0x65, 0x6c, 0x3d, 0x22,
- 0x63, 0x6c, 0x61, 0x69, 0x6d, 0x20, 0x74, 0x68, 0x61, 0x74, 0x20, 0x74, 0x68,
- 0x65, 0x68, 0x61, 0x76, 0x65, 0x20, 0x64, 0x65, 0x76, 0x65, 0x6c, 0x6f, 0x70,
- 0x65, 0x64, 0x3c, 0x74, 0x61, 0x62, 0x6c, 0x65, 0x20, 0x77, 0x69, 0x64, 0x74,
- 0x68, 0x3d, 0x22, 0x63, 0x65, 0x6c, 0x65, 0x62, 0x72, 0x61, 0x74, 0x69, 0x6f,
- 0x6e, 0x20, 0x6f, 0x66, 0x46, 0x6f, 0x6c, 0x6c, 0x6f, 0x77, 0x69, 0x6e, 0x67,
- 0x20, 0x74, 0x68, 0x65, 0x20, 0x74, 0x6f, 0x20, 0x64, 0x69, 0x73, 0x74, 0x69,
- 0x6e, 0x67, 0x75, 0x69, 0x73, 0x68, 0x3c, 0x73, 0x70, 0x61, 0x6e, 0x20, 0x63,
- 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x62, 0x74, 0x61, 0x6b, 0x65, 0x73, 0x20,
- 0x70, 0x6c, 0x61, 0x63, 0x65, 0x20, 0x69, 0x6e, 0x75, 0x6e, 0x64, 0x65, 0x72,
- 0x20, 0x74, 0x68, 0x65, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x6e, 0x6f, 0x74, 0x65,
- 0x64, 0x20, 0x74, 0x68, 0x61, 0x74, 0x20, 0x74, 0x68, 0x65, 0x3e, 0x3c, 0x21,
- 0x5b, 0x65, 0x6e, 0x64, 0x69, 0x66, 0x5d, 0x2d, 0x2d, 0x3e, 0x0a, 0x73, 0x74,
- 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x6d, 0x61, 0x72, 0x67, 0x69, 0x6e, 0x2d, 0x69,
- 0x6e, 0x73, 0x74, 0x65, 0x61, 0x64, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65,
- 0x69, 0x6e, 0x74, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x65, 0x64, 0x20, 0x74, 0x68,
- 0x65, 0x74, 0x68, 0x65, 0x20, 0x70, 0x72, 0x6f, 0x63, 0x65, 0x73, 0x73, 0x20,
- 0x6f, 0x66, 0x69, 0x6e, 0x63, 0x72, 0x65, 0x61, 0x73, 0x69, 0x6e, 0x67, 0x20,
- 0x74, 0x68, 0x65, 0x64, 0x69, 0x66, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63, 0x65,
- 0x73, 0x20, 0x69, 0x6e, 0x65, 0x73, 0x74, 0x69, 0x6d, 0x61, 0x74, 0x65, 0x64,
- 0x20, 0x74, 0x68, 0x61, 0x74, 0x65, 0x73, 0x70, 0x65, 0x63, 0x69, 0x61, 0x6c,
- 0x6c, 0x79, 0x20, 0x74, 0x68, 0x65, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x3c, 0x64,
- 0x69, 0x76, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x77, 0x61, 0x73, 0x20, 0x65, 0x76,
- 0x65, 0x6e, 0x74, 0x75, 0x61, 0x6c, 0x6c, 0x79, 0x74, 0x68, 0x72, 0x6f, 0x75,
- 0x67, 0x68, 0x6f, 0x75, 0x74, 0x20, 0x68, 0x69, 0x73, 0x74, 0x68, 0x65, 0x20,
- 0x64, 0x69, 0x66, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63, 0x65, 0x73, 0x6f, 0x6d,
- 0x65, 0x74, 0x68, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x61, 0x74, 0x73, 0x70,
- 0x61, 0x6e, 0x3e, 0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e, 0x3e, 0x3c, 0x2f, 0x73,
- 0x69, 0x67, 0x6e, 0x69, 0x66, 0x69, 0x63, 0x61, 0x6e, 0x74, 0x6c, 0x79, 0x20,
- 0x3e, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x0d, 0x0a, 0x0d,
- 0x0a, 0x65, 0x6e, 0x76, 0x69, 0x72, 0x6f, 0x6e, 0x6d, 0x65, 0x6e, 0x74, 0x61,
- 0x6c, 0x20, 0x74, 0x6f, 0x20, 0x70, 0x72, 0x65, 0x76, 0x65, 0x6e, 0x74, 0x20,
- 0x74, 0x68, 0x65, 0x68, 0x61, 0x76, 0x65, 0x20, 0x62, 0x65, 0x65, 0x6e, 0x20,
- 0x75, 0x73, 0x65, 0x64, 0x65, 0x73, 0x70, 0x65, 0x63, 0x69, 0x61, 0x6c, 0x6c,
- 0x79, 0x20, 0x66, 0x6f, 0x72, 0x75, 0x6e, 0x64, 0x65, 0x72, 0x73, 0x74, 0x61,
- 0x6e, 0x64, 0x20, 0x74, 0x68, 0x65, 0x69, 0x73, 0x20, 0x65, 0x73, 0x73, 0x65,
- 0x6e, 0x74, 0x69, 0x61, 0x6c, 0x6c, 0x79, 0x77, 0x65, 0x72, 0x65, 0x20, 0x74,
- 0x68, 0x65, 0x20, 0x66, 0x69, 0x72, 0x73, 0x74, 0x69, 0x73, 0x20, 0x74, 0x68,
- 0x65, 0x20, 0x6c, 0x61, 0x72, 0x67, 0x65, 0x73, 0x74, 0x68, 0x61, 0x76, 0x65,
- 0x20, 0x62, 0x65, 0x65, 0x6e, 0x20, 0x6d, 0x61, 0x64, 0x65, 0x22, 0x20, 0x73,
- 0x72, 0x63, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x69, 0x6e,
- 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x20, 0x61, 0x73, 0x73,
- 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x20, 0x68, 0x61, 0x6c, 0x66, 0x20, 0x6f, 0x66,
- 0x63, 0x72, 0x6f, 0x6c, 0x6c, 0x69, 0x6e, 0x67, 0x3d, 0x22, 0x6e, 0x6f, 0x22,
- 0x20, 0x69, 0x73, 0x20, 0x63, 0x6f, 0x6d, 0x70, 0x6f, 0x73, 0x65, 0x64, 0x20,
- 0x6f, 0x66, 0x49, 0x49, 0x2c, 0x20, 0x48, 0x6f, 0x6c, 0x79, 0x20, 0x52, 0x6f,
- 0x6d, 0x61, 0x6e, 0x69, 0x73, 0x20, 0x65, 0x78, 0x70, 0x65, 0x63, 0x74, 0x65,
- 0x64, 0x20, 0x74, 0x6f, 0x68, 0x61, 0x76, 0x65, 0x20, 0x74, 0x68, 0x65, 0x69,
- 0x72, 0x20, 0x6f, 0x77, 0x6e, 0x64, 0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, 0x20,
- 0x61, 0x73, 0x20, 0x74, 0x68, 0x65, 0x74, 0x72, 0x61, 0x64, 0x69, 0x74, 0x69,
- 0x6f, 0x6e, 0x61, 0x6c, 0x6c, 0x79, 0x20, 0x68, 0x61, 0x76, 0x65, 0x20, 0x64,
- 0x69, 0x66, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x74, 0x61, 0x72, 0x65, 0x20, 0x6f,
- 0x66, 0x74, 0x65, 0x6e, 0x20, 0x75, 0x73, 0x65, 0x64, 0x74, 0x6f, 0x20, 0x65,
- 0x6e, 0x73, 0x75, 0x72, 0x65, 0x20, 0x74, 0x68, 0x61, 0x74, 0x61, 0x67, 0x72,
- 0x65, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x20, 0x77, 0x69, 0x74, 0x68, 0x63, 0x6f,
- 0x6e, 0x74, 0x61, 0x69, 0x6e, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65, 0x61,
- 0x72, 0x65, 0x20, 0x66, 0x72, 0x65, 0x71, 0x75, 0x65, 0x6e, 0x74, 0x6c, 0x79,
- 0x69, 0x6e, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f,
- 0x6e, 0x65, 0x78, 0x61, 0x6d, 0x70, 0x6c, 0x65, 0x20, 0x69, 0x73, 0x20, 0x74,
- 0x68, 0x65, 0x72, 0x65, 0x73, 0x75, 0x6c, 0x74, 0x69, 0x6e, 0x67, 0x20, 0x69,
- 0x6e, 0x20, 0x61, 0x3c, 0x2f, 0x61, 0x3e, 0x3c, 0x2f, 0x6c, 0x69, 0x3e, 0x3c,
- 0x2f, 0x75, 0x6c, 0x3e, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x66,
- 0x6f, 0x6f, 0x74, 0x65, 0x72, 0x61, 0x6e, 0x64, 0x20, 0x65, 0x73, 0x70, 0x65,
- 0x63, 0x69, 0x61, 0x6c, 0x6c, 0x79, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x62,
- 0x75, 0x74, 0x74, 0x6f, 0x6e, 0x22, 0x20, 0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e,
- 0x3e, 0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e, 0x3e, 0x77, 0x68, 0x69, 0x63, 0x68,
- 0x20, 0x69, 0x6e, 0x63, 0x6c, 0x75, 0x64, 0x65, 0x64, 0x3e, 0x0a, 0x3c, 0x6d,
- 0x65, 0x74, 0x61, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x22, 0x63, 0x6f, 0x6e,
- 0x73, 0x69, 0x64, 0x65, 0x72, 0x65, 0x64, 0x20, 0x74, 0x68, 0x65, 0x63, 0x61,
- 0x72, 0x72, 0x69, 0x65, 0x64, 0x20, 0x6f, 0x75, 0x74, 0x20, 0x62, 0x79, 0x48,
- 0x6f, 0x77, 0x65, 0x76, 0x65, 0x72, 0x2c, 0x20, 0x69, 0x74, 0x20, 0x69, 0x73,
- 0x62, 0x65, 0x63, 0x61, 0x6d, 0x65, 0x20, 0x70, 0x61, 0x72, 0x74, 0x20, 0x6f,
- 0x66, 0x69, 0x6e, 0x20, 0x72, 0x65, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20,
- 0x74, 0x6f, 0x70, 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x72, 0x20, 0x69, 0x6e, 0x20,
- 0x74, 0x68, 0x65, 0x74, 0x68, 0x65, 0x20, 0x63, 0x61, 0x70, 0x69, 0x74, 0x61,
- 0x6c, 0x20, 0x6f, 0x66, 0x77, 0x61, 0x73, 0x20, 0x6f, 0x66, 0x66, 0x69, 0x63,
- 0x69, 0x61, 0x6c, 0x6c, 0x79, 0x77, 0x68, 0x69, 0x63, 0x68, 0x20, 0x68, 0x61,
- 0x73, 0x20, 0x62, 0x65, 0x65, 0x6e, 0x74, 0x68, 0x65, 0x20, 0x48, 0x69, 0x73,
- 0x74, 0x6f, 0x72, 0x79, 0x20, 0x6f, 0x66, 0x61, 0x6c, 0x74, 0x65, 0x72, 0x6e,
- 0x61, 0x74, 0x69, 0x76, 0x65, 0x20, 0x74, 0x6f, 0x64, 0x69, 0x66, 0x66, 0x65,
- 0x72, 0x65, 0x6e, 0x74, 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x74, 0x6f, 0x20, 0x73,
- 0x75, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x20, 0x74, 0x68, 0x65, 0x73, 0x75, 0x67,
- 0x67, 0x65, 0x73, 0x74, 0x65, 0x64, 0x20, 0x74, 0x68, 0x61, 0x74, 0x69, 0x6e,
- 0x20, 0x74, 0x68, 0x65, 0x20, 0x70, 0x72, 0x6f, 0x63, 0x65, 0x73, 0x73, 0x20,
- 0x20, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22,
- 0x74, 0x68, 0x65, 0x20, 0x66, 0x6f, 0x75, 0x6e, 0x64, 0x61, 0x74, 0x69, 0x6f,
- 0x6e, 0x62, 0x65, 0x63, 0x61, 0x75, 0x73, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x68,
- 0x69, 0x73, 0x63, 0x6f, 0x6e, 0x63, 0x65, 0x72, 0x6e, 0x65, 0x64, 0x20, 0x77,
- 0x69, 0x74, 0x68, 0x74, 0x68, 0x65, 0x20, 0x75, 0x6e, 0x69, 0x76, 0x65, 0x72,
- 0x73, 0x69, 0x74, 0x79, 0x6f, 0x70, 0x70, 0x6f, 0x73, 0x65, 0x64, 0x20, 0x74,
- 0x6f, 0x20, 0x74, 0x68, 0x65, 0x74, 0x68, 0x65, 0x20, 0x63, 0x6f, 0x6e, 0x74,
- 0x65, 0x78, 0x74, 0x20, 0x6f, 0x66, 0x3c, 0x73, 0x70, 0x61, 0x6e, 0x20, 0x63,
- 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x70, 0x74, 0x65, 0x78, 0x74, 0x22, 0x20,
- 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x22, 0x71, 0x22, 0x09, 0x09, 0x3c, 0x64, 0x69,
- 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x74, 0x68, 0x65, 0x20,
- 0x73, 0x63, 0x69, 0x65, 0x6e, 0x74, 0x69, 0x66, 0x69, 0x63, 0x72, 0x65, 0x70,
- 0x72, 0x65, 0x73, 0x65, 0x6e, 0x74, 0x65, 0x64, 0x20, 0x62, 0x79, 0x6d, 0x61,
- 0x74, 0x68, 0x65, 0x6d, 0x61, 0x74, 0x69, 0x63, 0x69, 0x61, 0x6e, 0x73, 0x65,
- 0x6c, 0x65, 0x63, 0x74, 0x65, 0x64, 0x20, 0x62, 0x79, 0x20, 0x74, 0x68, 0x65,
- 0x74, 0x68, 0x61, 0x74, 0x20, 0x68, 0x61, 0x76, 0x65, 0x20, 0x62, 0x65, 0x65,
- 0x6e, 0x3e, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d,
- 0x22, 0x63, 0x64, 0x69, 0x76, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x68, 0x65, 0x61,
- 0x64, 0x65, 0x72, 0x69, 0x6e, 0x20, 0x70, 0x61, 0x72, 0x74, 0x69, 0x63, 0x75,
- 0x6c, 0x61, 0x72, 0x2c, 0x63, 0x6f, 0x6e, 0x76, 0x65, 0x72, 0x74, 0x65, 0x64,
- 0x20, 0x69, 0x6e, 0x74, 0x6f, 0x29, 0x3b, 0x0a, 0x3c, 0x2f, 0x73, 0x63, 0x72,
- 0x69, 0x70, 0x74, 0x3e, 0x0a, 0x3c, 0x70, 0x68, 0x69, 0x6c, 0x6f, 0x73, 0x6f,
- 0x70, 0x68, 0x69, 0x63, 0x61, 0x6c, 0x20, 0x73, 0x72, 0x70, 0x73, 0x6b, 0x6f,
- 0x68, 0x72, 0x76, 0x61, 0x74, 0x73, 0x6b, 0x69, 0x74, 0x69, 0xe1, 0xba, 0xbf,
- 0x6e, 0x67, 0x20, 0x56, 0x69, 0xe1, 0xbb, 0x87, 0x74, 0xd0, 0xa0, 0xd1, 0x83,
- 0xd1, 0x81, 0xd1, 0x81, 0xd0, 0xba, 0xd0, 0xb8, 0xd0, 0xb9, 0xd1, 0x80, 0xd1,
- 0x83, 0xd1, 0x81, 0xd1, 0x81, 0xd0, 0xba, 0xd0, 0xb8, 0xd0, 0xb9, 0x69, 0x6e,
- 0x76, 0x65, 0x73, 0x74, 0x69, 0x67, 0x61, 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x70,
- 0x61, 0x72, 0x74, 0x69, 0x63, 0x69, 0x70, 0x61, 0x63, 0x69, 0xc3, 0xb3, 0x6e,
- 0xd0, 0xba, 0xd0, 0xbe, 0xd1, 0x82, 0xd0, 0xbe, 0xd1, 0x80, 0xd1, 0x8b, 0xd0,
- 0xb5, 0xd0, 0xbe, 0xd0, 0xb1, 0xd0, 0xbb, 0xd0, 0xb0, 0xd1, 0x81, 0xd1, 0x82,
- 0xd0, 0xb8, 0xd0, 0xba, 0xd0, 0xbe, 0xd1, 0x82, 0xd0, 0xbe, 0xd1, 0x80, 0xd1,
- 0x8b, 0xd0, 0xb9, 0xd1, 0x87, 0xd0, 0xb5, 0xd0, 0xbb, 0xd0, 0xbe, 0xd0, 0xb2,
- 0xd0, 0xb5, 0xd0, 0xba, 0xd1, 0x81, 0xd0, 0xb8, 0xd1, 0x81, 0xd1, 0x82, 0xd0,
- 0xb5, 0xd0, 0xbc, 0xd1, 0x8b, 0xd0, 0x9d, 0xd0, 0xbe, 0xd0, 0xb2, 0xd0, 0xbe,
- 0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xb8, 0xd0, 0xba, 0xd0, 0xbe, 0xd1, 0x82, 0xd0,
- 0xbe, 0xd1, 0x80, 0xd1, 0x8b, 0xd1, 0x85, 0xd0, 0xbe, 0xd0, 0xb1, 0xd0, 0xbb,
- 0xd0, 0xb0, 0xd1, 0x81, 0xd1, 0x82, 0xd1, 0x8c, 0xd0, 0xb2, 0xd1, 0x80, 0xd0,
- 0xb5, 0xd0, 0xbc, 0xd0, 0xb5, 0xd0, 0xbd, 0xd0, 0xb8, 0xd0, 0xba, 0xd0, 0xbe,
- 0xd1, 0x82, 0xd0, 0xbe, 0xd1, 0x80, 0xd0, 0xb0, 0xd1, 0x8f, 0xd1, 0x81, 0xd0,
- 0xb5, 0xd0, 0xb3, 0xd0, 0xbe, 0xd0, 0xb4, 0xd0, 0xbd, 0xd1, 0x8f, 0xd1, 0x81,
- 0xd0, 0xba, 0xd0, 0xb0, 0xd1, 0x87, 0xd0, 0xb0, 0xd1, 0x82, 0xd1, 0x8c, 0xd0,
- 0xbd, 0xd0, 0xbe, 0xd0, 0xb2, 0xd0, 0xbe, 0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xb8,
- 0xd0, 0xa3, 0xd0, 0xba, 0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xb8, 0xd0, 0xbd, 0xd1,
- 0x8b, 0xd0, 0xb2, 0xd0, 0xbe, 0xd0, 0xbf, 0xd1, 0x80, 0xd0, 0xbe, 0xd1, 0x81,
- 0xd1, 0x8b, 0xd0, 0xba, 0xd0, 0xbe, 0xd1, 0x82, 0xd0, 0xbe, 0xd1, 0x80, 0xd0,
- 0xbe, 0xd0, 0xb9, 0xd1, 0x81, 0xd0, 0xb4, 0xd0, 0xb5, 0xd0, 0xbb, 0xd0, 0xb0,
- 0xd1, 0x82, 0xd1, 0x8c, 0xd0, 0xbf, 0xd0, 0xbe, 0xd0, 0xbc, 0xd0, 0xbe, 0xd1,
- 0x89, 0xd1, 0x8c, 0xd1, 0x8e, 0xd1, 0x81, 0xd1, 0x80, 0xd0, 0xb5, 0xd0, 0xb4,
- 0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xb2, 0xd0, 0xbe, 0xd0, 0xb1, 0xd1, 0x80, 0xd0,
- 0xb0, 0xd0, 0xb7, 0xd0, 0xbe, 0xd0, 0xbc, 0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xbe,
- 0xd1, 0x80, 0xd0, 0xbe, 0xd0, 0xbd, 0xd1, 0x8b, 0xd1, 0x83, 0xd1, 0x87, 0xd0,
- 0xb0, 0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xb8, 0xd0, 0xb5, 0xd1, 0x82, 0xd0, 0xb5,
- 0xd1, 0x87, 0xd0, 0xb5, 0xd0, 0xbd, 0xd0, 0xb8, 0xd0, 0xb5, 0xd0, 0x93, 0xd0,
- 0xbb, 0xd0, 0xb0, 0xd0, 0xb2, 0xd0, 0xbd, 0xd0, 0xb0, 0xd1, 0x8f, 0xd0, 0xb8,
- 0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xbe, 0xd1, 0x80, 0xd0, 0xb8, 0xd0, 0xb8, 0xd1,
- 0x81, 0xd0, 0xb8, 0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xb5, 0xd0, 0xbc, 0xd0, 0xb0,
- 0xd1, 0x80, 0xd0, 0xb5, 0xd1, 0x88, 0xd0, 0xb5, 0xd0, 0xbd, 0xd0, 0xb8, 0xd1,
- 0x8f, 0xd0, 0xa1, 0xd0, 0xba, 0xd0, 0xb0, 0xd1, 0x87, 0xd0, 0xb0, 0xd1, 0x82,
- 0xd1, 0x8c, 0xd0, 0xbf, 0xd0, 0xbe, 0xd1, 0x8d, 0xd1, 0x82, 0xd0, 0xbe, 0xd0,
- 0xbc, 0xd1, 0x83, 0xd1, 0x81, 0xd0, 0xbb, 0xd0, 0xb5, 0xd0, 0xb4, 0xd1, 0x83,
- 0xd0, 0xb5, 0xd1, 0x82, 0xd1, 0x81, 0xd0, 0xba, 0xd0, 0xb0, 0xd0, 0xb7, 0xd0,
- 0xb0, 0xd1, 0x82, 0xd1, 0x8c, 0xd1, 0x82, 0xd0, 0xbe, 0xd0, 0xb2, 0xd0, 0xb0,
- 0xd1, 0x80, 0xd0, 0xbe, 0xd0, 0xb2, 0xd0, 0xba, 0xd0, 0xbe, 0xd0, 0xbd, 0xd0,
- 0xb5, 0xd1, 0x87, 0xd0, 0xbd, 0xd0, 0xbe, 0xd1, 0x80, 0xd0, 0xb5, 0xd1, 0x88,
- 0xd0, 0xb5, 0xd0, 0xbd, 0xd0, 0xb8, 0xd0, 0xb5, 0xd0, 0xba, 0xd0, 0xbe, 0xd1,
- 0x82, 0xd0, 0xbe, 0xd1, 0x80, 0xd0, 0xbe, 0xd0, 0xb5, 0xd0, 0xbe, 0xd1, 0x80,
- 0xd0, 0xb3, 0xd0, 0xb0, 0xd0, 0xbd, 0xd0, 0xbe, 0xd0, 0xb2, 0xd0, 0xba, 0xd0,
- 0xbe, 0xd1, 0x82, 0xd0, 0xbe, 0xd1, 0x80, 0xd0, 0xbe, 0xd0, 0xbc, 0xd0, 0xa0,
- 0xd0, 0xb5, 0xd0, 0xba, 0xd0, 0xbb, 0xd0, 0xb0, 0xd0, 0xbc, 0xd0, 0xb0, 0xd8,
- 0xa7, 0xd9, 0x84, 0xd9, 0x85, 0xd9, 0x86, 0xd8, 0xaa, 0xd8, 0xaf, 0xd9, 0x89,
- 0xd9, 0x85, 0xd9, 0x86, 0xd8, 0xaa, 0xd8, 0xaf, 0xd9, 0x8a, 0xd8, 0xa7, 0xd8,
- 0xaa, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x85, 0xd9, 0x88, 0xd8, 0xb6, 0xd9, 0x88,
- 0xd8, 0xb9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa8, 0xd8, 0xb1, 0xd8, 0xa7, 0xd9,
- 0x85, 0xd8, 0xac, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x85, 0xd9, 0x88, 0xd8, 0xa7,
- 0xd9, 0x82, 0xd8, 0xb9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb1, 0xd8, 0xb3, 0xd8,
- 0xa7, 0xd8, 0xa6, 0xd9, 0x84, 0xd9, 0x85, 0xd8, 0xb4, 0xd8, 0xa7, 0xd8, 0xb1,
- 0xd9, 0x83, 0xd8, 0xa7, 0xd8, 0xaa, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa3, 0xd8,
- 0xb9, 0xd8, 0xb6, 0xd8, 0xa7, 0xd8, 0xa1, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb1,
- 0xd9, 0x8a, 0xd8, 0xa7, 0xd8, 0xb6, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8,
- 0xaa, 0xd8, 0xb5, 0xd9, 0x85, 0xd9, 0x8a, 0xd9, 0x85, 0xd8, 0xa7, 0xd9, 0x84,
- 0xd8, 0xa7, 0xd8, 0xb9, 0xd8, 0xb6, 0xd8, 0xa7, 0xd8, 0xa1, 0xd8, 0xa7, 0xd9,
- 0x84, 0xd9, 0x86, 0xd8, 0xaa, 0xd8, 0xa7, 0xd8, 0xa6, 0xd8, 0xac, 0xd8, 0xa7,
- 0xd9, 0x84, 0xd8, 0xa3, 0xd9, 0x84, 0xd8, 0xb9, 0xd8, 0xa7, 0xd8, 0xa8, 0xd8,
- 0xa7, 0xd9, 0x84, 0xd8, 0xaa, 0xd8, 0xb3, 0xd8, 0xac, 0xd9, 0x8a, 0xd9, 0x84,
- 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa3, 0xd9, 0x82, 0xd8, 0xb3, 0xd8, 0xa7, 0xd9,
- 0x85, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb6, 0xd8, 0xba, 0xd8, 0xb7, 0xd8, 0xa7,
- 0xd8, 0xaa, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x81, 0xd9, 0x8a, 0xd8, 0xaf, 0xd9,
- 0x8a, 0xd9, 0x88, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xaa, 0xd8, 0xb1, 0xd8, 0xad,
- 0xd9, 0x8a, 0xd8, 0xa8, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xac, 0xd8, 0xaf, 0xd9,
- 0x8a, 0xd8, 0xaf, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xaa, 0xd8, 0xb9,
- 0xd9, 0x84, 0xd9, 0x8a, 0xd9, 0x85, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa3, 0xd8,
- 0xae, 0xd8, 0xa8, 0xd8, 0xa7, 0xd8, 0xb1, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa7,
- 0xd9, 0x81, 0xd9, 0x84, 0xd8, 0xa7, 0xd9, 0x85, 0xd8, 0xa7, 0xd9, 0x84, 0xd8,
- 0xa3, 0xd9, 0x81, 0xd9, 0x84, 0xd8, 0xa7, 0xd9, 0x85, 0xd8, 0xa7, 0xd9, 0x84,
- 0xd8, 0xaa, 0xd8, 0xa7, 0xd8, 0xb1, 0xd9, 0x8a, 0xd8, 0xae, 0xd8, 0xa7, 0xd9,
- 0x84, 0xd8, 0xaa, 0xd9, 0x82, 0xd9, 0x86, 0xd9, 0x8a, 0xd8, 0xa9, 0xd8, 0xa7,
- 0xd9, 0x84, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb9, 0xd8, 0xa7, 0xd8, 0xa8, 0xd8,
- 0xa7, 0xd9, 0x84, 0xd8, 0xae, 0xd9, 0x88, 0xd8, 0xa7, 0xd8, 0xb7, 0xd8, 0xb1,
- 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x85, 0xd8, 0xac, 0xd8, 0xaa, 0xd9, 0x85, 0xd8,
- 0xb9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xaf, 0xd9, 0x8a, 0xd9, 0x83, 0xd9, 0x88,
- 0xd8, 0xb1, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb3, 0xd9, 0x8a, 0xd8, 0xa7, 0xd8,
- 0xad, 0xd8, 0xa9, 0xd8, 0xb9, 0xd8, 0xa8, 0xd8, 0xaf, 0xd8, 0xa7, 0xd9, 0x84,
- 0xd9, 0x84, 0xd9, 0x87, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xaa, 0xd8, 0xb1, 0xd8,
- 0xa8, 0xd9, 0x8a, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb1, 0xd9, 0x88,
- 0xd8, 0xa7, 0xd8, 0xa8, 0xd8, 0xb7, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa3, 0xd8,
- 0xaf, 0xd8, 0xa8, 0xd9, 0x8a, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa7,
- 0xd8, 0xae, 0xd8, 0xa8, 0xd8, 0xa7, 0xd8, 0xb1, 0xd8, 0xa7, 0xd9, 0x84, 0xd9,
- 0x85, 0xd8, 0xaa, 0xd8, 0xad, 0xd8, 0xaf, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84,
- 0xd8, 0xa7, 0xd8, 0xba, 0xd8, 0xa7, 0xd9, 0x86, 0xd9, 0x8a, 0x63, 0x75, 0x72,
- 0x73, 0x6f, 0x72, 0x3a, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x3b, 0x3c,
- 0x2f, 0x74, 0x69, 0x74, 0x6c, 0x65, 0x3e, 0x0a, 0x3c, 0x6d, 0x65, 0x74, 0x61,
- 0x20, 0x22, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70,
- 0x3a, 0x2f, 0x2f, 0x22, 0x3e, 0x3c, 0x73, 0x70, 0x61, 0x6e, 0x20, 0x63, 0x6c,
- 0x61, 0x73, 0x73, 0x3d, 0x22, 0x6d, 0x65, 0x6d, 0x62, 0x65, 0x72, 0x73, 0x20,
- 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x77, 0x69, 0x6e, 0x64, 0x6f, 0x77,
- 0x2e, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x76, 0x65, 0x72, 0x74,
- 0x69, 0x63, 0x61, 0x6c, 0x2d, 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3a, 0x2f, 0x61,
- 0x3e, 0x20, 0x7c, 0x20, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22,
- 0x3c, 0x21, 0x64, 0x6f, 0x63, 0x74, 0x79, 0x70, 0x65, 0x20, 0x68, 0x74, 0x6d,
- 0x6c, 0x3e, 0x6d, 0x65, 0x64, 0x69, 0x61, 0x3d, 0x22, 0x73, 0x63, 0x72, 0x65,
- 0x65, 0x6e, 0x22, 0x20, 0x3c, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x76,
- 0x61, 0x6c, 0x75, 0x65, 0x3d, 0x22, 0x66, 0x61, 0x76, 0x69, 0x63, 0x6f, 0x6e,
- 0x2e, 0x69, 0x63, 0x6f, 0x22, 0x20, 0x2f, 0x3e, 0x0a, 0x09, 0x09, 0x3c, 0x64,
- 0x69, 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x63, 0x68, 0x61,
- 0x72, 0x61, 0x63, 0x74, 0x65, 0x72, 0x69, 0x73, 0x74, 0x69, 0x63, 0x73, 0x22,
- 0x20, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x3d, 0x22, 0x67, 0x65, 0x74, 0x22,
- 0x20, 0x2f, 0x62, 0x6f, 0x64, 0x79, 0x3e, 0x0a, 0x3c, 0x2f, 0x68, 0x74, 0x6d,
- 0x6c, 0x3e, 0x0a, 0x73, 0x68, 0x6f, 0x72, 0x74, 0x63, 0x75, 0x74, 0x20, 0x69,
- 0x63, 0x6f, 0x6e, 0x22, 0x20, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74,
- 0x2e, 0x77, 0x72, 0x69, 0x74, 0x65, 0x28, 0x70, 0x61, 0x64, 0x64, 0x69, 0x6e,
- 0x67, 0x2d, 0x62, 0x6f, 0x74, 0x74, 0x6f, 0x6d, 0x3a, 0x72, 0x65, 0x70, 0x72,
- 0x65, 0x73, 0x65, 0x6e, 0x74, 0x61, 0x74, 0x69, 0x76, 0x65, 0x73, 0x73, 0x75,
- 0x62, 0x6d, 0x69, 0x74, 0x22, 0x20, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3d, 0x22,
- 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3d, 0x22, 0x63, 0x65, 0x6e, 0x74, 0x65, 0x72,
- 0x22, 0x20, 0x74, 0x68, 0x72, 0x6f, 0x75, 0x67, 0x68, 0x6f, 0x75, 0x74, 0x20,
- 0x74, 0x68, 0x65, 0x20, 0x73, 0x63, 0x69, 0x65, 0x6e, 0x63, 0x65, 0x20, 0x66,
- 0x69, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x0a, 0x20, 0x20, 0x3c, 0x64, 0x69, 0x76,
- 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x73, 0x75, 0x62, 0x6d, 0x69,
- 0x74, 0x22, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x6f, 0x6e, 0x65,
- 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x6d, 0x6f, 0x73, 0x74, 0x20,
- 0x76, 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3d, 0x22, 0x74, 0x6f, 0x70, 0x22, 0x3e,
- 0x3c, 0x77, 0x61, 0x73, 0x20, 0x65, 0x73, 0x74, 0x61, 0x62, 0x6c, 0x69, 0x73,
- 0x68, 0x65, 0x64, 0x29, 0x3b, 0x0d, 0x0a, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69,
- 0x70, 0x74, 0x3e, 0x0d, 0x0a, 0x72, 0x65, 0x74, 0x75, 0x72, 0x6e, 0x20, 0x66,
- 0x61, 0x6c, 0x73, 0x65, 0x3b, 0x22, 0x3e, 0x29, 0x2e, 0x73, 0x74, 0x79, 0x6c,
- 0x65, 0x2e, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x62, 0x65, 0x63, 0x61,
- 0x75, 0x73, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x64, 0x6f,
- 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x2e, 0x63, 0x6f, 0x6f, 0x6b, 0x69, 0x65,
- 0x3c, 0x66, 0x6f, 0x72, 0x6d, 0x20, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x3d,
- 0x22, 0x2f, 0x7d, 0x62, 0x6f, 0x64, 0x79, 0x7b, 0x6d, 0x61, 0x72, 0x67, 0x69,
- 0x6e, 0x3a, 0x30, 0x3b, 0x45, 0x6e, 0x63, 0x79, 0x63, 0x6c, 0x6f, 0x70, 0x65,
- 0x64, 0x69, 0x61, 0x20, 0x6f, 0x66, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e,
- 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x2e, 0x63, 0x72, 0x65, 0x61,
- 0x74, 0x65, 0x45, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x28, 0x6e, 0x61, 0x6d,
- 0x65, 0x22, 0x20, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x3d, 0x22, 0x3c,
- 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0a, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0a,
- 0x0a, 0x61, 0x64, 0x6d, 0x69, 0x6e, 0x69, 0x73, 0x74, 0x72, 0x61, 0x74, 0x69,
- 0x76, 0x65, 0x20, 0x3c, 0x2f, 0x62, 0x6f, 0x64, 0x79, 0x3e, 0x0a, 0x3c, 0x2f,
- 0x68, 0x74, 0x6d, 0x6c, 0x3e, 0x68, 0x69, 0x73, 0x74, 0x6f, 0x72, 0x79, 0x20,
- 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x22, 0x3e, 0x3c, 0x69, 0x6e, 0x70,
- 0x75, 0x74, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x70, 0x6f, 0x72, 0x74,
- 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x61, 0x73,
- 0x20, 0x70, 0x61, 0x72, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20,
- 0x26, 0x6e, 0x62, 0x73, 0x70, 0x3b, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66,
- 0x3d, 0x22, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x20, 0x63, 0x6f, 0x75, 0x6e, 0x74,
- 0x72, 0x69, 0x65, 0x73, 0x22, 0x3e, 0x0a, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x63,
- 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e, 0x3e,
- 0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e, 0x3e, 0x3c, 0x49, 0x6e, 0x20, 0x6f, 0x74,
- 0x68, 0x65, 0x72, 0x20, 0x77, 0x6f, 0x72, 0x64, 0x73, 0x2c, 0x64, 0x69, 0x73,
- 0x70, 0x6c, 0x61, 0x79, 0x3a, 0x20, 0x62, 0x6c, 0x6f, 0x63, 0x6b, 0x3b, 0x63,
- 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65,
- 0x20, 0x69, 0x6e, 0x74, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x74, 0x69, 0x6f, 0x6e,
- 0x20, 0x6f, 0x66, 0x2f, 0x3e, 0x0a, 0x3c, 0x6d, 0x65, 0x74, 0x61, 0x20, 0x6e,
- 0x61, 0x6d, 0x65, 0x3d, 0x22, 0x61, 0x73, 0x20, 0x77, 0x65, 0x6c, 0x6c, 0x20,
- 0x61, 0x73, 0x20, 0x74, 0x68, 0x65, 0x20, 0x69, 0x6e, 0x20, 0x72, 0x65, 0x63,
- 0x65, 0x6e, 0x74, 0x20, 0x79, 0x65, 0x61, 0x72, 0x73, 0x0d, 0x0a, 0x09, 0x3c,
- 0x64, 0x69, 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x3c, 0x2f,
- 0x64, 0x69, 0x76, 0x3e, 0x0a, 0x09, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0a,
- 0x69, 0x6e, 0x73, 0x70, 0x69, 0x72, 0x65, 0x64, 0x20, 0x62, 0x79, 0x20, 0x74,
- 0x68, 0x65, 0x74, 0x68, 0x65, 0x20, 0x65, 0x6e, 0x64, 0x20, 0x6f, 0x66, 0x20,
- 0x74, 0x68, 0x65, 0x20, 0x63, 0x6f, 0x6d, 0x70, 0x61, 0x74, 0x69, 0x62, 0x6c,
- 0x65, 0x20, 0x77, 0x69, 0x74, 0x68, 0x62, 0x65, 0x63, 0x61, 0x6d, 0x65, 0x20,
- 0x6b, 0x6e, 0x6f, 0x77, 0x6e, 0x20, 0x61, 0x73, 0x20, 0x73, 0x74, 0x79, 0x6c,
- 0x65, 0x3d, 0x22, 0x6d, 0x61, 0x72, 0x67, 0x69, 0x6e, 0x3a, 0x2e, 0x6a, 0x73,
- 0x22, 0x3e, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x3c, 0x20,
- 0x49, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c,
- 0x20, 0x74, 0x68, 0x65, 0x72, 0x65, 0x20, 0x68, 0x61, 0x76, 0x65, 0x20, 0x62,
- 0x65, 0x65, 0x6e, 0x47, 0x65, 0x72, 0x6d, 0x61, 0x6e, 0x20, 0x6c, 0x61, 0x6e,
- 0x67, 0x75, 0x61, 0x67, 0x65, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22,
- 0x63, 0x6f, 0x6c, 0x6f, 0x72, 0x3a, 0x23, 0x43, 0x6f, 0x6d, 0x6d, 0x75, 0x6e,
- 0x69, 0x73, 0x74, 0x20, 0x50, 0x61, 0x72, 0x74, 0x79, 0x63, 0x6f, 0x6e, 0x73,
- 0x69, 0x73, 0x74, 0x65, 0x6e, 0x74, 0x20, 0x77, 0x69, 0x74, 0x68, 0x62, 0x6f,
- 0x72, 0x64, 0x65, 0x72, 0x3d, 0x22, 0x30, 0x22, 0x20, 0x63, 0x65, 0x6c, 0x6c,
- 0x20, 0x6d, 0x61, 0x72, 0x67, 0x69, 0x6e, 0x68, 0x65, 0x69, 0x67, 0x68, 0x74,
- 0x3d, 0x22, 0x74, 0x68, 0x65, 0x20, 0x6d, 0x61, 0x6a, 0x6f, 0x72, 0x69, 0x74,
- 0x79, 0x20, 0x6f, 0x66, 0x22, 0x20, 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3d, 0x22,
- 0x63, 0x65, 0x6e, 0x74, 0x65, 0x72, 0x72, 0x65, 0x6c, 0x61, 0x74, 0x65, 0x64,
- 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x20, 0x6d, 0x61, 0x6e, 0x79, 0x20,
- 0x64, 0x69, 0x66, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x74, 0x20, 0x4f, 0x72, 0x74,
- 0x68, 0x6f, 0x64, 0x6f, 0x78, 0x20, 0x43, 0x68, 0x75, 0x72, 0x63, 0x68, 0x73,
- 0x69, 0x6d, 0x69, 0x6c, 0x61, 0x72, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65,
- 0x20, 0x2f, 0x3e, 0x0a, 0x3c, 0x6c, 0x69, 0x6e, 0x6b, 0x20, 0x72, 0x65, 0x6c,
- 0x3d, 0x22, 0x73, 0x77, 0x61, 0x73, 0x20, 0x6f, 0x6e, 0x65, 0x20, 0x6f, 0x66,
- 0x20, 0x74, 0x68, 0x65, 0x20, 0x75, 0x6e, 0x74, 0x69, 0x6c, 0x20, 0x68, 0x69,
- 0x73, 0x20, 0x64, 0x65, 0x61, 0x74, 0x68, 0x7d, 0x29, 0x28, 0x29, 0x3b, 0x0a,
- 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x6f, 0x74, 0x68, 0x65,
- 0x72, 0x20, 0x6c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x73, 0x63, 0x6f,
- 0x6d, 0x70, 0x61, 0x72, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65,
- 0x70, 0x6f, 0x72, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x20, 0x6f, 0x66, 0x20, 0x74,
- 0x68, 0x65, 0x74, 0x68, 0x65, 0x20, 0x4e, 0x65, 0x74, 0x68, 0x65, 0x72, 0x6c,
- 0x61, 0x6e, 0x64, 0x73, 0x74, 0x68, 0x65, 0x20, 0x6d, 0x6f, 0x73, 0x74, 0x20,
- 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x62, 0x61, 0x63, 0x6b, 0x67, 0x72, 0x6f,
- 0x75, 0x6e, 0x64, 0x3a, 0x75, 0x72, 0x6c, 0x28, 0x61, 0x72, 0x67, 0x75, 0x65,
- 0x64, 0x20, 0x74, 0x68, 0x61, 0x74, 0x20, 0x74, 0x68, 0x65, 0x73, 0x63, 0x72,
- 0x6f, 0x6c, 0x6c, 0x69, 0x6e, 0x67, 0x3d, 0x22, 0x6e, 0x6f, 0x22, 0x20, 0x69,
- 0x6e, 0x63, 0x6c, 0x75, 0x64, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x20, 0x74, 0x68,
- 0x65, 0x4e, 0x6f, 0x72, 0x74, 0x68, 0x20, 0x41, 0x6d, 0x65, 0x72, 0x69, 0x63,
- 0x61, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x20, 0x6f,
- 0x66, 0x20, 0x74, 0x68, 0x65, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65,
- 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x74, 0x68, 0x65, 0x20, 0x74, 0x72,
- 0x61, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x64, 0x65, 0x76, 0x65,
- 0x6c, 0x6f, 0x70, 0x6d, 0x65, 0x6e, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x66, 0x72,
- 0x65, 0x71, 0x75, 0x65, 0x6e, 0x74, 0x6c, 0x79, 0x20, 0x75, 0x73, 0x65, 0x64,
- 0x61, 0x20, 0x63, 0x6f, 0x6c, 0x6c, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x20,
- 0x6f, 0x66, 0x76, 0x65, 0x72, 0x79, 0x20, 0x73, 0x69, 0x6d, 0x69, 0x6c, 0x61,
- 0x72, 0x20, 0x74, 0x6f, 0x73, 0x75, 0x72, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x69,
- 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65, 0x65, 0x78, 0x61, 0x6d, 0x70, 0x6c, 0x65,
- 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x69, 0x73, 0x61, 0x6c, 0x69, 0x67, 0x6e,
- 0x3d, 0x22, 0x63, 0x65, 0x6e, 0x74, 0x65, 0x72, 0x22, 0x3e, 0x77, 0x6f, 0x75,
- 0x6c, 0x64, 0x20, 0x68, 0x61, 0x76, 0x65, 0x20, 0x62, 0x65, 0x65, 0x6e, 0x69,
- 0x6d, 0x61, 0x67, 0x65, 0x5f, 0x63, 0x61, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x20,
- 0x3d, 0x61, 0x74, 0x74, 0x61, 0x63, 0x68, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x20,
- 0x74, 0x68, 0x65, 0x73, 0x75, 0x67, 0x67, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x67,
- 0x20, 0x74, 0x68, 0x61, 0x74, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x66,
- 0x6f, 0x72, 0x6d, 0x20, 0x6f, 0x66, 0x20, 0x69, 0x6e, 0x76, 0x6f, 0x6c, 0x76,
- 0x65, 0x64, 0x20, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x69, 0x73, 0x20, 0x64,
- 0x65, 0x72, 0x69, 0x76, 0x65, 0x64, 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x6e, 0x61,
- 0x6d, 0x65, 0x64, 0x20, 0x61, 0x66, 0x74, 0x65, 0x72, 0x20, 0x74, 0x68, 0x65,
- 0x49, 0x6e, 0x74, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x20,
- 0x74, 0x6f, 0x72, 0x65, 0x73, 0x74, 0x72, 0x69, 0x63, 0x74, 0x69, 0x6f, 0x6e,
- 0x73, 0x20, 0x6f, 0x6e, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x77,
- 0x69, 0x64, 0x74, 0x68, 0x3a, 0x20, 0x63, 0x61, 0x6e, 0x20, 0x62, 0x65, 0x20,
- 0x75, 0x73, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x20, 0x63,
- 0x72, 0x65, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x6d, 0x6f, 0x73,
- 0x74, 0x20, 0x69, 0x6d, 0x70, 0x6f, 0x72, 0x74, 0x61, 0x6e, 0x74, 0x20, 0x69,
- 0x6e, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x61, 0x6e,
- 0x64, 0x72, 0x65, 0x73, 0x75, 0x6c, 0x74, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x20,
- 0x74, 0x68, 0x65, 0x63, 0x6f, 0x6c, 0x6c, 0x61, 0x70, 0x73, 0x65, 0x20, 0x6f,
- 0x66, 0x20, 0x74, 0x68, 0x65, 0x54, 0x68, 0x69, 0x73, 0x20, 0x6d, 0x65, 0x61,
- 0x6e, 0x73, 0x20, 0x74, 0x68, 0x61, 0x74, 0x65, 0x6c, 0x65, 0x6d, 0x65, 0x6e,
- 0x74, 0x73, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x77, 0x61, 0x73, 0x20,
- 0x72, 0x65, 0x70, 0x6c, 0x61, 0x63, 0x65, 0x64, 0x20, 0x62, 0x79, 0x61, 0x6e,
- 0x61, 0x6c, 0x79, 0x73, 0x69, 0x73, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65,
- 0x69, 0x6e, 0x73, 0x70, 0x69, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x66,
- 0x6f, 0x72, 0x72, 0x65, 0x67, 0x61, 0x72, 0x64, 0x65, 0x64, 0x20, 0x61, 0x73,
- 0x20, 0x74, 0x68, 0x65, 0x6d, 0x6f, 0x73, 0x74, 0x20, 0x73, 0x75, 0x63, 0x63,
- 0x65, 0x73, 0x73, 0x66, 0x75, 0x6c, 0x6b, 0x6e, 0x6f, 0x77, 0x6e, 0x20, 0x61,
- 0x73, 0x20, 0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b, 0x61, 0x20, 0x63, 0x6f, 0x6d,
- 0x70, 0x72, 0x65, 0x68, 0x65, 0x6e, 0x73, 0x69, 0x76, 0x65, 0x48, 0x69, 0x73,
- 0x74, 0x6f, 0x72, 0x79, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x77,
- 0x65, 0x72, 0x65, 0x20, 0x63, 0x6f, 0x6e, 0x73, 0x69, 0x64, 0x65, 0x72, 0x65,
- 0x64, 0x72, 0x65, 0x74, 0x75, 0x72, 0x6e, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x20,
- 0x74, 0x68, 0x65, 0x61, 0x72, 0x65, 0x20, 0x72, 0x65, 0x66, 0x65, 0x72, 0x72,
- 0x65, 0x64, 0x20, 0x74, 0x6f, 0x55, 0x6e, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65,
- 0x64, 0x20, 0x69, 0x6d, 0x61, 0x67, 0x65, 0x3e, 0x0a, 0x09, 0x3c, 0x64, 0x69,
- 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x63, 0x6f, 0x6e, 0x73,
- 0x69, 0x73, 0x74, 0x73, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x73, 0x74,
- 0x6f, 0x70, 0x50, 0x72, 0x6f, 0x70, 0x61, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e,
- 0x69, 0x6e, 0x74, 0x65, 0x72, 0x65, 0x73, 0x74, 0x20, 0x69, 0x6e, 0x20, 0x74,
- 0x68, 0x65, 0x61, 0x76, 0x61, 0x69, 0x6c, 0x61, 0x62, 0x69, 0x6c, 0x69, 0x74,
- 0x79, 0x20, 0x6f, 0x66, 0x61, 0x70, 0x70, 0x65, 0x61, 0x72, 0x73, 0x20, 0x74,
- 0x6f, 0x20, 0x68, 0x61, 0x76, 0x65, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x72, 0x6f,
- 0x6d, 0x61, 0x67, 0x6e, 0x65, 0x74, 0x69, 0x63, 0x65, 0x6e, 0x61, 0x62, 0x6c,
- 0x65, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x28, 0x66, 0x75, 0x6e,
- 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x49,
- 0x74, 0x20, 0x69, 0x73, 0x20, 0x69, 0x6d, 0x70, 0x6f, 0x72, 0x74, 0x61, 0x6e,
- 0x74, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x3c, 0x2f, 0x64,
- 0x69, 0x76, 0x3e, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x28, 0x29,
- 0x7b, 0x76, 0x61, 0x72, 0x20, 0x72, 0x65, 0x6c, 0x61, 0x74, 0x69, 0x76, 0x65,
- 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x61, 0x73, 0x20, 0x61, 0x20, 0x72,
- 0x65, 0x73, 0x75, 0x6c, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20,
- 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x46, 0x6f,
- 0x72, 0x20, 0x65, 0x78, 0x61, 0x6d, 0x70, 0x6c, 0x65, 0x2c, 0x20, 0x69, 0x6e,
- 0x20, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x3d, 0x22, 0x70, 0x6f, 0x73, 0x74,
- 0x22, 0x20, 0x77, 0x61, 0x73, 0x20, 0x66, 0x6f, 0x6c, 0x6c, 0x6f, 0x77, 0x65,
- 0x64, 0x20, 0x62, 0x79, 0x26, 0x61, 0x6d, 0x70, 0x3b, 0x6d, 0x64, 0x61, 0x73,
- 0x68, 0x3b, 0x20, 0x74, 0x68, 0x65, 0x74, 0x68, 0x65, 0x20, 0x61, 0x70, 0x70,
- 0x6c, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x6a, 0x73, 0x22, 0x3e, 0x3c,
- 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x0d, 0x0a, 0x75, 0x6c, 0x3e,
- 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x61,
- 0x66, 0x74, 0x65, 0x72, 0x20, 0x74, 0x68, 0x65, 0x20, 0x64, 0x65, 0x61, 0x74,
- 0x68, 0x77, 0x69, 0x74, 0x68, 0x20, 0x72, 0x65, 0x73, 0x70, 0x65, 0x63, 0x74,
- 0x20, 0x74, 0x6f, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x70, 0x61, 0x64,
- 0x64, 0x69, 0x6e, 0x67, 0x3a, 0x69, 0x73, 0x20, 0x70, 0x61, 0x72, 0x74, 0x69,
- 0x63, 0x75, 0x6c, 0x61, 0x72, 0x6c, 0x79, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61,
- 0x79, 0x3a, 0x69, 0x6e, 0x6c, 0x69, 0x6e, 0x65, 0x3b, 0x20, 0x74, 0x79, 0x70,
- 0x65, 0x3d, 0x22, 0x73, 0x75, 0x62, 0x6d, 0x69, 0x74, 0x22, 0x20, 0x69, 0x73,
- 0x20, 0x64, 0x69, 0x76, 0x69, 0x64, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x74, 0x6f,
- 0xe4, 0xb8, 0xad, 0xe6, 0x96, 0x87, 0x20, 0x28, 0xe7, 0xae, 0x80, 0xe4, 0xbd,
- 0x93, 0x29, 0x72, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x61, 0x62, 0x69, 0x6c,
- 0x69, 0x64, 0x61, 0x64, 0x61, 0x64, 0x6d, 0x69, 0x6e, 0x69, 0x73, 0x74, 0x72,
- 0x61, 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61,
- 0x63, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x65, 0x73, 0x63, 0x6f, 0x72, 0x72, 0x65,
- 0x73, 0x70, 0x6f, 0x6e, 0x64, 0x69, 0x65, 0x6e, 0x74, 0x65, 0xe0, 0xa4, 0x89,
- 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xaf, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x97, 0xe0,
- 0xa4, 0xaa, 0xe0, 0xa5, 0x82, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4,
- 0xb5, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb0,
- 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x97, 0xe0,
- 0xa5, 0x8b, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0x9a, 0xe0, 0xa5, 0x81, 0xe0, 0xa4,
- 0xa8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x87,
- 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xb8, 0xe0,
- 0xa4, 0xb0, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4,
- 0xaa, 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xb8,
- 0xe0, 0xa4, 0x96, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x9c, 0xe0, 0xa5, 0x87, 0xe0,
- 0xa4, 0x82, 0xe0, 0xa4, 0x9a, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4,
- 0xbf, 0xe0, 0xa4, 0x8f, 0xe0, 0xa4, 0xad, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x9c,
- 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xb6, 0xe0, 0xa4, 0xbe, 0xe0,
- 0xa4, 0xae, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4,
- 0xae, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0x9c,
- 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xa3, 0xe0,
- 0xa4, 0xac, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5,
- 0x87, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xbe,
- 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xac, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb2, 0xe0,
- 0xa5, 0x89, 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4,
- 0xb2, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xb9,
- 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xaa, 0xe0,
- 0xa5, 0x83, 0xe0, 0xa4, 0xb7, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xa0, 0xe0, 0xa4,
- 0xac, 0xe0, 0xa4, 0xa2, 0xe0, 0xa4, 0xbc, 0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x87,
- 0xe0, 0xa4, 0xad, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xaa, 0xe0,
- 0xa4, 0xbe, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4,
- 0xbf, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0x9f, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb0,
- 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0x96, 0xe0, 0xa4, 0xbf, 0xe0,
- 0xa4, 0xb2, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xab, 0xe0, 0xa4, 0xa6, 0xe0, 0xa5,
- 0x8c, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xae,
- 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x87, 0xe0,
- 0xa4, 0xae, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xa6, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4,
- 0xa8, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xbe,
- 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0x95, 0xe0,
- 0xa4, 0xbe, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4,
- 0xaf, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0x9a, 0xe0, 0xa4, 0xbe,
- 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xaa, 0xe0,
- 0xa4, 0xb9, 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0x81, 0xe0, 0xa4, 0x9a, 0xe0, 0xa4,
- 0xac, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xbe,
- 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xbe, 0xe0,
- 0xa4, 0xa6, 0xe0, 0xa4, 0xa6, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x96, 0xe0, 0xa4,
- 0xa8, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0x9b,
- 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xbf, 0xe0,
- 0xa4, 0xb6, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb7, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4,
- 0xbe, 0xe0, 0xa4, 0x9c, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0x89,
- 0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xb0, 0xe0,
- 0xa4, 0xae, 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xac, 0xe0, 0xa4,
- 0x88, 0xe0, 0xa4, 0xa6, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x8b,
- 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0x89, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0x95, 0xe0,
- 0xa4, 0xb0, 0xe0, 0xa4, 0xa3, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xa2, 0xe0, 0xa4,
- 0xbc, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xb8, 0xe0, 0xa5, 0x8d,
- 0xe0, 0xa4, 0xa5, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xab, 0xe0,
- 0xa4, 0xbf, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xae, 0xe0, 0xa4,
- 0xae, 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0x96, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xaf,
- 0xe0, 0xa4, 0x85, 0xe0, 0xa4, 0x9a, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0x9b, 0xe0,
- 0xa4, 0xbe, 0xe0, 0xa4, 0x9b, 0xe0, 0xa5, 0x82, 0xe0, 0xa4, 0x9f, 0xe0, 0xa4,
- 0xa4, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0x97,
- 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xbe, 0xe0,
- 0xa4, 0x8f, 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4,
- 0xbf, 0xe0, 0xa4, 0xad, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0x98,
- 0xe0, 0xa4, 0xa3, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0x9f, 0xe0, 0xa5, 0x87, 0xe0,
- 0xa4, 0xa6, 0xe0, 0xa5, 0x82, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5,
- 0x87, 0xe0, 0xa4, 0xa6, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x8b,
- 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x8d, 0xe0,
- 0xa4, 0xaf, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb8, 0xe0, 0xa5, 0x87, 0xe0, 0xa4,
- 0x95, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0xbe,
- 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xa7, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xb5, 0xe0,
- 0xa4, 0xbf, 0xe0, 0xa4, 0xb6, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4,
- 0xb0, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x82,
- 0xe0, 0xa4, 0xa6, 0xe0, 0xa5, 0x88, 0xe0, 0xa4, 0x9f, 0xe0, 0xa5, 0x8d, 0xe0,
- 0xa4, 0xb8, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4,
- 0xb6, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xae,
- 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x85, 0xe0, 0xa4, 0xa6, 0xe0,
- 0xa4, 0xbe, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xac, 0xe0, 0xa4,
- 0xbf, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xaa,
- 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x82, 0xe0, 0xa4, 0xb7, 0xe0,
- 0xa4, 0xb9, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xa6, 0xe0, 0xa5,
- 0x80, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x8d,
- 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xbf, 0xe0,
- 0xa4, 0xa4, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x81, 0xe0, 0xa4,
- 0xaa, 0xe0, 0xa4, 0xaf, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb8, 0xe0, 0xa5, 0x8d,
- 0xe0, 0xa4, 0xa5, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0x95, 0xe0,
- 0xa4, 0xb0, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0xa1, 0xe0, 0xa4, 0xbc, 0xe0, 0xa4,
- 0xae, 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xa4,
- 0xe0, 0xa4, 0xaf, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xa8, 0xe0,
- 0xa4, 0xbe, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x83, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4,
- 0xaf, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xaa, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0xb8,
- 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0x9f, 0xe0, 0xa4, 0x98, 0xe0, 0xa4, 0xb0, 0xe0,
- 0xa5, 0x87, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x82, 0xe0, 0xa4, 0x95, 0xe0, 0xa4,
- 0xbe, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xb5,
- 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0x9a, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb0, 0xe0,
- 0xa4, 0xb8, 0xe0, 0xa5, 0x82, 0xe0, 0xa4, 0x9a, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4,
- 0xbe, 0xe0, 0xa4, 0xae, 0xe0, 0xa5, 0x82, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x8d,
- 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xa6, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x96, 0xe0,
- 0xa5, 0x87, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xae, 0xe0, 0xa5,
- 0x87, 0xe0, 0xa4, 0xb6, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb8, 0xe0, 0xa5, 0x8d,
- 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x82, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xae, 0xe0,
- 0xa5, 0x88, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x87, 0xe0, 0xa4,
- 0xa4, 0xe0, 0xa5, 0x88, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb0,
- 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0x95, 0xe0,
- 0xa5, 0x87, 0x72, 0x73, 0x73, 0x2b, 0x78, 0x6d, 0x6c, 0x22, 0x20, 0x74, 0x69,
- 0x74, 0x6c, 0x65, 0x3d, 0x22, 0x2d, 0x74, 0x79, 0x70, 0x65, 0x22, 0x20, 0x63,
- 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x3d, 0x22, 0x74, 0x69, 0x74, 0x6c, 0x65,
- 0x22, 0x20, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x3d, 0x22, 0x61, 0x74,
- 0x20, 0x74, 0x68, 0x65, 0x20, 0x73, 0x61, 0x6d, 0x65, 0x20, 0x74, 0x69, 0x6d,
- 0x65, 0x2e, 0x6a, 0x73, 0x22, 0x3e, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70,
- 0x74, 0x3e, 0x0a, 0x3c, 0x22, 0x20, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x3d,
- 0x22, 0x70, 0x6f, 0x73, 0x74, 0x22, 0x20, 0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e,
- 0x3e, 0x3c, 0x2f, 0x61, 0x3e, 0x3c, 0x2f, 0x6c, 0x69, 0x3e, 0x76, 0x65, 0x72,
- 0x74, 0x69, 0x63, 0x61, 0x6c, 0x2d, 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3a, 0x74,
- 0x2f, 0x6a, 0x71, 0x75, 0x65, 0x72, 0x79, 0x2e, 0x6d, 0x69, 0x6e, 0x2e, 0x6a,
- 0x73, 0x22, 0x3e, 0x2e, 0x63, 0x6c, 0x69, 0x63, 0x6b, 0x28, 0x66, 0x75, 0x6e,
- 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x28, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d,
- 0x22, 0x70, 0x61, 0x64, 0x64, 0x69, 0x6e, 0x67, 0x2d, 0x7d, 0x29, 0x28, 0x29,
- 0x3b, 0x0a, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x0a, 0x3c,
- 0x2f, 0x73, 0x70, 0x61, 0x6e, 0x3e, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66,
- 0x3d, 0x22, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74,
- 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x29, 0x3b, 0x20, 0x72, 0x65, 0x74, 0x75, 0x72,
- 0x6e, 0x20, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x3b, 0x74, 0x65, 0x78, 0x74, 0x2d,
- 0x64, 0x65, 0x63, 0x6f, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x3a, 0x20, 0x73,
- 0x63, 0x72, 0x6f, 0x6c, 0x6c, 0x69, 0x6e, 0x67, 0x3d, 0x22, 0x6e, 0x6f, 0x22,
- 0x20, 0x62, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x2d, 0x63, 0x6f, 0x6c, 0x6c, 0x61,
- 0x70, 0x73, 0x65, 0x3a, 0x61, 0x73, 0x73, 0x6f, 0x63, 0x69, 0x61, 0x74, 0x65,
- 0x64, 0x20, 0x77, 0x69, 0x74, 0x68, 0x20, 0x42, 0x61, 0x68, 0x61, 0x73, 0x61,
- 0x20, 0x49, 0x6e, 0x64, 0x6f, 0x6e, 0x65, 0x73, 0x69, 0x61, 0x45, 0x6e, 0x67,
- 0x6c, 0x69, 0x73, 0x68, 0x20, 0x6c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65,
- 0x3c, 0x74, 0x65, 0x78, 0x74, 0x20, 0x78, 0x6d, 0x6c, 0x3a, 0x73, 0x70, 0x61,
- 0x63, 0x65, 0x3d, 0x2e, 0x67, 0x69, 0x66, 0x22, 0x20, 0x62, 0x6f, 0x72, 0x64,
- 0x65, 0x72, 0x3d, 0x22, 0x30, 0x22, 0x3c, 0x2f, 0x62, 0x6f, 0x64, 0x79, 0x3e,
- 0x0a, 0x3c, 0x2f, 0x68, 0x74, 0x6d, 0x6c, 0x3e, 0x0a, 0x6f, 0x76, 0x65, 0x72,
- 0x66, 0x6c, 0x6f, 0x77, 0x3a, 0x68, 0x69, 0x64, 0x64, 0x65, 0x6e, 0x3b, 0x69,
- 0x6d, 0x67, 0x20, 0x73, 0x72, 0x63, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a,
- 0x2f, 0x2f, 0x61, 0x64, 0x64, 0x45, 0x76, 0x65, 0x6e, 0x74, 0x4c, 0x69, 0x73,
- 0x74, 0x65, 0x6e, 0x65, 0x72, 0x72, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x69,
- 0x62, 0x6c, 0x65, 0x20, 0x66, 0x6f, 0x72, 0x20, 0x73, 0x2e, 0x6a, 0x73, 0x22,
- 0x3e, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x0a, 0x2f, 0x66,
- 0x61, 0x76, 0x69, 0x63, 0x6f, 0x6e, 0x2e, 0x69, 0x63, 0x6f, 0x22, 0x20, 0x2f,
- 0x3e, 0x6f, 0x70, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6e, 0x67, 0x20, 0x73, 0x79,
- 0x73, 0x74, 0x65, 0x6d, 0x22, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22,
- 0x77, 0x69, 0x64, 0x74, 0x68, 0x3a, 0x31, 0x74, 0x61, 0x72, 0x67, 0x65, 0x74,
- 0x3d, 0x22, 0x5f, 0x62, 0x6c, 0x61, 0x6e, 0x6b, 0x22, 0x3e, 0x53, 0x74, 0x61,
- 0x74, 0x65, 0x20, 0x55, 0x6e, 0x69, 0x76, 0x65, 0x72, 0x73, 0x69, 0x74, 0x79,
- 0x74, 0x65, 0x78, 0x74, 0x2d, 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3a, 0x6c, 0x65,
- 0x66, 0x74, 0x3b, 0x0a, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x2e,
- 0x77, 0x72, 0x69, 0x74, 0x65, 0x28, 0x2c, 0x20, 0x69, 0x6e, 0x63, 0x6c, 0x75,
- 0x64, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65, 0x20, 0x61, 0x72, 0x6f, 0x75,
- 0x6e, 0x64, 0x20, 0x74, 0x68, 0x65, 0x20, 0x77, 0x6f, 0x72, 0x6c, 0x64, 0x29,
- 0x3b, 0x0d, 0x0a, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x0d,
- 0x0a, 0x3c, 0x22, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x68, 0x65,
- 0x69, 0x67, 0x68, 0x74, 0x3a, 0x3b, 0x6f, 0x76, 0x65, 0x72, 0x66, 0x6c, 0x6f,
- 0x77, 0x3a, 0x68, 0x69, 0x64, 0x64, 0x65, 0x6e, 0x6d, 0x6f, 0x72, 0x65, 0x20,
- 0x69, 0x6e, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6e,
- 0x20, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61,
- 0x6c, 0x61, 0x20, 0x6d, 0x65, 0x6d, 0x62, 0x65, 0x72, 0x20, 0x6f, 0x66, 0x20,
- 0x74, 0x68, 0x65, 0x20, 0x6f, 0x6e, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68,
- 0x65, 0x20, 0x66, 0x69, 0x72, 0x73, 0x74, 0x63, 0x61, 0x6e, 0x20, 0x62, 0x65,
- 0x20, 0x66, 0x6f, 0x75, 0x6e, 0x64, 0x20, 0x69, 0x6e, 0x20, 0x3c, 0x2f, 0x64,
- 0x69, 0x76, 0x3e, 0x0a, 0x09, 0x09, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0a,
- 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x3a, 0x20, 0x6e, 0x6f, 0x6e, 0x65,
- 0x3b, 0x22, 0x3e, 0x22, 0x20, 0x2f, 0x3e, 0x0a, 0x3c, 0x6c, 0x69, 0x6e, 0x6b,
- 0x20, 0x72, 0x65, 0x6c, 0x3d, 0x22, 0x0a, 0x20, 0x20, 0x28, 0x66, 0x75, 0x6e,
- 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x28, 0x29, 0x20, 0x7b, 0x74, 0x68, 0x65, 0x20,
- 0x31, 0x35, 0x74, 0x68, 0x20, 0x63, 0x65, 0x6e, 0x74, 0x75, 0x72, 0x79, 0x2e,
- 0x70, 0x72, 0x65, 0x76, 0x65, 0x6e, 0x74, 0x44, 0x65, 0x66, 0x61, 0x75, 0x6c,
- 0x74, 0x28, 0x6c, 0x61, 0x72, 0x67, 0x65, 0x20, 0x6e, 0x75, 0x6d, 0x62, 0x65,
- 0x72, 0x20, 0x6f, 0x66, 0x20, 0x42, 0x79, 0x7a, 0x61, 0x6e, 0x74, 0x69, 0x6e,
- 0x65, 0x20, 0x45, 0x6d, 0x70, 0x69, 0x72, 0x65, 0x2e, 0x6a, 0x70, 0x67, 0x7c,
- 0x74, 0x68, 0x75, 0x6d, 0x62, 0x7c, 0x6c, 0x65, 0x66, 0x74, 0x7c, 0x76, 0x61,
- 0x73, 0x74, 0x20, 0x6d, 0x61, 0x6a, 0x6f, 0x72, 0x69, 0x74, 0x79, 0x20, 0x6f,
- 0x66, 0x6d, 0x61, 0x6a, 0x6f, 0x72, 0x69, 0x74, 0x79, 0x20, 0x6f, 0x66, 0x20,
- 0x74, 0x68, 0x65, 0x20, 0x20, 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3d, 0x22, 0x63,
- 0x65, 0x6e, 0x74, 0x65, 0x72, 0x22, 0x3e, 0x55, 0x6e, 0x69, 0x76, 0x65, 0x72,
- 0x73, 0x69, 0x74, 0x79, 0x20, 0x50, 0x72, 0x65, 0x73, 0x73, 0x64, 0x6f, 0x6d,
- 0x69, 0x6e, 0x61, 0x74, 0x65, 0x64, 0x20, 0x62, 0x79, 0x20, 0x74, 0x68, 0x65,
- 0x53, 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x20, 0x57, 0x6f, 0x72, 0x6c, 0x64, 0x20,
- 0x57, 0x61, 0x72, 0x64, 0x69, 0x73, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x69,
- 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22,
- 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x3a, 0x74, 0x68, 0x65, 0x20,
- 0x72, 0x65, 0x73, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x63,
- 0x68, 0x61, 0x72, 0x61, 0x63, 0x74, 0x65, 0x72, 0x69, 0x7a, 0x65, 0x64, 0x20,
- 0x62, 0x79, 0x20, 0x72, 0x65, 0x6c, 0x3d, 0x22, 0x6e, 0x6f, 0x66, 0x6f, 0x6c,
- 0x6c, 0x6f, 0x77, 0x22, 0x3e, 0x64, 0x65, 0x72, 0x69, 0x76, 0x65, 0x73, 0x20,
- 0x66, 0x72, 0x6f, 0x6d, 0x20, 0x74, 0x68, 0x65, 0x72, 0x61, 0x74, 0x68, 0x65,
- 0x72, 0x20, 0x74, 0x68, 0x61, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x61, 0x20,
- 0x63, 0x6f, 0x6d, 0x62, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f,
- 0x66, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x77, 0x69, 0x64, 0x74, 0x68,
- 0x3a, 0x31, 0x30, 0x30, 0x45, 0x6e, 0x67, 0x6c, 0x69, 0x73, 0x68, 0x2d, 0x73,
- 0x70, 0x65, 0x61, 0x6b, 0x69, 0x6e, 0x67, 0x63, 0x6f, 0x6d, 0x70, 0x75, 0x74,
- 0x65, 0x72, 0x20, 0x73, 0x63, 0x69, 0x65, 0x6e, 0x63, 0x65, 0x62, 0x6f, 0x72,
- 0x64, 0x65, 0x72, 0x3d, 0x22, 0x30, 0x22, 0x20, 0x61, 0x6c, 0x74, 0x3d, 0x22,
- 0x74, 0x68, 0x65, 0x20, 0x65, 0x78, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x63, 0x65,
- 0x20, 0x6f, 0x66, 0x44, 0x65, 0x6d, 0x6f, 0x63, 0x72, 0x61, 0x74, 0x69, 0x63,
- 0x20, 0x50, 0x61, 0x72, 0x74, 0x79, 0x22, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65,
- 0x3d, 0x22, 0x6d, 0x61, 0x72, 0x67, 0x69, 0x6e, 0x2d, 0x46, 0x6f, 0x72, 0x20,
- 0x74, 0x68, 0x69, 0x73, 0x20, 0x72, 0x65, 0x61, 0x73, 0x6f, 0x6e, 0x2c, 0x2e,
- 0x6a, 0x73, 0x22, 0x3e, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e,
- 0x0a, 0x09, 0x73, 0x42, 0x79, 0x54, 0x61, 0x67, 0x4e, 0x61, 0x6d, 0x65, 0x28,
- 0x73, 0x29, 0x5b, 0x30, 0x5d, 0x6a, 0x73, 0x22, 0x3e, 0x3c, 0x2f, 0x73, 0x63,
- 0x72, 0x69, 0x70, 0x74, 0x3e, 0x0d, 0x0a, 0x3c, 0x2e, 0x6a, 0x73, 0x22, 0x3e,
- 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x0d, 0x0a, 0x6c, 0x69,
- 0x6e, 0x6b, 0x20, 0x72, 0x65, 0x6c, 0x3d, 0x22, 0x69, 0x63, 0x6f, 0x6e, 0x22,
- 0x20, 0x27, 0x20, 0x61, 0x6c, 0x74, 0x3d, 0x27, 0x27, 0x20, 0x63, 0x6c, 0x61,
- 0x73, 0x73, 0x3d, 0x27, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x69, 0x6f, 0x6e,
- 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f,
- 0x6e, 0x73, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x3c, 0x2f, 0x61,
- 0x3e, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e,
- 0x2f, 0x70, 0x61, 0x67, 0x65, 0x3e, 0x0a, 0x20, 0x20, 0x3c, 0x70, 0x61, 0x67,
- 0x65, 0x3e, 0x0a, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73,
- 0x3d, 0x22, 0x63, 0x6f, 0x6e, 0x74, 0x62, 0x65, 0x63, 0x61, 0x6d, 0x65, 0x20,
- 0x74, 0x68, 0x65, 0x20, 0x66, 0x69, 0x72, 0x73, 0x74, 0x62, 0x61, 0x68, 0x61,
- 0x73, 0x61, 0x20, 0x49, 0x6e, 0x64, 0x6f, 0x6e, 0x65, 0x73, 0x69, 0x61, 0x65,
- 0x6e, 0x67, 0x6c, 0x69, 0x73, 0x68, 0x20, 0x28, 0x73, 0x69, 0x6d, 0x70, 0x6c,
- 0x65, 0x29, 0xce, 0x95, 0xce, 0xbb, 0xce, 0xbb, 0xce, 0xb7, 0xce, 0xbd, 0xce,
- 0xb9, 0xce, 0xba, 0xce, 0xac, 0xd1, 0x85, 0xd1, 0x80, 0xd0, 0xb2, 0xd0, 0xb0,
- 0xd1, 0x82, 0xd1, 0x81, 0xd0, 0xba, 0xd0, 0xb8, 0xd0, 0xba, 0xd0, 0xbe, 0xd0,
- 0xbc, 0xd0, 0xbf, 0xd0, 0xb0, 0xd0, 0xbd, 0xd0, 0xb8, 0xd0, 0xb8, 0xd1, 0x8f,
- 0xd0, 0xb2, 0xd0, 0xbb, 0xd1, 0x8f, 0xd0, 0xb5, 0xd1, 0x82, 0xd1, 0x81, 0xd1,
- 0x8f, 0xd0, 0x94, 0xd0, 0xbe, 0xd0, 0xb1, 0xd0, 0xb0, 0xd0, 0xb2, 0xd0, 0xb8,
- 0xd1, 0x82, 0xd1, 0x8c, 0xd1, 0x87, 0xd0, 0xb5, 0xd0, 0xbb, 0xd0, 0xbe, 0xd0,
- 0xb2, 0xd0, 0xb5, 0xd0, 0xba, 0xd0, 0xb0, 0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xb7,
- 0xd0, 0xb2, 0xd0, 0xb8, 0xd1, 0x82, 0xd0, 0xb8, 0xd1, 0x8f, 0xd0, 0x98, 0xd0,
- 0xbd, 0xd1, 0x82, 0xd0, 0xb5, 0xd1, 0x80, 0xd0, 0xbd, 0xd0, 0xb5, 0xd1, 0x82,
- 0xd0, 0x9e, 0xd1, 0x82, 0xd0, 0xb2, 0xd0, 0xb5, 0xd1, 0x82, 0xd0, 0xb8, 0xd1,
- 0x82, 0xd1, 0x8c, 0xd0, 0xbd, 0xd0, 0xb0, 0xd0, 0xbf, 0xd1, 0x80, 0xd0, 0xb8,
- 0xd0, 0xbc, 0xd0, 0xb5, 0xd1, 0x80, 0xd0, 0xb8, 0xd0, 0xbd, 0xd1, 0x82, 0xd0,
- 0xb5, 0xd1, 0x80, 0xd0, 0xbd, 0xd0, 0xb5, 0xd1, 0x82, 0xd0, 0xba, 0xd0, 0xbe,
- 0xd1, 0x82, 0xd0, 0xbe, 0xd1, 0x80, 0xd0, 0xbe, 0xd0, 0xb3, 0xd0, 0xbe, 0xd1,
- 0x81, 0xd1, 0x82, 0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xbd, 0xd0, 0xb8, 0xd1, 0x86,
- 0xd1, 0x8b, 0xd0, 0xba, 0xd0, 0xb0, 0xd1, 0x87, 0xd0, 0xb5, 0xd1, 0x81, 0xd1,
- 0x82, 0xd0, 0xb2, 0xd0, 0xb5, 0xd1, 0x83, 0xd1, 0x81, 0xd0, 0xbb, 0xd0, 0xbe,
- 0xd0, 0xb2, 0xd0, 0xb8, 0xd1, 0x8f, 0xd1, 0x85, 0xd0, 0xbf, 0xd1, 0x80, 0xd0,
- 0xbe, 0xd0, 0xb1, 0xd0, 0xbb, 0xd0, 0xb5, 0xd0, 0xbc, 0xd1, 0x8b, 0xd0, 0xbf,
- 0xd0, 0xbe, 0xd0, 0xbb, 0xd1, 0x83, 0xd1, 0x87, 0xd0, 0xb8, 0xd1, 0x82, 0xd1,
- 0x8c, 0xd1, 0x8f, 0xd0, 0xb2, 0xd0, 0xbb, 0xd1, 0x8f, 0xd1, 0x8e, 0xd1, 0x82,
- 0xd1, 0x81, 0xd1, 0x8f, 0xd0, 0xbd, 0xd0, 0xb0, 0xd0, 0xb8, 0xd0, 0xb1, 0xd0,
- 0xbe, 0xd0, 0xbb, 0xd0, 0xb5, 0xd0, 0xb5, 0xd0, 0xba, 0xd0, 0xbe, 0xd0, 0xbc,
- 0xd0, 0xbf, 0xd0, 0xb0, 0xd0, 0xbd, 0xd0, 0xb8, 0xd1, 0x8f, 0xd0, 0xb2, 0xd0,
- 0xbd, 0xd0, 0xb8, 0xd0, 0xbc, 0xd0, 0xb0, 0xd0, 0xbd, 0xd0, 0xb8, 0xd0, 0xb5,
- 0xd1, 0x81, 0xd1, 0x80, 0xd0, 0xb5, 0xd0, 0xb4, 0xd1, 0x81, 0xd1, 0x82, 0xd0,
- 0xb2, 0xd0, 0xb0, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x85, 0xd9, 0x88, 0xd8, 0xa7,
- 0xd8, 0xb6, 0xd9, 0x8a, 0xd8, 0xb9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb1, 0xd8,
- 0xa6, 0xd9, 0x8a, 0xd8, 0xb3, 0xd9, 0x8a, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84,
- 0xd8, 0xa7, 0xd9, 0x86, 0xd8, 0xaa, 0xd9, 0x82, 0xd8, 0xa7, 0xd9, 0x84, 0xd9,
- 0x85, 0xd8, 0xb4, 0xd8, 0xa7, 0xd8, 0xb1, 0xd9, 0x83, 0xd8, 0xa7, 0xd8, 0xaa,
- 0xd9, 0x83, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb3, 0xd9, 0x8a, 0xd8, 0xa7, 0xd8,
- 0xb1, 0xd8, 0xa7, 0xd8, 0xaa, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x85, 0xd9, 0x83,
- 0xd8, 0xaa, 0xd9, 0x88, 0xd8, 0xa8, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8,
- 0xb3, 0xd8, 0xb9, 0xd9, 0x88, 0xd8, 0xaf, 0xd9, 0x8a, 0xd8, 0xa9, 0xd8, 0xa7,
- 0xd8, 0xad, 0xd8, 0xb5, 0xd8, 0xa7, 0xd8, 0xa6, 0xd9, 0x8a, 0xd8, 0xa7, 0xd8,
- 0xaa, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb9, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x85,
- 0xd9, 0x8a, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb5, 0xd9, 0x88, 0xd8,
- 0xaa, 0xd9, 0x8a, 0xd8, 0xa7, 0xd8, 0xaa, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa7,
- 0xd9, 0x86, 0xd8, 0xaa, 0xd8, 0xb1, 0xd9, 0x86, 0xd8, 0xaa, 0xd8, 0xa7, 0xd9,
- 0x84, 0xd8, 0xaa, 0xd8, 0xb5, 0xd8, 0xa7, 0xd9, 0x85, 0xd9, 0x8a, 0xd9, 0x85,
- 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa5, 0xd8, 0xb3, 0xd9, 0x84, 0xd8, 0xa7, 0xd9,
- 0x85, 0xd9, 0x8a, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x85, 0xd8, 0xb4, 0xd8, 0xa7,
- 0xd8, 0xb1, 0xd9, 0x83, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x85, 0xd8,
- 0xb1, 0xd8, 0xa6, 0xd9, 0x8a, 0xd8, 0xa7, 0xd8, 0xaa, 0x72, 0x6f, 0x62, 0x6f,
- 0x74, 0x73, 0x22, 0x20, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x3d, 0x22,
- 0x3c, 0x64, 0x69, 0x76, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x66, 0x6f, 0x6f, 0x74,
- 0x65, 0x72, 0x22, 0x3e, 0x74, 0x68, 0x65, 0x20, 0x55, 0x6e, 0x69, 0x74, 0x65,
- 0x64, 0x20, 0x53, 0x74, 0x61, 0x74, 0x65, 0x73, 0x3c, 0x69, 0x6d, 0x67, 0x20,
- 0x73, 0x72, 0x63, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x2e,
- 0x6a, 0x70, 0x67, 0x7c, 0x72, 0x69, 0x67, 0x68, 0x74, 0x7c, 0x74, 0x68, 0x75,
- 0x6d, 0x62, 0x7c, 0x2e, 0x6a, 0x73, 0x22, 0x3e, 0x3c, 0x2f, 0x73, 0x63, 0x72,
- 0x69, 0x70, 0x74, 0x3e, 0x0d, 0x0a, 0x3c, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69,
- 0x6f, 0x6e, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x66, 0x72,
- 0x61, 0x6d, 0x65, 0x62, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x3d, 0x22, 0x30, 0x22,
- 0x20, 0x73, 0x22, 0x20, 0x2f, 0x3e, 0x0a, 0x3c, 0x6d, 0x65, 0x74, 0x61, 0x20,
- 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x22, 0x3c, 0x2f, 0x61, 0x3e, 0x3c, 0x2f, 0x64,
- 0x69, 0x76, 0x3e, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x3c, 0x66, 0x6f, 0x6e,
- 0x74, 0x2d, 0x77, 0x65, 0x69, 0x67, 0x68, 0x74, 0x3a, 0x62, 0x6f, 0x6c, 0x64,
- 0x3b, 0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b, 0x20, 0x61, 0x6e, 0x64, 0x20, 0x26,
- 0x71, 0x75, 0x6f, 0x74, 0x3b, 0x64, 0x65, 0x70, 0x65, 0x6e, 0x64, 0x69, 0x6e,
- 0x67, 0x20, 0x6f, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x6d, 0x61, 0x72, 0x67,
- 0x69, 0x6e, 0x3a, 0x30, 0x3b, 0x70, 0x61, 0x64, 0x64, 0x69, 0x6e, 0x67, 0x3a,
- 0x22, 0x20, 0x72, 0x65, 0x6c, 0x3d, 0x22, 0x6e, 0x6f, 0x66, 0x6f, 0x6c, 0x6c,
- 0x6f, 0x77, 0x22, 0x20, 0x50, 0x72, 0x65, 0x73, 0x69, 0x64, 0x65, 0x6e, 0x74,
- 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x74, 0x77, 0x65, 0x6e, 0x74,
- 0x69, 0x65, 0x74, 0x68, 0x20, 0x63, 0x65, 0x6e, 0x74, 0x75, 0x72, 0x79, 0x65,
- 0x76, 0x69, 0x73, 0x69, 0x6f, 0x6e, 0x3e, 0x0a, 0x20, 0x20, 0x3c, 0x2f, 0x70,
- 0x61, 0x67, 0x65, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x65, 0x74, 0x20, 0x45,
- 0x78, 0x70, 0x6c, 0x6f, 0x72, 0x65, 0x72, 0x61, 0x2e, 0x61, 0x73, 0x79, 0x6e,
- 0x63, 0x20, 0x3d, 0x20, 0x74, 0x72, 0x75, 0x65, 0x3b, 0x0d, 0x0a, 0x69, 0x6e,
- 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x61, 0x62, 0x6f,
- 0x75, 0x74, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x68, 0x65,
- 0x61, 0x64, 0x65, 0x72, 0x22, 0x3e, 0x22, 0x20, 0x61, 0x63, 0x74, 0x69, 0x6f,
- 0x6e, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x3c, 0x61, 0x20,
- 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f,
- 0x2f, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x63, 0x6f, 0x6e,
- 0x74, 0x65, 0x6e, 0x74, 0x22, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0d, 0x0a,
- 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0d, 0x0a, 0x3c, 0x64, 0x65, 0x72, 0x69,
- 0x76, 0x65, 0x64, 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x20, 0x74, 0x68, 0x65, 0x20,
- 0x3c, 0x69, 0x6d, 0x67, 0x20, 0x73, 0x72, 0x63, 0x3d, 0x27, 0x68, 0x74, 0x74,
- 0x70, 0x3a, 0x2f, 0x2f, 0x61, 0x63, 0x63, 0x6f, 0x72, 0x64, 0x69, 0x6e, 0x67,
- 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x20, 0x0a, 0x3c, 0x2f, 0x62, 0x6f,
- 0x64, 0x79, 0x3e, 0x0a, 0x3c, 0x2f, 0x68, 0x74, 0x6d, 0x6c, 0x3e, 0x0a, 0x73,
- 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x66, 0x6f, 0x6e, 0x74, 0x2d, 0x73, 0x69,
- 0x7a, 0x65, 0x3a, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x20, 0x6c, 0x61, 0x6e,
- 0x67, 0x75, 0x61, 0x67, 0x65, 0x3d, 0x22, 0x41, 0x72, 0x69, 0x61, 0x6c, 0x2c,
- 0x20, 0x48, 0x65, 0x6c, 0x76, 0x65, 0x74, 0x69, 0x63, 0x61, 0x2c, 0x3c, 0x2f,
- 0x61, 0x3e, 0x3c, 0x73, 0x70, 0x61, 0x6e, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73,
- 0x3d, 0x22, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x3c, 0x73,
- 0x63, 0x72, 0x69, 0x70, 0x74, 0x20, 0x70, 0x6f, 0x6c, 0x69, 0x74, 0x69, 0x63,
- 0x61, 0x6c, 0x20, 0x70, 0x61, 0x72, 0x74, 0x69, 0x65, 0x73, 0x74, 0x64, 0x3e,
- 0x3c, 0x2f, 0x74, 0x72, 0x3e, 0x3c, 0x2f, 0x74, 0x61, 0x62, 0x6c, 0x65, 0x3e,
- 0x3c, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f,
- 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65,
- 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x72, 0x65, 0x6c, 0x3d,
- 0x22, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x73, 0x68, 0x65, 0x65, 0x74, 0x22, 0x20,
- 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x2e, 0x77, 0x72, 0x69, 0x74,
- 0x65, 0x28, 0x27, 0x3c, 0x63, 0x68, 0x61, 0x72, 0x73, 0x65, 0x74, 0x3d, 0x22,
- 0x75, 0x74, 0x66, 0x2d, 0x38, 0x22, 0x3e, 0x0a, 0x62, 0x65, 0x67, 0x69, 0x6e,
- 0x6e, 0x69, 0x6e, 0x67, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x72,
- 0x65, 0x76, 0x65, 0x61, 0x6c, 0x65, 0x64, 0x20, 0x74, 0x68, 0x61, 0x74, 0x20,
- 0x74, 0x68, 0x65, 0x74, 0x65, 0x6c, 0x65, 0x76, 0x69, 0x73, 0x69, 0x6f, 0x6e,
- 0x20, 0x73, 0x65, 0x72, 0x69, 0x65, 0x73, 0x22, 0x20, 0x72, 0x65, 0x6c, 0x3d,
- 0x22, 0x6e, 0x6f, 0x66, 0x6f, 0x6c, 0x6c, 0x6f, 0x77, 0x22, 0x3e, 0x20, 0x74,
- 0x61, 0x72, 0x67, 0x65, 0x74, 0x3d, 0x22, 0x5f, 0x62, 0x6c, 0x61, 0x6e, 0x6b,
- 0x22, 0x3e, 0x63, 0x6c, 0x61, 0x69, 0x6d, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68,
- 0x61, 0x74, 0x20, 0x74, 0x68, 0x65, 0x68, 0x74, 0x74, 0x70, 0x25, 0x33, 0x41,
- 0x25, 0x32, 0x46, 0x25, 0x32, 0x46, 0x77, 0x77, 0x77, 0x2e, 0x6d, 0x61, 0x6e,
- 0x69, 0x66, 0x65, 0x73, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x20, 0x6f,
- 0x66, 0x50, 0x72, 0x69, 0x6d, 0x65, 0x20, 0x4d, 0x69, 0x6e, 0x69, 0x73, 0x74,
- 0x65, 0x72, 0x20, 0x6f, 0x66, 0x69, 0x6e, 0x66, 0x6c, 0x75, 0x65, 0x6e, 0x63,
- 0x65, 0x64, 0x20, 0x62, 0x79, 0x20, 0x74, 0x68, 0x65, 0x63, 0x6c, 0x61, 0x73,
- 0x73, 0x3d, 0x22, 0x63, 0x6c, 0x65, 0x61, 0x72, 0x66, 0x69, 0x78, 0x22, 0x3e,
- 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0d, 0x0a, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e,
- 0x0d, 0x0a, 0x0d, 0x0a, 0x74, 0x68, 0x72, 0x65, 0x65, 0x2d, 0x64, 0x69, 0x6d,
- 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x43, 0x68, 0x75, 0x72, 0x63,
- 0x68, 0x20, 0x6f, 0x66, 0x20, 0x45, 0x6e, 0x67, 0x6c, 0x61, 0x6e, 0x64, 0x6f,
- 0x66, 0x20, 0x4e, 0x6f, 0x72, 0x74, 0x68, 0x20, 0x43, 0x61, 0x72, 0x6f, 0x6c,
- 0x69, 0x6e, 0x61, 0x73, 0x71, 0x75, 0x61, 0x72, 0x65, 0x20, 0x6b, 0x69, 0x6c,
- 0x6f, 0x6d, 0x65, 0x74, 0x72, 0x65, 0x73, 0x2e, 0x61, 0x64, 0x64, 0x45, 0x76,
- 0x65, 0x6e, 0x74, 0x4c, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x64, 0x69,
- 0x73, 0x74, 0x69, 0x6e, 0x63, 0x74, 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x20, 0x74,
- 0x68, 0x65, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x6c, 0x79, 0x20, 0x6b, 0x6e,
- 0x6f, 0x77, 0x6e, 0x20, 0x61, 0x73, 0x50, 0x68, 0x6f, 0x6e, 0x65, 0x74, 0x69,
- 0x63, 0x20, 0x41, 0x6c, 0x70, 0x68, 0x61, 0x62, 0x65, 0x74, 0x64, 0x65, 0x63,
- 0x6c, 0x61, 0x72, 0x65, 0x64, 0x20, 0x74, 0x68, 0x61, 0x74, 0x20, 0x74, 0x68,
- 0x65, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x6c, 0x65, 0x64, 0x20, 0x62,
- 0x79, 0x20, 0x74, 0x68, 0x65, 0x42, 0x65, 0x6e, 0x6a, 0x61, 0x6d, 0x69, 0x6e,
- 0x20, 0x46, 0x72, 0x61, 0x6e, 0x6b, 0x6c, 0x69, 0x6e, 0x72, 0x6f, 0x6c, 0x65,
- 0x2d, 0x70, 0x6c, 0x61, 0x79, 0x69, 0x6e, 0x67, 0x20, 0x67, 0x61, 0x6d, 0x65,
- 0x74, 0x68, 0x65, 0x20, 0x55, 0x6e, 0x69, 0x76, 0x65, 0x72, 0x73, 0x69, 0x74,
- 0x79, 0x20, 0x6f, 0x66, 0x69, 0x6e, 0x20, 0x57, 0x65, 0x73, 0x74, 0x65, 0x72,
- 0x6e, 0x20, 0x45, 0x75, 0x72, 0x6f, 0x70, 0x65, 0x70, 0x65, 0x72, 0x73, 0x6f,
- 0x6e, 0x61, 0x6c, 0x20, 0x63, 0x6f, 0x6d, 0x70, 0x75, 0x74, 0x65, 0x72, 0x50,
- 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x20, 0x47, 0x75, 0x74, 0x65, 0x6e, 0x62,
- 0x65, 0x72, 0x67, 0x72, 0x65, 0x67, 0x61, 0x72, 0x64, 0x6c, 0x65, 0x73, 0x73,
- 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x68, 0x61, 0x73, 0x20, 0x62, 0x65,
- 0x65, 0x6e, 0x20, 0x70, 0x72, 0x6f, 0x70, 0x6f, 0x73, 0x65, 0x64, 0x74, 0x6f,
- 0x67, 0x65, 0x74, 0x68, 0x65, 0x72, 0x20, 0x77, 0x69, 0x74, 0x68, 0x20, 0x74,
- 0x68, 0x65, 0x3e, 0x3c, 0x2f, 0x6c, 0x69, 0x3e, 0x3c, 0x6c, 0x69, 0x20, 0x63,
- 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x69, 0x6e, 0x20, 0x73, 0x6f, 0x6d, 0x65,
- 0x20, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x72, 0x69, 0x65, 0x73, 0x6d, 0x69, 0x6e,
- 0x2e, 0x6a, 0x73, 0x22, 0x3e, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
- 0x3e, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x70, 0x6f, 0x70, 0x75, 0x6c,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x6f, 0x66, 0x66, 0x69, 0x63, 0x69, 0x61, 0x6c,
- 0x20, 0x6c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x3c, 0x69, 0x6d, 0x67,
- 0x20, 0x73, 0x72, 0x63, 0x3d, 0x22, 0x69, 0x6d, 0x61, 0x67, 0x65, 0x73, 0x2f,
- 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x66, 0x69, 0x65, 0x64, 0x20, 0x62, 0x79,
- 0x20, 0x74, 0x68, 0x65, 0x6e, 0x61, 0x74, 0x75, 0x72, 0x61, 0x6c, 0x20, 0x72,
- 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x73, 0x63, 0x6c, 0x61, 0x73, 0x73,
- 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x63,
- 0x61, 0x6e, 0x20, 0x62, 0x65, 0x20, 0x63, 0x6f, 0x6e, 0x73, 0x69, 0x64, 0x65,
- 0x72, 0x65, 0x64, 0x71, 0x75, 0x61, 0x6e, 0x74, 0x75, 0x6d, 0x20, 0x6d, 0x65,
- 0x63, 0x68, 0x61, 0x6e, 0x69, 0x63, 0x73, 0x4e, 0x65, 0x76, 0x65, 0x72, 0x74,
- 0x68, 0x65, 0x6c, 0x65, 0x73, 0x73, 0x2c, 0x20, 0x74, 0x68, 0x65, 0x6d, 0x69,
- 0x6c, 0x6c, 0x69, 0x6f, 0x6e, 0x20, 0x79, 0x65, 0x61, 0x72, 0x73, 0x20, 0x61,
- 0x67, 0x6f, 0x3c, 0x2f, 0x62, 0x6f, 0x64, 0x79, 0x3e, 0x0d, 0x0a, 0x3c, 0x2f,
- 0x68, 0x74, 0x6d, 0x6c, 0x3e, 0x0d, 0xce, 0x95, 0xce, 0xbb, 0xce, 0xbb, 0xce,
- 0xb7, 0xce, 0xbd, 0xce, 0xb9, 0xce, 0xba, 0xce, 0xac, 0x0a, 0x74, 0x61, 0x6b,
- 0x65, 0x20, 0x61, 0x64, 0x76, 0x61, 0x6e, 0x74, 0x61, 0x67, 0x65, 0x20, 0x6f,
- 0x66, 0x61, 0x6e, 0x64, 0x2c, 0x20, 0x61, 0x63, 0x63, 0x6f, 0x72, 0x64, 0x69,
- 0x6e, 0x67, 0x20, 0x74, 0x6f, 0x61, 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74,
- 0x65, 0x64, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x4d, 0x69, 0x63, 0x72,
- 0x6f, 0x73, 0x6f, 0x66, 0x74, 0x20, 0x57, 0x69, 0x6e, 0x64, 0x6f, 0x77, 0x73,
- 0x74, 0x68, 0x65, 0x20, 0x66, 0x69, 0x72, 0x73, 0x74, 0x20, 0x63, 0x65, 0x6e,
- 0x74, 0x75, 0x72, 0x79, 0x75, 0x6e, 0x64, 0x65, 0x72, 0x20, 0x74, 0x68, 0x65,
- 0x20, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x64, 0x69, 0x76, 0x20, 0x63,
- 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73,
- 0x68, 0x6f, 0x72, 0x74, 0x6c, 0x79, 0x20, 0x61, 0x66, 0x74, 0x65, 0x72, 0x20,
- 0x74, 0x68, 0x65, 0x6e, 0x6f, 0x74, 0x61, 0x62, 0x6c, 0x65, 0x20, 0x65, 0x78,
- 0x63, 0x65, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x73, 0x20, 0x6f,
- 0x66, 0x20, 0x74, 0x68, 0x6f, 0x75, 0x73, 0x61, 0x6e, 0x64, 0x73, 0x73, 0x65,
- 0x76, 0x65, 0x72, 0x61, 0x6c, 0x20, 0x64, 0x69, 0x66, 0x66, 0x65, 0x72, 0x65,
- 0x6e, 0x74, 0x61, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x20, 0x74, 0x68, 0x65, 0x20,
- 0x77, 0x6f, 0x72, 0x6c, 0x64, 0x2e, 0x72, 0x65, 0x61, 0x63, 0x68, 0x69, 0x6e,
- 0x67, 0x20, 0x6d, 0x69, 0x6c, 0x69, 0x74, 0x61, 0x72, 0x79, 0x69, 0x73, 0x6f,
- 0x6c, 0x61, 0x74, 0x65, 0x64, 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x20, 0x74, 0x68,
- 0x65, 0x6f, 0x70, 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x74,
- 0x6f, 0x20, 0x74, 0x68, 0x65, 0x74, 0x68, 0x65, 0x20, 0x4f, 0x6c, 0x64, 0x20,
- 0x54, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x65, 0x6e, 0x74, 0x41, 0x66, 0x72, 0x69,
- 0x63, 0x61, 0x6e, 0x20, 0x41, 0x6d, 0x65, 0x72, 0x69, 0x63, 0x61, 0x6e, 0x73,
- 0x69, 0x6e, 0x73, 0x65, 0x72, 0x74, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x74, 0x6f,
- 0x20, 0x74, 0x68, 0x65, 0x73, 0x65, 0x70, 0x61, 0x72, 0x61, 0x74, 0x65, 0x20,
- 0x66, 0x72, 0x6f, 0x6d, 0x20, 0x74, 0x68, 0x65, 0x6d, 0x65, 0x74, 0x72, 0x6f,
- 0x70, 0x6f, 0x6c, 0x69, 0x74, 0x61, 0x6e, 0x20, 0x61, 0x72, 0x65, 0x61, 0x6d,
- 0x61, 0x6b, 0x65, 0x73, 0x20, 0x69, 0x74, 0x20, 0x70, 0x6f, 0x73, 0x73, 0x69,
- 0x62, 0x6c, 0x65, 0x61, 0x63, 0x6b, 0x6e, 0x6f, 0x77, 0x6c, 0x65, 0x64, 0x67,
- 0x65, 0x64, 0x20, 0x74, 0x68, 0x61, 0x74, 0x61, 0x72, 0x67, 0x75, 0x61, 0x62,
- 0x6c, 0x79, 0x20, 0x74, 0x68, 0x65, 0x20, 0x6d, 0x6f, 0x73, 0x74, 0x74, 0x79,
- 0x70, 0x65, 0x3d, 0x22, 0x74, 0x65, 0x78, 0x74, 0x2f, 0x63, 0x73, 0x73, 0x22,
- 0x3e, 0x0a, 0x74, 0x68, 0x65, 0x20, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61,
- 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x41, 0x63, 0x63, 0x6f, 0x72, 0x64, 0x69,
- 0x6e, 0x67, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x20, 0x70, 0x65, 0x3d,
- 0x22, 0x74, 0x65, 0x78, 0x74, 0x2f, 0x63, 0x73, 0x73, 0x22, 0x20, 0x2f, 0x3e,
- 0x0a, 0x63, 0x6f, 0x69, 0x6e, 0x63, 0x69, 0x64, 0x65, 0x20, 0x77, 0x69, 0x74,
- 0x68, 0x20, 0x74, 0x68, 0x65, 0x74, 0x77, 0x6f, 0x2d, 0x74, 0x68, 0x69, 0x72,
- 0x64, 0x73, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x44, 0x75, 0x72, 0x69,
- 0x6e, 0x67, 0x20, 0x74, 0x68, 0x69, 0x73, 0x20, 0x74, 0x69, 0x6d, 0x65, 0x2c,
- 0x64, 0x75, 0x72, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65, 0x20, 0x70, 0x65,
- 0x72, 0x69, 0x6f, 0x64, 0x61, 0x6e, 0x6e, 0x6f, 0x75, 0x6e, 0x63, 0x65, 0x64,
- 0x20, 0x74, 0x68, 0x61, 0x74, 0x20, 0x68, 0x65, 0x74, 0x68, 0x65, 0x20, 0x69,
- 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x61,
- 0x6e, 0x64, 0x20, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x72, 0x65, 0x63, 0x65, 0x6e,
- 0x74, 0x6c, 0x79, 0x62, 0x65, 0x6c, 0x69, 0x65, 0x76, 0x65, 0x64, 0x20, 0x74,
- 0x68, 0x61, 0x74, 0x20, 0x74, 0x68, 0x65, 0x63, 0x6f, 0x6e, 0x73, 0x63, 0x69,
- 0x6f, 0x75, 0x73, 0x6e, 0x65, 0x73, 0x73, 0x20, 0x61, 0x6e, 0x64, 0x66, 0x6f,
- 0x72, 0x6d, 0x65, 0x72, 0x6c, 0x79, 0x20, 0x6b, 0x6e, 0x6f, 0x77, 0x6e, 0x20,
- 0x61, 0x73, 0x73, 0x75, 0x72, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x65, 0x64, 0x20,
- 0x62, 0x79, 0x20, 0x74, 0x68, 0x65, 0x66, 0x69, 0x72, 0x73, 0x74, 0x20, 0x61,
- 0x70, 0x70, 0x65, 0x61, 0x72, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x6f, 0x63, 0x63,
- 0x61, 0x73, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x6c, 0x79, 0x20, 0x75, 0x73, 0x65,
- 0x64, 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x3a, 0x61, 0x62, 0x73,
- 0x6f, 0x6c, 0x75, 0x74, 0x65, 0x3b, 0x22, 0x20, 0x74, 0x61, 0x72, 0x67, 0x65,
- 0x74, 0x3d, 0x22, 0x5f, 0x62, 0x6c, 0x61, 0x6e, 0x6b, 0x22, 0x20, 0x70, 0x6f,
- 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x3a, 0x72, 0x65, 0x6c, 0x61, 0x74, 0x69,
- 0x76, 0x65, 0x3b, 0x74, 0x65, 0x78, 0x74, 0x2d, 0x61, 0x6c, 0x69, 0x67, 0x6e,
- 0x3a, 0x63, 0x65, 0x6e, 0x74, 0x65, 0x72, 0x3b, 0x6a, 0x61, 0x78, 0x2f, 0x6c,
- 0x69, 0x62, 0x73, 0x2f, 0x6a, 0x71, 0x75, 0x65, 0x72, 0x79, 0x2f, 0x31, 0x2e,
- 0x62, 0x61, 0x63, 0x6b, 0x67, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x2d, 0x63, 0x6f,
- 0x6c, 0x6f, 0x72, 0x3a, 0x23, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x61, 0x70,
- 0x70, 0x6c, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2f, 0x61, 0x6e, 0x67,
- 0x75, 0x61, 0x67, 0x65, 0x22, 0x20, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74,
- 0x3d, 0x22, 0x3c, 0x6d, 0x65, 0x74, 0x61, 0x20, 0x68, 0x74, 0x74, 0x70, 0x2d,
- 0x65, 0x71, 0x75, 0x69, 0x76, 0x3d, 0x22, 0x50, 0x72, 0x69, 0x76, 0x61, 0x63,
- 0x79, 0x20, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x3c, 0x2f, 0x61, 0x3e, 0x65,
- 0x28, 0x22, 0x25, 0x33, 0x43, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x20, 0x73,
- 0x72, 0x63, 0x3d, 0x27, 0x22, 0x20, 0x74, 0x61, 0x72, 0x67, 0x65, 0x74, 0x3d,
- 0x22, 0x5f, 0x62, 0x6c, 0x61, 0x6e, 0x6b, 0x22, 0x3e, 0x4f, 0x6e, 0x20, 0x74,
- 0x68, 0x65, 0x20, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x20, 0x68, 0x61, 0x6e, 0x64,
- 0x2c, 0x2e, 0x6a, 0x70, 0x67, 0x7c, 0x74, 0x68, 0x75, 0x6d, 0x62, 0x7c, 0x72,
- 0x69, 0x67, 0x68, 0x74, 0x7c, 0x32, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x3c,
- 0x64, 0x69, 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x3c, 0x64,
- 0x69, 0x76, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x66, 0x6c, 0x6f,
- 0x61, 0x74, 0x3a, 0x6e, 0x69, 0x6e, 0x65, 0x74, 0x65, 0x65, 0x6e, 0x74, 0x68,
- 0x20, 0x63, 0x65, 0x6e, 0x74, 0x75, 0x72, 0x79, 0x3c, 0x2f, 0x62, 0x6f, 0x64,
- 0x79, 0x3e, 0x0d, 0x0a, 0x3c, 0x2f, 0x68, 0x74, 0x6d, 0x6c, 0x3e, 0x0d, 0x0a,
- 0x3c, 0x69, 0x6d, 0x67, 0x20, 0x73, 0x72, 0x63, 0x3d, 0x22, 0x68, 0x74, 0x74,
- 0x70, 0x3a, 0x2f, 0x2f, 0x73, 0x3b, 0x74, 0x65, 0x78, 0x74, 0x2d, 0x61, 0x6c,
- 0x69, 0x67, 0x6e, 0x3a, 0x63, 0x65, 0x6e, 0x74, 0x65, 0x72, 0x66, 0x6f, 0x6e,
- 0x74, 0x2d, 0x77, 0x65, 0x69, 0x67, 0x68, 0x74, 0x3a, 0x20, 0x62, 0x6f, 0x6c,
- 0x64, 0x3b, 0x20, 0x41, 0x63, 0x63, 0x6f, 0x72, 0x64, 0x69, 0x6e, 0x67, 0x20,
- 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x20, 0x64, 0x69, 0x66, 0x66, 0x65, 0x72,
- 0x65, 0x6e, 0x63, 0x65, 0x20, 0x62, 0x65, 0x74, 0x77, 0x65, 0x65, 0x6e, 0x22,
- 0x20, 0x66, 0x72, 0x61, 0x6d, 0x65, 0x62, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x3d,
- 0x22, 0x30, 0x22, 0x20, 0x22, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22,
- 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x3a, 0x6c, 0x69, 0x6e, 0x6b,
- 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f,
- 0x2f, 0x68, 0x74, 0x6d, 0x6c, 0x34, 0x2f, 0x6c, 0x6f, 0x6f, 0x73, 0x65, 0x2e,
- 0x64, 0x74, 0x64, 0x22, 0x3e, 0x0a, 0x64, 0x75, 0x72, 0x69, 0x6e, 0x67, 0x20,
- 0x74, 0x68, 0x69, 0x73, 0x20, 0x70, 0x65, 0x72, 0x69, 0x6f, 0x64, 0x3c, 0x2f,
- 0x74, 0x64, 0x3e, 0x3c, 0x2f, 0x74, 0x72, 0x3e, 0x3c, 0x2f, 0x74, 0x61, 0x62,
- 0x6c, 0x65, 0x3e, 0x63, 0x6c, 0x6f, 0x73, 0x65, 0x6c, 0x79, 0x20, 0x72, 0x65,
- 0x6c, 0x61, 0x74, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x66, 0x6f, 0x72, 0x20, 0x74,
- 0x68, 0x65, 0x20, 0x66, 0x69, 0x72, 0x73, 0x74, 0x20, 0x74, 0x69, 0x6d, 0x65,
- 0x3b, 0x66, 0x6f, 0x6e, 0x74, 0x2d, 0x77, 0x65, 0x69, 0x67, 0x68, 0x74, 0x3a,
- 0x62, 0x6f, 0x6c, 0x64, 0x3b, 0x69, 0x6e, 0x70, 0x75, 0x74, 0x20, 0x74, 0x79,
- 0x70, 0x65, 0x3d, 0x22, 0x74, 0x65, 0x78, 0x74, 0x22, 0x20, 0x3c, 0x73, 0x70,
- 0x61, 0x6e, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x66, 0x6f, 0x6e,
- 0x74, 0x2d, 0x6f, 0x6e, 0x72, 0x65, 0x61, 0x64, 0x79, 0x73, 0x74, 0x61, 0x74,
- 0x65, 0x63, 0x68, 0x61, 0x6e, 0x67, 0x65, 0x09, 0x3c, 0x64, 0x69, 0x76, 0x20,
- 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x63, 0x6c, 0x65, 0x61, 0x72, 0x64,
- 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x2e, 0x6c, 0x6f, 0x63, 0x61, 0x74,
- 0x69, 0x6f, 0x6e, 0x2e, 0x20, 0x46, 0x6f, 0x72, 0x20, 0x65, 0x78, 0x61, 0x6d,
- 0x70, 0x6c, 0x65, 0x2c, 0x20, 0x74, 0x68, 0x65, 0x20, 0x61, 0x20, 0x77, 0x69,
- 0x64, 0x65, 0x20, 0x76, 0x61, 0x72, 0x69, 0x65, 0x74, 0x79, 0x20, 0x6f, 0x66,
- 0x20, 0x3c, 0x21, 0x44, 0x4f, 0x43, 0x54, 0x59, 0x50, 0x45, 0x20, 0x68, 0x74,
- 0x6d, 0x6c, 0x3e, 0x0d, 0x0a, 0x3c, 0x26, 0x6e, 0x62, 0x73, 0x70, 0x3b, 0x26,
- 0x6e, 0x62, 0x73, 0x70, 0x3b, 0x26, 0x6e, 0x62, 0x73, 0x70, 0x3b, 0x22, 0x3e,
- 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70,
- 0x3a, 0x2f, 0x2f, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x66, 0x6c, 0x6f,
- 0x61, 0x74, 0x3a, 0x6c, 0x65, 0x66, 0x74, 0x3b, 0x63, 0x6f, 0x6e, 0x63, 0x65,
- 0x72, 0x6e, 0x65, 0x64, 0x20, 0x77, 0x69, 0x74, 0x68, 0x20, 0x74, 0x68, 0x65,
- 0x3d, 0x68, 0x74, 0x74, 0x70, 0x25, 0x33, 0x41, 0x25, 0x32, 0x46, 0x25, 0x32,
- 0x46, 0x77, 0x77, 0x77, 0x2e, 0x69, 0x6e, 0x20, 0x70, 0x6f, 0x70, 0x75, 0x6c,
- 0x61, 0x72, 0x20, 0x63, 0x75, 0x6c, 0x74, 0x75, 0x72, 0x65, 0x74, 0x79, 0x70,
- 0x65, 0x3d, 0x22, 0x74, 0x65, 0x78, 0x74, 0x2f, 0x63, 0x73, 0x73, 0x22, 0x20,
- 0x2f, 0x3e, 0x69, 0x74, 0x20, 0x69, 0x73, 0x20, 0x70, 0x6f, 0x73, 0x73, 0x69,
- 0x62, 0x6c, 0x65, 0x20, 0x74, 0x6f, 0x20, 0x48, 0x61, 0x72, 0x76, 0x61, 0x72,
- 0x64, 0x20, 0x55, 0x6e, 0x69, 0x76, 0x65, 0x72, 0x73, 0x69, 0x74, 0x79, 0x74,
- 0x79, 0x6c, 0x65, 0x73, 0x68, 0x65, 0x65, 0x74, 0x22, 0x20, 0x68, 0x72, 0x65,
- 0x66, 0x3d, 0x22, 0x2f, 0x74, 0x68, 0x65, 0x20, 0x6d, 0x61, 0x69, 0x6e, 0x20,
- 0x63, 0x68, 0x61, 0x72, 0x61, 0x63, 0x74, 0x65, 0x72, 0x4f, 0x78, 0x66, 0x6f,
- 0x72, 0x64, 0x20, 0x55, 0x6e, 0x69, 0x76, 0x65, 0x72, 0x73, 0x69, 0x74, 0x79,
- 0x20, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x22, 0x6b, 0x65, 0x79, 0x77, 0x6f,
- 0x72, 0x64, 0x73, 0x22, 0x20, 0x63, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22,
- 0x74, 0x65, 0x78, 0x74, 0x2d, 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3a, 0x74, 0x68,
- 0x65, 0x20, 0x55, 0x6e, 0x69, 0x74, 0x65, 0x64, 0x20, 0x4b, 0x69, 0x6e, 0x67,
- 0x64, 0x6f, 0x6d, 0x66, 0x65, 0x64, 0x65, 0x72, 0x61, 0x6c, 0x20, 0x67, 0x6f,
- 0x76, 0x65, 0x72, 0x6e, 0x6d, 0x65, 0x6e, 0x74, 0x3c, 0x64, 0x69, 0x76, 0x20,
- 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x6d, 0x61, 0x72, 0x67, 0x69, 0x6e,
- 0x20, 0x64, 0x65, 0x70, 0x65, 0x6e, 0x64, 0x69, 0x6e, 0x67, 0x20, 0x6f, 0x6e,
- 0x20, 0x74, 0x68, 0x65, 0x20, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
- 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x3c, 0x64, 0x69,
- 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x68, 0x65, 0x61, 0x64,
- 0x65, 0x72, 0x2e, 0x6d, 0x69, 0x6e, 0x2e, 0x6a, 0x73, 0x22, 0x3e, 0x3c, 0x2f,
- 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x64, 0x65, 0x73, 0x74, 0x72, 0x75,
- 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x73,
- 0x6c, 0x69, 0x67, 0x68, 0x74, 0x6c, 0x79, 0x20, 0x64, 0x69, 0x66, 0x66, 0x65,
- 0x72, 0x65, 0x6e, 0x74, 0x69, 0x6e, 0x20, 0x61, 0x63, 0x63, 0x6f, 0x72, 0x64,
- 0x61, 0x6e, 0x63, 0x65, 0x20, 0x77, 0x69, 0x74, 0x68, 0x74, 0x65, 0x6c, 0x65,
- 0x63, 0x6f, 0x6d, 0x6d, 0x75, 0x6e, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e,
- 0x73, 0x69, 0x6e, 0x64, 0x69, 0x63, 0x61, 0x74, 0x65, 0x73, 0x20, 0x74, 0x68,
- 0x61, 0x74, 0x20, 0x74, 0x68, 0x65, 0x73, 0x68, 0x6f, 0x72, 0x74, 0x6c, 0x79,
- 0x20, 0x74, 0x68, 0x65, 0x72, 0x65, 0x61, 0x66, 0x74, 0x65, 0x72, 0x65, 0x73,
- 0x70, 0x65, 0x63, 0x69, 0x61, 0x6c, 0x6c, 0x79, 0x20, 0x69, 0x6e, 0x20, 0x74,
- 0x68, 0x65, 0x20, 0x45, 0x75, 0x72, 0x6f, 0x70, 0x65, 0x61, 0x6e, 0x20, 0x63,
- 0x6f, 0x75, 0x6e, 0x74, 0x72, 0x69, 0x65, 0x73, 0x48, 0x6f, 0x77, 0x65, 0x76,
- 0x65, 0x72, 0x2c, 0x20, 0x74, 0x68, 0x65, 0x72, 0x65, 0x20, 0x61, 0x72, 0x65,
- 0x73, 0x72, 0x63, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x73,
- 0x74, 0x61, 0x74, 0x69, 0x63, 0x73, 0x75, 0x67, 0x67, 0x65, 0x73, 0x74, 0x65,
- 0x64, 0x20, 0x74, 0x68, 0x61, 0x74, 0x20, 0x74, 0x68, 0x65, 0x22, 0x20, 0x73,
- 0x72, 0x63, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x77, 0x77,
- 0x77, 0x2e, 0x61, 0x20, 0x6c, 0x61, 0x72, 0x67, 0x65, 0x20, 0x6e, 0x75, 0x6d,
- 0x62, 0x65, 0x72, 0x20, 0x6f, 0x66, 0x20, 0x54, 0x65, 0x6c, 0x65, 0x63, 0x6f,
- 0x6d, 0x6d, 0x75, 0x6e, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x22,
- 0x20, 0x72, 0x65, 0x6c, 0x3d, 0x22, 0x6e, 0x6f, 0x66, 0x6f, 0x6c, 0x6c, 0x6f,
- 0x77, 0x22, 0x20, 0x74, 0x48, 0x6f, 0x6c, 0x79, 0x20, 0x52, 0x6f, 0x6d, 0x61,
- 0x6e, 0x20, 0x45, 0x6d, 0x70, 0x65, 0x72, 0x6f, 0x72, 0x61, 0x6c, 0x6d, 0x6f,
- 0x73, 0x74, 0x20, 0x65, 0x78, 0x63, 0x6c, 0x75, 0x73, 0x69, 0x76, 0x65, 0x6c,
- 0x79, 0x22, 0x20, 0x62, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x3d, 0x22, 0x30, 0x22,
- 0x20, 0x61, 0x6c, 0x74, 0x3d, 0x22, 0x53, 0x65, 0x63, 0x72, 0x65, 0x74, 0x61,
- 0x72, 0x79, 0x20, 0x6f, 0x66, 0x20, 0x53, 0x74, 0x61, 0x74, 0x65, 0x63, 0x75,
- 0x6c, 0x6d, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6e, 0x67, 0x20, 0x69, 0x6e, 0x20,
- 0x74, 0x68, 0x65, 0x43, 0x49, 0x41, 0x20, 0x57, 0x6f, 0x72, 0x6c, 0x64, 0x20,
- 0x46, 0x61, 0x63, 0x74, 0x62, 0x6f, 0x6f, 0x6b, 0x74, 0x68, 0x65, 0x20, 0x6d,
- 0x6f, 0x73, 0x74, 0x20, 0x69, 0x6d, 0x70, 0x6f, 0x72, 0x74, 0x61, 0x6e, 0x74,
- 0x61, 0x6e, 0x6e, 0x69, 0x76, 0x65, 0x72, 0x73, 0x61, 0x72, 0x79, 0x20, 0x6f,
- 0x66, 0x20, 0x74, 0x68, 0x65, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x62,
- 0x61, 0x63, 0x6b, 0x67, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x2d, 0x3c, 0x6c, 0x69,
- 0x3e, 0x3c, 0x65, 0x6d, 0x3e, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d,
- 0x22, 0x2f, 0x74, 0x68, 0x65, 0x20, 0x41, 0x74, 0x6c, 0x61, 0x6e, 0x74, 0x69,
- 0x63, 0x20, 0x4f, 0x63, 0x65, 0x61, 0x6e, 0x73, 0x74, 0x72, 0x69, 0x63, 0x74,
- 0x6c, 0x79, 0x20, 0x73, 0x70, 0x65, 0x61, 0x6b, 0x69, 0x6e, 0x67, 0x2c, 0x73,
- 0x68, 0x6f, 0x72, 0x74, 0x6c, 0x79, 0x20, 0x62, 0x65, 0x66, 0x6f, 0x72, 0x65,
- 0x20, 0x74, 0x68, 0x65, 0x64, 0x69, 0x66, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x74,
- 0x20, 0x74, 0x79, 0x70, 0x65, 0x73, 0x20, 0x6f, 0x66, 0x74, 0x68, 0x65, 0x20,
- 0x4f, 0x74, 0x74, 0x6f, 0x6d, 0x61, 0x6e, 0x20, 0x45, 0x6d, 0x70, 0x69, 0x72,
- 0x65, 0x3e, 0x3c, 0x69, 0x6d, 0x67, 0x20, 0x73, 0x72, 0x63, 0x3d, 0x22, 0x68,
- 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x41, 0x6e, 0x20, 0x49, 0x6e, 0x74, 0x72,
- 0x6f, 0x64, 0x75, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x74, 0x6f, 0x63, 0x6f,
- 0x6e, 0x73, 0x65, 0x71, 0x75, 0x65, 0x6e, 0x63, 0x65, 0x20, 0x6f, 0x66, 0x20,
- 0x74, 0x68, 0x65, 0x64, 0x65, 0x70, 0x61, 0x72, 0x74, 0x75, 0x72, 0x65, 0x20,
- 0x66, 0x72, 0x6f, 0x6d, 0x20, 0x74, 0x68, 0x65, 0x43, 0x6f, 0x6e, 0x66, 0x65,
- 0x64, 0x65, 0x72, 0x61, 0x74, 0x65, 0x20, 0x53, 0x74, 0x61, 0x74, 0x65, 0x73,
- 0x69, 0x6e, 0x64, 0x69, 0x67, 0x65, 0x6e, 0x6f, 0x75, 0x73, 0x20, 0x70, 0x65,
- 0x6f, 0x70, 0x6c, 0x65, 0x73, 0x50, 0x72, 0x6f, 0x63, 0x65, 0x65, 0x64, 0x69,
- 0x6e, 0x67, 0x73, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x69, 0x6e, 0x66,
- 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x6e, 0x20, 0x74,
- 0x68, 0x65, 0x74, 0x68, 0x65, 0x6f, 0x72, 0x69, 0x65, 0x73, 0x20, 0x68, 0x61,
- 0x76, 0x65, 0x20, 0x62, 0x65, 0x65, 0x6e, 0x69, 0x6e, 0x76, 0x6f, 0x6c, 0x76,
- 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x20, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x64,
- 0x69, 0x76, 0x69, 0x64, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x74, 0x6f, 0x20, 0x74,
- 0x68, 0x72, 0x65, 0x65, 0x61, 0x64, 0x6a, 0x61, 0x63, 0x65, 0x6e, 0x74, 0x20,
- 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x72, 0x69, 0x65, 0x73, 0x69, 0x73, 0x20, 0x72,
- 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x69, 0x62, 0x6c, 0x65, 0x20, 0x66, 0x6f,
- 0x72, 0x64, 0x69, 0x73, 0x73, 0x6f, 0x6c, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x20,
- 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x63, 0x6f, 0x6c, 0x6c, 0x61, 0x62, 0x6f,
- 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x77, 0x69, 0x74, 0x68, 0x77, 0x69,
- 0x64, 0x65, 0x6c, 0x79, 0x20, 0x72, 0x65, 0x67, 0x61, 0x72, 0x64, 0x65, 0x64,
- 0x20, 0x61, 0x73, 0x68, 0x69, 0x73, 0x20, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6d,
- 0x70, 0x6f, 0x72, 0x61, 0x72, 0x69, 0x65, 0x73, 0x66, 0x6f, 0x75, 0x6e, 0x64,
- 0x69, 0x6e, 0x67, 0x20, 0x6d, 0x65, 0x6d, 0x62, 0x65, 0x72, 0x20, 0x6f, 0x66,
- 0x44, 0x6f, 0x6d, 0x69, 0x6e, 0x69, 0x63, 0x61, 0x6e, 0x20, 0x52, 0x65, 0x70,
- 0x75, 0x62, 0x6c, 0x69, 0x63, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x6c, 0x6c,
- 0x79, 0x20, 0x61, 0x63, 0x63, 0x65, 0x70, 0x74, 0x65, 0x64, 0x74, 0x68, 0x65,
- 0x20, 0x70, 0x6f, 0x73, 0x73, 0x69, 0x62, 0x69, 0x6c, 0x69, 0x74, 0x79, 0x20,
- 0x6f, 0x66, 0x61, 0x72, 0x65, 0x20, 0x61, 0x6c, 0x73, 0x6f, 0x20, 0x61, 0x76,
- 0x61, 0x69, 0x6c, 0x61, 0x62, 0x6c, 0x65, 0x75, 0x6e, 0x64, 0x65, 0x72, 0x20,
- 0x63, 0x6f, 0x6e, 0x73, 0x74, 0x72, 0x75, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x72,
- 0x65, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66,
- 0x20, 0x74, 0x68, 0x65, 0x74, 0x68, 0x65, 0x20, 0x67, 0x65, 0x6e, 0x65, 0x72,
- 0x61, 0x6c, 0x20, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x63, 0x69, 0x73, 0x20, 0x61,
- 0x6c, 0x6d, 0x6f, 0x73, 0x74, 0x20, 0x65, 0x6e, 0x74, 0x69, 0x72, 0x65, 0x6c,
- 0x79, 0x70, 0x61, 0x73, 0x73, 0x65, 0x73, 0x20, 0x74, 0x68, 0x72, 0x6f, 0x75,
- 0x67, 0x68, 0x20, 0x74, 0x68, 0x65, 0x68, 0x61, 0x73, 0x20, 0x62, 0x65, 0x65,
- 0x6e, 0x20, 0x73, 0x75, 0x67, 0x67, 0x65, 0x73, 0x74, 0x65, 0x64, 0x63, 0x6f,
- 0x6d, 0x70, 0x75, 0x74, 0x65, 0x72, 0x20, 0x61, 0x6e, 0x64, 0x20, 0x76, 0x69,
- 0x64, 0x65, 0x6f, 0x47, 0x65, 0x72, 0x6d, 0x61, 0x6e, 0x69, 0x63, 0x20, 0x6c,
- 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x73, 0x20, 0x61, 0x63, 0x63, 0x6f,
- 0x72, 0x64, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x20,
- 0x64, 0x69, 0x66, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x74, 0x20, 0x66, 0x72, 0x6f,
- 0x6d, 0x20, 0x74, 0x68, 0x65, 0x73, 0x68, 0x6f, 0x72, 0x74, 0x6c, 0x79, 0x20,
- 0x61, 0x66, 0x74, 0x65, 0x72, 0x77, 0x61, 0x72, 0x64, 0x73, 0x68, 0x72, 0x65,
- 0x66, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77,
- 0x77, 0x2e, 0x72, 0x65, 0x63, 0x65, 0x6e, 0x74, 0x20, 0x64, 0x65, 0x76, 0x65,
- 0x6c, 0x6f, 0x70, 0x6d, 0x65, 0x6e, 0x74, 0x42, 0x6f, 0x61, 0x72, 0x64, 0x20,
- 0x6f, 0x66, 0x20, 0x44, 0x69, 0x72, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x73, 0x3c,
- 0x64, 0x69, 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x73, 0x65,
- 0x61, 0x72, 0x63, 0x68, 0x7c, 0x20, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66,
- 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x49, 0x6e, 0x20, 0x70,
- 0x61, 0x72, 0x74, 0x69, 0x63, 0x75, 0x6c, 0x61, 0x72, 0x2c, 0x20, 0x74, 0x68,
- 0x65, 0x4d, 0x75, 0x6c, 0x74, 0x69, 0x70, 0x6c, 0x65, 0x20, 0x66, 0x6f, 0x6f,
- 0x74, 0x6e, 0x6f, 0x74, 0x65, 0x73, 0x6f, 0x72, 0x20, 0x6f, 0x74, 0x68, 0x65,
- 0x72, 0x20, 0x73, 0x75, 0x62, 0x73, 0x74, 0x61, 0x6e, 0x63, 0x65, 0x74, 0x68,
- 0x6f, 0x75, 0x73, 0x61, 0x6e, 0x64, 0x73, 0x20, 0x6f, 0x66, 0x20, 0x79, 0x65,
- 0x61, 0x72, 0x73, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x6c, 0x61, 0x74, 0x69, 0x6f,
- 0x6e, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x3c, 0x2f, 0x64, 0x69, 0x76,
- 0x3e, 0x0d, 0x0a, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0d, 0x0a, 0x0d, 0x0a,
- 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x69, 0x6e, 0x64, 0x65,
- 0x78, 0x2e, 0x70, 0x68, 0x70, 0x77, 0x61, 0x73, 0x20, 0x65, 0x73, 0x74, 0x61,
- 0x62, 0x6c, 0x69, 0x73, 0x68, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x6d, 0x69, 0x6e,
- 0x2e, 0x6a, 0x73, 0x22, 0x3e, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
- 0x3e, 0x0a, 0x70, 0x61, 0x72, 0x74, 0x69, 0x63, 0x69, 0x70, 0x61, 0x74, 0x65,
- 0x20, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x61, 0x20, 0x73, 0x74, 0x72, 0x6f,
- 0x6e, 0x67, 0x20, 0x69, 0x6e, 0x66, 0x6c, 0x75, 0x65, 0x6e, 0x63, 0x65, 0x73,
- 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x6d, 0x61, 0x72, 0x67, 0x69, 0x6e, 0x2d,
- 0x74, 0x6f, 0x70, 0x3a, 0x72, 0x65, 0x70, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x74,
- 0x65, 0x64, 0x20, 0x62, 0x79, 0x20, 0x74, 0x68, 0x65, 0x67, 0x72, 0x61, 0x64,
- 0x75, 0x61, 0x74, 0x65, 0x64, 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x20, 0x74, 0x68,
- 0x65, 0x54, 0x72, 0x61, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x6c,
- 0x79, 0x2c, 0x20, 0x74, 0x68, 0x65, 0x45, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74,
- 0x28, 0x22, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x22, 0x29, 0x3b, 0x48, 0x6f,
- 0x77, 0x65, 0x76, 0x65, 0x72, 0x2c, 0x20, 0x73, 0x69, 0x6e, 0x63, 0x65, 0x20,
- 0x74, 0x68, 0x65, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0a, 0x3c, 0x2f, 0x64, 0x69,
- 0x76, 0x3e, 0x0a, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x6c, 0x65, 0x66, 0x74, 0x3b,
- 0x20, 0x6d, 0x61, 0x72, 0x67, 0x69, 0x6e, 0x2d, 0x6c, 0x65, 0x66, 0x74, 0x3a,
- 0x70, 0x72, 0x6f, 0x74, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x61, 0x67,
- 0x61, 0x69, 0x6e, 0x73, 0x74, 0x30, 0x3b, 0x20, 0x76, 0x65, 0x72, 0x74, 0x69,
- 0x63, 0x61, 0x6c, 0x2d, 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3a, 0x55, 0x6e, 0x66,
- 0x6f, 0x72, 0x74, 0x75, 0x6e, 0x61, 0x74, 0x65, 0x6c, 0x79, 0x2c, 0x20, 0x74,
- 0x68, 0x65, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x69, 0x6d, 0x61, 0x67, 0x65,
- 0x2f, 0x78, 0x2d, 0x69, 0x63, 0x6f, 0x6e, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0a,
- 0x3c, 0x64, 0x69, 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x20,
- 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x63, 0x6c, 0x65, 0x61, 0x72, 0x66,
- 0x69, 0x78, 0x22, 0x3e, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73,
- 0x73, 0x3d, 0x22, 0x66, 0x6f, 0x6f, 0x74, 0x65, 0x72, 0x09, 0x09, 0x3c, 0x2f,
- 0x64, 0x69, 0x76, 0x3e, 0x0a, 0x09, 0x09, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e,
- 0x0a, 0x74, 0x68, 0x65, 0x20, 0x6d, 0x6f, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x70,
- 0x69, 0x63, 0x74, 0x75, 0x72, 0x65, 0xd0, 0x91, 0xd1, 0x8a, 0xd0, 0xbb, 0xd0,
- 0xb3, 0xd0, 0xb0, 0xd1, 0x80, 0xd1, 0x81, 0xd0, 0xba, 0xd0, 0xb8, 0xd0, 0xb1,
- 0xd1, 0x8a, 0xd0, 0xbb, 0xd0, 0xb3, 0xd0, 0xb0, 0xd1, 0x80, 0xd1, 0x81, 0xd0,
- 0xba, 0xd0, 0xb8, 0xd0, 0xa4, 0xd0, 0xb5, 0xd0, 0xb4, 0xd0, 0xb5, 0xd1, 0x80,
- 0xd0, 0xb0, 0xd1, 0x86, 0xd0, 0xb8, 0xd0, 0xb8, 0xd0, 0xbd, 0xd0, 0xb5, 0xd1,
- 0x81, 0xd0, 0xba, 0xd0, 0xbe, 0xd0, 0xbb, 0xd1, 0x8c, 0xd0, 0xba, 0xd0, 0xbe,
- 0xd1, 0x81, 0xd0, 0xbe, 0xd0, 0xbe, 0xd0, 0xb1, 0xd1, 0x89, 0xd0, 0xb5, 0xd0,
- 0xbd, 0xd0, 0xb8, 0xd0, 0xb5, 0xd1, 0x81, 0xd0, 0xbe, 0xd0, 0xbe, 0xd0, 0xb1,
- 0xd1, 0x89, 0xd0, 0xb5, 0xd0, 0xbd, 0xd0, 0xb8, 0xd1, 0x8f, 0xd0, 0xbf, 0xd1,
- 0x80, 0xd0, 0xbe, 0xd0, 0xb3, 0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xbc, 0xd0, 0xbc,
- 0xd1, 0x8b, 0xd0, 0x9e, 0xd1, 0x82, 0xd0, 0xbf, 0xd1, 0x80, 0xd0, 0xb0, 0xd0,
- 0xb2, 0xd0, 0xb8, 0xd1, 0x82, 0xd1, 0x8c, 0xd0, 0xb1, 0xd0, 0xb5, 0xd1, 0x81,
- 0xd0, 0xbf, 0xd0, 0xbb, 0xd0, 0xb0, 0xd1, 0x82, 0xd0, 0xbd, 0xd0, 0xbe, 0xd0,
- 0xbc, 0xd0, 0xb0, 0xd1, 0x82, 0xd0, 0xb5, 0xd1, 0x80, 0xd0, 0xb8, 0xd0, 0xb0,
- 0xd0, 0xbb, 0xd1, 0x8b, 0xd0, 0xbf, 0xd0, 0xbe, 0xd0, 0xb7, 0xd0, 0xb2, 0xd0,
- 0xbe, 0xd0, 0xbb, 0xd1, 0x8f, 0xd0, 0xb5, 0xd1, 0x82, 0xd0, 0xbf, 0xd0, 0xbe,
- 0xd1, 0x81, 0xd0, 0xbb, 0xd0, 0xb5, 0xd0, 0xb4, 0xd0, 0xbd, 0xd0, 0xb8, 0xd0,
- 0xb5, 0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xb7, 0xd0, 0xbb, 0xd0, 0xb8, 0xd1, 0x87,
- 0xd0, 0xbd, 0xd1, 0x8b, 0xd1, 0x85, 0xd0, 0xbf, 0xd1, 0x80, 0xd0, 0xbe, 0xd0,
- 0xb4, 0xd1, 0x83, 0xd0, 0xba, 0xd1, 0x86, 0xd0, 0xb8, 0xd0, 0xb8, 0xd0, 0xbf,
- 0xd1, 0x80, 0xd0, 0xbe, 0xd0, 0xb3, 0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xbc, 0xd0,
- 0xbc, 0xd0, 0xb0, 0xd0, 0xbf, 0xd0, 0xbe, 0xd0, 0xbb, 0xd0, 0xbd, 0xd0, 0xbe,
- 0xd1, 0x81, 0xd1, 0x82, 0xd1, 0x8c, 0xd1, 0x8e, 0xd0, 0xbd, 0xd0, 0xb0, 0xd1,
- 0x85, 0xd0, 0xbe, 0xd0, 0xb4, 0xd0, 0xb8, 0xd1, 0x82, 0xd1, 0x81, 0xd1, 0x8f,
- 0xd0, 0xb8, 0xd0, 0xb7, 0xd0, 0xb1, 0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xbd, 0xd0,
- 0xbd, 0xd0, 0xbe, 0xd0, 0xb5, 0xd0, 0xbd, 0xd0, 0xb0, 0xd1, 0x81, 0xd0, 0xb5,
- 0xd0, 0xbb, 0xd0, 0xb5, 0xd0, 0xbd, 0xd0, 0xb8, 0xd1, 0x8f, 0xd0, 0xb8, 0xd0,
- 0xb7, 0xd0, 0xbc, 0xd0, 0xb5, 0xd0, 0xbd, 0xd0, 0xb5, 0xd0, 0xbd, 0xd0, 0xb8,
- 0xd1, 0x8f, 0xd0, 0xba, 0xd0, 0xb0, 0xd1, 0x82, 0xd0, 0xb5, 0xd0, 0xb3, 0xd0,
- 0xbe, 0xd1, 0x80, 0xd0, 0xb8, 0xd0, 0xb8, 0xd0, 0x90, 0xd0, 0xbb, 0xd0, 0xb5,
- 0xd0, 0xba, 0xd1, 0x81, 0xd0, 0xb0, 0xd0, 0xbd, 0xd0, 0xb4, 0xd1, 0x80, 0xe0,
- 0xa4, 0xa6, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4,
- 0xb0, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xae, 0xe0, 0xa5, 0x88, 0xe0, 0xa4, 0xa8,
- 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0x85, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xaa, 0xe0,
- 0xa5, 0x8d, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xa6, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4,
- 0xa8, 0xe0, 0xa4, 0xad, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xa4,
- 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0x85, 0xe0, 0xa4, 0xa8, 0xe0,
- 0xa5, 0x81, 0xe0, 0xa4, 0xa6, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb6, 0xe0, 0xa4,
- 0xb9, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xa6,
- 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0x87, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xa1, 0xe0,
- 0xa4, 0xbf, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa6, 0xe0, 0xa4,
- 0xbf, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x80,
- 0xe0, 0xa4, 0x85, 0xe0, 0xa4, 0xa7, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0x95, 0xe0,
- 0xa4, 0xbe, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xb5, 0xe0, 0xa5, 0x80, 0xe0, 0xa4,
- 0xa1, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xaf, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x9a,
- 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0x9f, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xa0, 0xe0,
- 0xa5, 0x87, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4,
- 0x9a, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0x82,
- 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb6, 0xe0, 0xa4, 0xa8, 0xe0,
- 0xa4, 0xa6, 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4,
- 0xaf, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xaa, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb0,
- 0xe0, 0xa4, 0xaf, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0x85, 0xe0,
- 0xa4, 0xa8, 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4,
- 0xb0, 0xe0, 0xa4, 0x91, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xbe,
- 0xe0, 0xa4, 0x87, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xbe, 0xe0,
- 0xa4, 0xb0, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0x9f, 0xe0, 0xa5, 0x80, 0xe0, 0xa4,
- 0xb6, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x8b,
- 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x95, 0xe0,
- 0xa4, 0xb8, 0xe0, 0xa4, 0xad, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xab, 0xe0, 0xa4,
- 0xbc, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x88, 0xe0, 0xa4, 0xb6,
- 0xe0, 0xa4, 0xb6, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xa4, 0xe0,
- 0xa5, 0x87, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xaa, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4,
- 0xb0, 0xe0, 0xa4, 0xa6, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb6, 0xe0, 0xa4, 0xaa,
- 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xaf, 0xe0,
- 0xa4, 0xb0, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x82, 0xe0, 0xa4,
- 0xa6, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xb8, 0xe0, 0xa5, 0x8d,
- 0xe0, 0xa4, 0xa5, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xbf, 0xe0,
- 0xa4, 0x89, 0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4,
- 0xbe, 0xe0, 0xa4, 0xa6, 0xe0, 0xa4, 0x89, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x8d,
- 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0x9a, 0xe0,
- 0xa4, 0xbf, 0xe0, 0xa4, 0x9f, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xa0, 0xe0, 0xa4,
- 0xbe, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x8d,
- 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x9c, 0xe0, 0xa5, 0x8d, 0xe0,
- 0xa4, 0xaf, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa6, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4,
- 0xaa, 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa8,
- 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x9c, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0xa1, 0xe0,
- 0xa4, 0xbc, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0x85, 0xe0, 0xa4,
- 0xa8, 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa6,
- 0xe0, 0xa4, 0xb6, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x87, 0xe0,
- 0xa4, 0xa3, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xb6, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4,
- 0x95, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb7, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb8,
- 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb0, 0xe0,
- 0xa5, 0x80, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0x97, 0xe0, 0xa5,
- 0x8d, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xb0,
- 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xa3, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xae, 0xe0,
- 0xa4, 0xac, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4,
- 0x82, 0xe0, 0xa4, 0xa1, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0x9a, 0xe0, 0xa5, 0x8d,
- 0xe0, 0xa4, 0x9a, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0x89, 0xe0,
- 0xa4, 0xaa, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xac, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4,
- 0xa7, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x8d,
- 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0x82, 0xe0,
- 0xa4, 0xaa, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0x95, 0xe0, 0xa4,
- 0x89, 0xe0, 0xa4, 0xae, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xae, 0xe0, 0xa5, 0x80,
- 0xe0, 0xa4, 0xa6, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa7, 0xe0,
- 0xa5, 0x8d, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4,
- 0xb9, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xbe,
- 0xe0, 0xa4, 0xb6, 0xe0, 0xa4, 0xac, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xa6, 0xe0,
- 0xa5, 0x8b, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xae, 0xe0, 0xa5, 0x80, 0xe0, 0xa4,
- 0xa1, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x86,
- 0xe0, 0xa4, 0x88, 0xe0, 0xa4, 0xaa, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0x8f, 0xe0,
- 0xa4, 0xb2, 0xe0, 0xa4, 0xae, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0xac, 0xe0, 0xa4,
- 0xbe, 0xe0, 0xa4, 0x87, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0x82,
- 0xe0, 0xa4, 0x96, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xbe, 0xe0,
- 0xa4, 0x86, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x87, 0xe0, 0xa4,
- 0xb6, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0x85, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x81,
- 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xa7, 0xe0, 0xa4, 0xac, 0xe0,
- 0xa4, 0xbe, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xbc, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4,
- 0xb0, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xb5, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xa8,
- 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xaa, 0xe0, 0xa5, 0x8d, 0xe0,
- 0xa4, 0xb0, 0xe0, 0xa4, 0xae, 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0x96, 0xe0, 0xa4,
- 0xaa, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xb6, 0xe0, 0xa5, 0x8d,
- 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xbf, 0xe0,
- 0xa4, 0xb5, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5,
- 0x81, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa8,
- 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x8d, 0xe0,
- 0xa4, 0xa5, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0x86, 0xe0, 0xa4, 0xaf, 0xe0, 0xa5,
- 0x8b, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xb8,
- 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xbe, 0xe0,
- 0xa4, 0xb0, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x85, 0xd8, 0xb4, 0xd8, 0xa7, 0xd8,
- 0xb1, 0xd9, 0x83, 0xd8, 0xa7, 0xd8, 0xaa, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x85,
- 0xd9, 0x86, 0xd8, 0xaa, 0xd8, 0xaf, 0xd9, 0x8a, 0xd8, 0xa7, 0xd8, 0xaa, 0xd8,
- 0xa7, 0xd9, 0x84, 0xd9, 0x83, 0xd9, 0x85, 0xd8, 0xa8, 0xd9, 0x8a, 0xd9, 0x88,
- 0xd8, 0xaa, 0xd8, 0xb1, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x85, 0xd8, 0xb4, 0xd8,
- 0xa7, 0xd9, 0x87, 0xd8, 0xaf, 0xd8, 0xa7, 0xd8, 0xaa, 0xd8, 0xb9, 0xd8, 0xaf,
- 0xd8, 0xaf, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb2, 0xd9, 0x88, 0xd8, 0xa7, 0xd8,
- 0xb1, 0xd8, 0xb9, 0xd8, 0xaf, 0xd8, 0xaf, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb1,
- 0xd8, 0xaf, 0xd9, 0x88, 0xd8, 0xaf, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa5, 0xd8,
- 0xb3, 0xd9, 0x84, 0xd8, 0xa7, 0xd9, 0x85, 0xd9, 0x8a, 0xd8, 0xa9, 0xd8, 0xa7,
- 0xd9, 0x84, 0xd9, 0x81, 0xd9, 0x88, 0xd8, 0xaa, 0xd9, 0x88, 0xd8, 0xb4, 0xd9,
- 0x88, 0xd8, 0xa8, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x85, 0xd8, 0xb3, 0xd8, 0xa7,
- 0xd8, 0xa8, 0xd9, 0x82, 0xd8, 0xa7, 0xd8, 0xaa, 0xd8, 0xa7, 0xd9, 0x84, 0xd9,
- 0x85, 0xd8, 0xb9, 0xd9, 0x84, 0xd9, 0x88, 0xd9, 0x85, 0xd8, 0xa7, 0xd8, 0xaa,
- 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x85, 0xd8, 0xb3, 0xd9, 0x84, 0xd8, 0xb3, 0xd9,
- 0x84, 0xd8, 0xa7, 0xd8, 0xaa, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xac, 0xd8, 0xb1,
- 0xd8, 0xa7, 0xd9, 0x81, 0xd9, 0x8a, 0xd9, 0x83, 0xd8, 0xb3, 0xd8, 0xa7, 0xd9,
- 0x84, 0xd8, 0xa7, 0xd8, 0xb3, 0xd9, 0x84, 0xd8, 0xa7, 0xd9, 0x85, 0xd9, 0x8a,
- 0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa7, 0xd8, 0xaa, 0xd8, 0xb5, 0xd8,
- 0xa7, 0xd9, 0x84, 0xd8, 0xa7, 0xd8, 0xaa, 0x6b, 0x65, 0x79, 0x77, 0x6f, 0x72,
- 0x64, 0x73, 0x22, 0x20, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x3d, 0x22,
- 0x77, 0x33, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x31, 0x39, 0x39, 0x39, 0x2f, 0x78,
- 0x68, 0x74, 0x6d, 0x6c, 0x22, 0x3e, 0x3c, 0x61, 0x20, 0x74, 0x61, 0x72, 0x67,
- 0x65, 0x74, 0x3d, 0x22, 0x5f, 0x62, 0x6c, 0x61, 0x6e, 0x6b, 0x22, 0x20, 0x74,
- 0x65, 0x78, 0x74, 0x2f, 0x68, 0x74, 0x6d, 0x6c, 0x3b, 0x20, 0x63, 0x68, 0x61,
- 0x72, 0x73, 0x65, 0x74, 0x3d, 0x22, 0x20, 0x74, 0x61, 0x72, 0x67, 0x65, 0x74,
- 0x3d, 0x22, 0x5f, 0x62, 0x6c, 0x61, 0x6e, 0x6b, 0x22, 0x3e, 0x3c, 0x74, 0x61,
- 0x62, 0x6c, 0x65, 0x20, 0x63, 0x65, 0x6c, 0x6c, 0x70, 0x61, 0x64, 0x64, 0x69,
- 0x6e, 0x67, 0x3d, 0x22, 0x61, 0x75, 0x74, 0x6f, 0x63, 0x6f, 0x6d, 0x70, 0x6c,
- 0x65, 0x74, 0x65, 0x3d, 0x22, 0x6f, 0x66, 0x66, 0x22, 0x20, 0x74, 0x65, 0x78,
- 0x74, 0x2d, 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3a, 0x20, 0x63, 0x65, 0x6e, 0x74,
- 0x65, 0x72, 0x3b, 0x74, 0x6f, 0x20, 0x6c, 0x61, 0x73, 0x74, 0x20, 0x76, 0x65,
- 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x20, 0x62, 0x79, 0x20, 0x62, 0x61, 0x63, 0x6b,
- 0x67, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x2d, 0x63, 0x6f, 0x6c, 0x6f, 0x72, 0x3a,
- 0x20, 0x23, 0x22, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74, 0x74,
- 0x70, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x2f, 0x64, 0x69, 0x76, 0x3e,
- 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x69, 0x64,
- 0x3d, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x23, 0x22, 0x20,
- 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x22, 0x3e, 0x3c, 0x69, 0x6d, 0x67,
- 0x20, 0x73, 0x72, 0x63, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f,
- 0x63, 0x72, 0x69, 0x70, 0x74, 0x22, 0x20, 0x73, 0x72, 0x63, 0x3d, 0x22, 0x68,
- 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x0a, 0x3c, 0x73, 0x63, 0x72, 0x69, 0x70,
- 0x74, 0x20, 0x6c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x3d, 0x22, 0x2f,
- 0x2f, 0x45, 0x4e, 0x22, 0x20, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f,
- 0x77, 0x77, 0x77, 0x2e, 0x77, 0x65, 0x6e, 0x63, 0x6f, 0x64, 0x65, 0x55, 0x52,
- 0x49, 0x43, 0x6f, 0x6d, 0x70, 0x6f, 0x6e, 0x65, 0x6e, 0x74, 0x28, 0x22, 0x20,
- 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x6a, 0x61, 0x76, 0x61, 0x73, 0x63, 0x72,
- 0x69, 0x70, 0x74, 0x3a, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73,
- 0x73, 0x3d, 0x22, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x64, 0x6f, 0x63,
- 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x2e, 0x77, 0x72, 0x69, 0x74, 0x65, 0x28, 0x27,
- 0x3c, 0x73, 0x63, 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x3a, 0x20,
- 0x61, 0x62, 0x73, 0x6f, 0x6c, 0x75, 0x74, 0x65, 0x3b, 0x73, 0x63, 0x72, 0x69,
- 0x70, 0x74, 0x20, 0x73, 0x72, 0x63, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a,
- 0x2f, 0x2f, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x6d, 0x61, 0x72,
- 0x67, 0x69, 0x6e, 0x2d, 0x74, 0x6f, 0x70, 0x3a, 0x2e, 0x6d, 0x69, 0x6e, 0x2e,
- 0x6a, 0x73, 0x22, 0x3e, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e,
- 0x0a, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0a, 0x3c, 0x64, 0x69, 0x76, 0x20,
- 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x77, 0x33, 0x2e, 0x6f, 0x72, 0x67,
- 0x2f, 0x31, 0x39, 0x39, 0x39, 0x2f, 0x78, 0x68, 0x74, 0x6d, 0x6c, 0x22, 0x20,
- 0x0a, 0x0d, 0x0a, 0x3c, 0x2f, 0x62, 0x6f, 0x64, 0x79, 0x3e, 0x0d, 0x0a, 0x3c,
- 0x2f, 0x68, 0x74, 0x6d, 0x6c, 0x3e, 0x64, 0x69, 0x73, 0x74, 0x69, 0x6e, 0x63,
- 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x62, 0x65, 0x74, 0x77, 0x65, 0x65, 0x6e, 0x2f,
- 0x22, 0x20, 0x74, 0x61, 0x72, 0x67, 0x65, 0x74, 0x3d, 0x22, 0x5f, 0x62, 0x6c,
- 0x61, 0x6e, 0x6b, 0x22, 0x3e, 0x3c, 0x6c, 0x69, 0x6e, 0x6b, 0x20, 0x68, 0x72,
- 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x65, 0x6e,
- 0x63, 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x3d, 0x22, 0x75, 0x74, 0x66, 0x2d, 0x38,
- 0x22, 0x3f, 0x3e, 0x0a, 0x77, 0x2e, 0x61, 0x64, 0x64, 0x45, 0x76, 0x65, 0x6e,
- 0x74, 0x4c, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x3f, 0x61, 0x63, 0x74,
- 0x69, 0x6f, 0x6e, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x77,
- 0x77, 0x77, 0x2e, 0x69, 0x63, 0x6f, 0x6e, 0x22, 0x20, 0x68, 0x72, 0x65, 0x66,
- 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x20, 0x73, 0x74, 0x79,
- 0x6c, 0x65, 0x3d, 0x22, 0x62, 0x61, 0x63, 0x6b, 0x67, 0x72, 0x6f, 0x75, 0x6e,
- 0x64, 0x3a, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x74, 0x65, 0x78, 0x74, 0x2f,
- 0x63, 0x73, 0x73, 0x22, 0x20, 0x2f, 0x3e, 0x0a, 0x6d, 0x65, 0x74, 0x61, 0x20,
- 0x70, 0x72, 0x6f, 0x70, 0x65, 0x72, 0x74, 0x79, 0x3d, 0x22, 0x6f, 0x67, 0x3a,
- 0x74, 0x3c, 0x69, 0x6e, 0x70, 0x75, 0x74, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d,
- 0x22, 0x74, 0x65, 0x78, 0x74, 0x22, 0x20, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65,
- 0x3d, 0x22, 0x74, 0x65, 0x78, 0x74, 0x2d, 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3a,
- 0x74, 0x68, 0x65, 0x20, 0x64, 0x65, 0x76, 0x65, 0x6c, 0x6f, 0x70, 0x6d, 0x65,
- 0x6e, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x79, 0x6c, 0x65, 0x73, 0x68, 0x65,
- 0x65, 0x74, 0x22, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x74, 0x65, 0x68,
- 0x74, 0x6d, 0x6c, 0x3b, 0x20, 0x63, 0x68, 0x61, 0x72, 0x73, 0x65, 0x74, 0x3d,
- 0x75, 0x74, 0x66, 0x2d, 0x38, 0x69, 0x73, 0x20, 0x63, 0x6f, 0x6e, 0x73, 0x69,
- 0x64, 0x65, 0x72, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x20, 0x62, 0x65, 0x74, 0x61,
- 0x62, 0x6c, 0x65, 0x20, 0x77, 0x69, 0x64, 0x74, 0x68, 0x3d, 0x22, 0x31, 0x30,
- 0x30, 0x25, 0x22, 0x20, 0x49, 0x6e, 0x20, 0x61, 0x64, 0x64, 0x69, 0x74, 0x69,
- 0x6f, 0x6e, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x20, 0x63, 0x6f, 0x6e,
- 0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x20, 0x74,
- 0x68, 0x65, 0x20, 0x64, 0x69, 0x66, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63, 0x65,
- 0x73, 0x20, 0x62, 0x65, 0x74, 0x77, 0x65, 0x65, 0x6e, 0x64, 0x65, 0x76, 0x65,
- 0x6c, 0x6f, 0x70, 0x6d, 0x65, 0x6e, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68,
- 0x65, 0x20, 0x49, 0x74, 0x20, 0x69, 0x73, 0x20, 0x69, 0x6d, 0x70, 0x6f, 0x72,
- 0x74, 0x61, 0x6e, 0x74, 0x20, 0x74, 0x6f, 0x20, 0x3c, 0x2f, 0x73, 0x63, 0x72,
- 0x69, 0x70, 0x74, 0x3e, 0x0a, 0x0a, 0x3c, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
- 0x20, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x66, 0x6f, 0x6e, 0x74,
- 0x2d, 0x73, 0x69, 0x7a, 0x65, 0x3a, 0x31, 0x3e, 0x3c, 0x2f, 0x73, 0x70, 0x61,
- 0x6e, 0x3e, 0x3c, 0x73, 0x70, 0x61, 0x6e, 0x20, 0x69, 0x64, 0x3d, 0x67, 0x62,
- 0x4c, 0x69, 0x62, 0x72, 0x61, 0x72, 0x79, 0x20, 0x6f, 0x66, 0x20, 0x43, 0x6f,
- 0x6e, 0x67, 0x72, 0x65, 0x73, 0x73, 0x3c, 0x69, 0x6d, 0x67, 0x20, 0x73, 0x72,
- 0x63, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x69, 0x6d, 0x45,
- 0x6e, 0x67, 0x6c, 0x69, 0x73, 0x68, 0x20, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x6c,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x41, 0x63, 0x61, 0x64, 0x65, 0x6d, 0x79, 0x20,
- 0x6f, 0x66, 0x20, 0x53, 0x63, 0x69, 0x65, 0x6e, 0x63, 0x65, 0x73, 0x64, 0x69,
- 0x76, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x64, 0x69, 0x73, 0x70,
- 0x6c, 0x61, 0x79, 0x3a, 0x63, 0x6f, 0x6e, 0x73, 0x74, 0x72, 0x75, 0x63, 0x74,
- 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x2e, 0x67, 0x65,
- 0x74, 0x45, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x42, 0x79, 0x49, 0x64, 0x28,
- 0x69, 0x64, 0x29, 0x69, 0x6e, 0x20, 0x63, 0x6f, 0x6e, 0x6a, 0x75, 0x6e, 0x63,
- 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x77, 0x69, 0x74, 0x68, 0x45, 0x6c, 0x65, 0x6d,
- 0x65, 0x6e, 0x74, 0x28, 0x27, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x27, 0x29,
- 0x3b, 0x20, 0x3c, 0x6d, 0x65, 0x74, 0x61, 0x20, 0x70, 0x72, 0x6f, 0x70, 0x65,
- 0x72, 0x74, 0x79, 0x3d, 0x22, 0x6f, 0x67, 0x3a, 0xd0, 0x91, 0xd1, 0x8a, 0xd0,
- 0xbb, 0xd0, 0xb3, 0xd0, 0xb0, 0xd1, 0x80, 0xd1, 0x81, 0xd0, 0xba, 0xd0, 0xb8,
- 0x0a, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x74, 0x65, 0x78, 0x74, 0x22,
- 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x22, 0x3e, 0x50, 0x72, 0x69, 0x76, 0x61,
- 0x63, 0x79, 0x20, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x3c, 0x2f, 0x61, 0x3e,
- 0x61, 0x64, 0x6d, 0x69, 0x6e, 0x69, 0x73, 0x74, 0x65, 0x72, 0x65, 0x64, 0x20,
- 0x62, 0x79, 0x20, 0x74, 0x68, 0x65, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x53,
- 0x69, 0x6e, 0x67, 0x6c, 0x65, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x73,
- 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b, 0x6d, 0x61,
- 0x72, 0x67, 0x69, 0x6e, 0x3a, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x3c, 0x2f,
- 0x64, 0x69, 0x76, 0x3e, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x3c, 0x3e, 0x3c,
- 0x69, 0x6d, 0x67, 0x20, 0x73, 0x72, 0x63, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70,
- 0x3a, 0x2f, 0x2f, 0x69, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x26, 0x71,
- 0x75, 0x6f, 0x74, 0x3b, 0x66, 0x6c, 0x6f, 0x61, 0x74, 0x3a, 0x72, 0x65, 0x66,
- 0x65, 0x72, 0x72, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x20, 0x61, 0x73, 0x20, 0x74,
- 0x68, 0x65, 0x20, 0x74, 0x6f, 0x74, 0x61, 0x6c, 0x20, 0x70, 0x6f, 0x70, 0x75,
- 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x69, 0x6e, 0x20, 0x57,
- 0x61, 0x73, 0x68, 0x69, 0x6e, 0x67, 0x74, 0x6f, 0x6e, 0x2c, 0x20, 0x44, 0x2e,
- 0x43, 0x2e, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x62, 0x61, 0x63,
- 0x6b, 0x67, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x2d, 0x61, 0x6d, 0x6f, 0x6e, 0x67,
- 0x20, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x20, 0x74, 0x68, 0x69, 0x6e, 0x67, 0x73,
- 0x2c, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e,
- 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x70, 0x61, 0x72, 0x74, 0x69, 0x63,
- 0x69, 0x70, 0x61, 0x74, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65,
- 0x74, 0x68, 0x65, 0x20, 0x69, 0x6e, 0x74, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x74,
- 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x66,
- 0x69, 0x65, 0x64, 0x20, 0x77, 0x69, 0x74, 0x68, 0x20, 0x74, 0x68, 0x65, 0x66,
- 0x69, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x20, 0x63, 0x68, 0x61, 0x72,
- 0x61, 0x63, 0x74, 0x65, 0x72, 0x20, 0x4f, 0x78, 0x66, 0x6f, 0x72, 0x64, 0x20,
- 0x55, 0x6e, 0x69, 0x76, 0x65, 0x72, 0x73, 0x69, 0x74, 0x79, 0x20, 0x6d, 0x69,
- 0x73, 0x75, 0x6e, 0x64, 0x65, 0x72, 0x73, 0x74, 0x61, 0x6e, 0x64, 0x69, 0x6e,
- 0x67, 0x20, 0x6f, 0x66, 0x54, 0x68, 0x65, 0x72, 0x65, 0x20, 0x61, 0x72, 0x65,
- 0x2c, 0x20, 0x68, 0x6f, 0x77, 0x65, 0x76, 0x65, 0x72, 0x2c, 0x73, 0x74, 0x79,
- 0x6c, 0x65, 0x73, 0x68, 0x65, 0x65, 0x74, 0x22, 0x20, 0x68, 0x72, 0x65, 0x66,
- 0x3d, 0x22, 0x2f, 0x43, 0x6f, 0x6c, 0x75, 0x6d, 0x62, 0x69, 0x61, 0x20, 0x55,
- 0x6e, 0x69, 0x76, 0x65, 0x72, 0x73, 0x69, 0x74, 0x79, 0x65, 0x78, 0x70, 0x61,
- 0x6e, 0x64, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x20, 0x69, 0x6e, 0x63, 0x6c, 0x75,
- 0x64, 0x65, 0x75, 0x73, 0x75, 0x61, 0x6c, 0x6c, 0x79, 0x20, 0x72, 0x65, 0x66,
- 0x65, 0x72, 0x72, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x69, 0x6e, 0x64, 0x69, 0x63,
- 0x61, 0x74, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x61, 0x74, 0x20, 0x74, 0x68,
- 0x65, 0x68, 0x61, 0x76, 0x65, 0x20, 0x73, 0x75, 0x67, 0x67, 0x65, 0x73, 0x74,
- 0x65, 0x64, 0x20, 0x74, 0x68, 0x61, 0x74, 0x61, 0x66, 0x66, 0x69, 0x6c, 0x69,
- 0x61, 0x74, 0x65, 0x64, 0x20, 0x77, 0x69, 0x74, 0x68, 0x20, 0x74, 0x68, 0x65,
- 0x63, 0x6f, 0x72, 0x72, 0x65, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x62,
- 0x65, 0x74, 0x77, 0x65, 0x65, 0x6e, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x20,
- 0x6f, 0x66, 0x20, 0x64, 0x69, 0x66, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x74, 0x3e,
- 0x3c, 0x2f, 0x74, 0x64, 0x3e, 0x3c, 0x2f, 0x74, 0x72, 0x3e, 0x3c, 0x2f, 0x74,
- 0x61, 0x62, 0x6c, 0x65, 0x3e, 0x52, 0x65, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x63,
- 0x20, 0x6f, 0x66, 0x20, 0x49, 0x72, 0x65, 0x6c, 0x61, 0x6e, 0x64, 0x0a, 0x3c,
- 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x0a, 0x3c, 0x73, 0x63, 0x72,
- 0x69, 0x70, 0x74, 0x20, 0x75, 0x6e, 0x64, 0x65, 0x72, 0x20, 0x74, 0x68, 0x65,
- 0x20, 0x69, 0x6e, 0x66, 0x6c, 0x75, 0x65, 0x6e, 0x63, 0x65, 0x63, 0x6f, 0x6e,
- 0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x74, 0x6f, 0x20,
- 0x74, 0x68, 0x65, 0x4f, 0x66, 0x66, 0x69, 0x63, 0x69, 0x61, 0x6c, 0x20, 0x77,
- 0x65, 0x62, 0x73, 0x69, 0x74, 0x65, 0x20, 0x6f, 0x66, 0x68, 0x65, 0x61, 0x64,
- 0x71, 0x75, 0x61, 0x72, 0x74, 0x65, 0x72, 0x73, 0x20, 0x6f, 0x66, 0x20, 0x74,
- 0x68, 0x65, 0x63, 0x65, 0x6e, 0x74, 0x65, 0x72, 0x65, 0x64, 0x20, 0x61, 0x72,
- 0x6f, 0x75, 0x6e, 0x64, 0x20, 0x74, 0x68, 0x65, 0x69, 0x6d, 0x70, 0x6c, 0x69,
- 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68,
- 0x65, 0x68, 0x61, 0x76, 0x65, 0x20, 0x62, 0x65, 0x65, 0x6e, 0x20, 0x64, 0x65,
- 0x76, 0x65, 0x6c, 0x6f, 0x70, 0x65, 0x64, 0x46, 0x65, 0x64, 0x65, 0x72, 0x61,
- 0x6c, 0x20, 0x52, 0x65, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x63, 0x20, 0x6f, 0x66,
- 0x62, 0x65, 0x63, 0x61, 0x6d, 0x65, 0x20, 0x69, 0x6e, 0x63, 0x72, 0x65, 0x61,
- 0x73, 0x69, 0x6e, 0x67, 0x6c, 0x79, 0x63, 0x6f, 0x6e, 0x74, 0x69, 0x6e, 0x75,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x4e,
- 0x6f, 0x74, 0x65, 0x2c, 0x20, 0x68, 0x6f, 0x77, 0x65, 0x76, 0x65, 0x72, 0x2c,
- 0x20, 0x74, 0x68, 0x61, 0x74, 0x73, 0x69, 0x6d, 0x69, 0x6c, 0x61, 0x72, 0x20,
- 0x74, 0x6f, 0x20, 0x74, 0x68, 0x61, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x63, 0x61,
- 0x70, 0x61, 0x62, 0x69, 0x6c, 0x69, 0x74, 0x69, 0x65, 0x73, 0x20, 0x6f, 0x66,
- 0x20, 0x74, 0x68, 0x65, 0x61, 0x63, 0x63, 0x6f, 0x72, 0x64, 0x61, 0x6e, 0x63,
- 0x65, 0x20, 0x77, 0x69, 0x74, 0x68, 0x20, 0x74, 0x68, 0x65, 0x70, 0x61, 0x72,
- 0x74, 0x69, 0x63, 0x69, 0x70, 0x61, 0x6e, 0x74, 0x73, 0x20, 0x69, 0x6e, 0x20,
- 0x74, 0x68, 0x65, 0x66, 0x75, 0x72, 0x74, 0x68, 0x65, 0x72, 0x20, 0x64, 0x65,
- 0x76, 0x65, 0x6c, 0x6f, 0x70, 0x6d, 0x65, 0x6e, 0x74, 0x75, 0x6e, 0x64, 0x65,
- 0x72, 0x20, 0x74, 0x68, 0x65, 0x20, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x69,
- 0x6f, 0x6e, 0x69, 0x73, 0x20, 0x6f, 0x66, 0x74, 0x65, 0x6e, 0x20, 0x63, 0x6f,
- 0x6e, 0x73, 0x69, 0x64, 0x65, 0x72, 0x65, 0x64, 0x68, 0x69, 0x73, 0x20, 0x79,
- 0x6f, 0x75, 0x6e, 0x67, 0x65, 0x72, 0x20, 0x62, 0x72, 0x6f, 0x74, 0x68, 0x65,
- 0x72, 0x3c, 0x2f, 0x74, 0x64, 0x3e, 0x3c, 0x2f, 0x74, 0x72, 0x3e, 0x3c, 0x2f,
- 0x74, 0x61, 0x62, 0x6c, 0x65, 0x3e, 0x3c, 0x61, 0x20, 0x68, 0x74, 0x74, 0x70,
- 0x2d, 0x65, 0x71, 0x75, 0x69, 0x76, 0x3d, 0x22, 0x58, 0x2d, 0x55, 0x41, 0x2d,
- 0x70, 0x68, 0x79, 0x73, 0x69, 0x63, 0x61, 0x6c, 0x20, 0x70, 0x72, 0x6f, 0x70,
- 0x65, 0x72, 0x74, 0x69, 0x65, 0x73, 0x6f, 0x66, 0x20, 0x42, 0x72, 0x69, 0x74,
- 0x69, 0x73, 0x68, 0x20, 0x43, 0x6f, 0x6c, 0x75, 0x6d, 0x62, 0x69, 0x61, 0x68,
- 0x61, 0x73, 0x20, 0x62, 0x65, 0x65, 0x6e, 0x20, 0x63, 0x72, 0x69, 0x74, 0x69,
- 0x63, 0x69, 0x7a, 0x65, 0x64, 0x28, 0x77, 0x69, 0x74, 0x68, 0x20, 0x74, 0x68,
- 0x65, 0x20, 0x65, 0x78, 0x63, 0x65, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x71, 0x75,
- 0x65, 0x73, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x20, 0x61, 0x62, 0x6f, 0x75, 0x74,
- 0x20, 0x74, 0x68, 0x65, 0x70, 0x61, 0x73, 0x73, 0x69, 0x6e, 0x67, 0x20, 0x74,
- 0x68, 0x72, 0x6f, 0x75, 0x67, 0x68, 0x20, 0x74, 0x68, 0x65, 0x30, 0x22, 0x20,
- 0x63, 0x65, 0x6c, 0x6c, 0x70, 0x61, 0x64, 0x64, 0x69, 0x6e, 0x67, 0x3d, 0x22,
- 0x30, 0x22, 0x20, 0x74, 0x68, 0x6f, 0x75, 0x73, 0x61, 0x6e, 0x64, 0x73, 0x20,
- 0x6f, 0x66, 0x20, 0x70, 0x65, 0x6f, 0x70, 0x6c, 0x65, 0x72, 0x65, 0x64, 0x69,
- 0x72, 0x65, 0x63, 0x74, 0x73, 0x20, 0x68, 0x65, 0x72, 0x65, 0x2e, 0x20, 0x46,
- 0x6f, 0x72, 0x68, 0x61, 0x76, 0x65, 0x20, 0x63, 0x68, 0x69, 0x6c, 0x64, 0x72,
- 0x65, 0x6e, 0x20, 0x75, 0x6e, 0x64, 0x65, 0x72, 0x25, 0x33, 0x45, 0x25, 0x33,
- 0x43, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x25, 0x33, 0x45, 0x22, 0x29,
- 0x29, 0x3b, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74,
- 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x3c, 0x6c, 0x69, 0x3e,
- 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70,
- 0x3a, 0x2f, 0x2f, 0x73, 0x69, 0x74, 0x65, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x22,
- 0x20, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x3d, 0x22, 0x74, 0x65, 0x78,
- 0x74, 0x2d, 0x64, 0x65, 0x63, 0x6f, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x3a,
- 0x6e, 0x6f, 0x6e, 0x65, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x64, 0x69,
- 0x73, 0x70, 0x6c, 0x61, 0x79, 0x3a, 0x20, 0x6e, 0x6f, 0x6e, 0x65, 0x3c, 0x6d,
- 0x65, 0x74, 0x61, 0x20, 0x68, 0x74, 0x74, 0x70, 0x2d, 0x65, 0x71, 0x75, 0x69,
- 0x76, 0x3d, 0x22, 0x58, 0x2d, 0x6e, 0x65, 0x77, 0x20, 0x44, 0x61, 0x74, 0x65,
- 0x28, 0x29, 0x2e, 0x67, 0x65, 0x74, 0x54, 0x69, 0x6d, 0x65, 0x28, 0x29, 0x20,
- 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x69, 0x6d, 0x61, 0x67, 0x65, 0x2f, 0x78,
- 0x2d, 0x69, 0x63, 0x6f, 0x6e, 0x22, 0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e, 0x3e,
- 0x3c, 0x73, 0x70, 0x61, 0x6e, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22,
- 0x6c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x3d, 0x22, 0x6a, 0x61, 0x76,
- 0x61, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x77, 0x69, 0x6e, 0x64, 0x6f, 0x77,
- 0x2e, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x68, 0x72, 0x65,
- 0x66, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x6a, 0x61, 0x76,
- 0x61, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3a, 0x2d, 0x2d, 0x3e, 0x0d, 0x0a,
- 0x3c, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d,
- 0x22, 0x74, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x27, 0x68, 0x74,
- 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x68, 0x6f, 0x72, 0x74,
- 0x63, 0x75, 0x74, 0x20, 0x69, 0x63, 0x6f, 0x6e, 0x22, 0x20, 0x68, 0x72, 0x65,
- 0x66, 0x3d, 0x22, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0d, 0x0a, 0x3c, 0x64,
- 0x69, 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x3c, 0x73, 0x63,
- 0x72, 0x69, 0x70, 0x74, 0x20, 0x73, 0x72, 0x63, 0x3d, 0x22, 0x68, 0x74, 0x74,
- 0x70, 0x3a, 0x2f, 0x2f, 0x22, 0x20, 0x72, 0x65, 0x6c, 0x3d, 0x22, 0x73, 0x74,
- 0x79, 0x6c, 0x65, 0x73, 0x68, 0x65, 0x65, 0x74, 0x22, 0x20, 0x74, 0x3c, 0x2f,
- 0x64, 0x69, 0x76, 0x3e, 0x0a, 0x3c, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x20,
- 0x74, 0x79, 0x70, 0x65, 0x3d, 0x2f, 0x61, 0x3e, 0x20, 0x3c, 0x61, 0x20, 0x68,
- 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x20,
- 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x54, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x61, 0x72,
- 0x65, 0x6e, 0x63, 0x79, 0x3d, 0x22, 0x58, 0x2d, 0x55, 0x41, 0x2d, 0x43, 0x6f,
- 0x6d, 0x70, 0x61, 0x74, 0x69, 0x62, 0x6c, 0x65, 0x22, 0x20, 0x63, 0x6f, 0x6e,
- 0x72, 0x65, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x68, 0x69, 0x70, 0x20,
- 0x62, 0x65, 0x74, 0x77, 0x65, 0x65, 0x6e, 0x0a, 0x3c, 0x2f, 0x73, 0x63, 0x72,
- 0x69, 0x70, 0x74, 0x3e, 0x0d, 0x0a, 0x3c, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
- 0x20, 0x3c, 0x2f, 0x61, 0x3e, 0x3c, 0x2f, 0x6c, 0x69, 0x3e, 0x3c, 0x2f, 0x75,
- 0x6c, 0x3e, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x61, 0x73, 0x73, 0x6f, 0x63,
- 0x69, 0x61, 0x74, 0x65, 0x64, 0x20, 0x77, 0x69, 0x74, 0x68, 0x20, 0x74, 0x68,
- 0x65, 0x20, 0x70, 0x72, 0x6f, 0x67, 0x72, 0x61, 0x6d, 0x6d, 0x69, 0x6e, 0x67,
- 0x20, 0x6c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x3c, 0x2f, 0x61, 0x3e,
- 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70,
- 0x3a, 0x2f, 0x2f, 0x3c, 0x2f, 0x61, 0x3e, 0x3c, 0x2f, 0x6c, 0x69, 0x3e, 0x3c,
- 0x6c, 0x69, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x66, 0x6f, 0x72,
- 0x6d, 0x20, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x3d, 0x22, 0x68, 0x74, 0x74,
- 0x70, 0x3a, 0x2f, 0x2f, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x73, 0x74, 0x79, 0x6c,
- 0x65, 0x3d, 0x22, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x3a, 0x74, 0x79,
- 0x70, 0x65, 0x3d, 0x22, 0x74, 0x65, 0x78, 0x74, 0x22, 0x20, 0x6e, 0x61, 0x6d,
- 0x65, 0x3d, 0x22, 0x71, 0x22, 0x3c, 0x74, 0x61, 0x62, 0x6c, 0x65, 0x20, 0x77,
- 0x69, 0x64, 0x74, 0x68, 0x3d, 0x22, 0x31, 0x30, 0x30, 0x25, 0x22, 0x20, 0x62,
- 0x61, 0x63, 0x6b, 0x67, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x2d, 0x70, 0x6f, 0x73,
- 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x3a, 0x22, 0x20, 0x62, 0x6f, 0x72, 0x64, 0x65,
- 0x72, 0x3d, 0x22, 0x30, 0x22, 0x20, 0x77, 0x69, 0x64, 0x74, 0x68, 0x3d, 0x22,
- 0x72, 0x65, 0x6c, 0x3d, 0x22, 0x73, 0x68, 0x6f, 0x72, 0x74, 0x63, 0x75, 0x74,
- 0x20, 0x69, 0x63, 0x6f, 0x6e, 0x22, 0x20, 0x68, 0x36, 0x3e, 0x3c, 0x75, 0x6c,
- 0x3e, 0x3c, 0x6c, 0x69, 0x3e, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d,
- 0x22, 0x20, 0x20, 0x3c, 0x6d, 0x65, 0x74, 0x61, 0x20, 0x68, 0x74, 0x74, 0x70,
- 0x2d, 0x65, 0x71, 0x75, 0x69, 0x76, 0x3d, 0x22, 0x63, 0x73, 0x73, 0x22, 0x20,
- 0x6d, 0x65, 0x64, 0x69, 0x61, 0x3d, 0x22, 0x73, 0x63, 0x72, 0x65, 0x65, 0x6e,
- 0x22, 0x20, 0x72, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x69, 0x62, 0x6c, 0x65,
- 0x20, 0x66, 0x6f, 0x72, 0x20, 0x74, 0x68, 0x65, 0x20, 0x22, 0x20, 0x74, 0x79,
- 0x70, 0x65, 0x3d, 0x22, 0x61, 0x70, 0x70, 0x6c, 0x69, 0x63, 0x61, 0x74, 0x69,
- 0x6f, 0x6e, 0x2f, 0x22, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x62,
- 0x61, 0x63, 0x6b, 0x67, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x2d, 0x68, 0x74, 0x6d,
- 0x6c, 0x3b, 0x20, 0x63, 0x68, 0x61, 0x72, 0x73, 0x65, 0x74, 0x3d, 0x75, 0x74,
- 0x66, 0x2d, 0x38, 0x22, 0x20, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x74, 0x72, 0x61,
- 0x6e, 0x73, 0x70, 0x61, 0x72, 0x65, 0x6e, 0x63, 0x79, 0x3d, 0x22, 0x73, 0x74,
- 0x79, 0x6c, 0x65, 0x73, 0x68, 0x65, 0x65, 0x74, 0x22, 0x20, 0x74, 0x79, 0x70,
- 0x65, 0x3d, 0x22, 0x74, 0x65, 0x0d, 0x0a, 0x3c, 0x6d, 0x65, 0x74, 0x61, 0x20,
- 0x68, 0x74, 0x74, 0x70, 0x2d, 0x65, 0x71, 0x75, 0x69, 0x76, 0x3d, 0x22, 0x3e,
- 0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e, 0x3e, 0x3c, 0x73, 0x70, 0x61, 0x6e, 0x20,
- 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x30, 0x22, 0x20, 0x63, 0x65, 0x6c,
- 0x6c, 0x73, 0x70, 0x61, 0x63, 0x69, 0x6e, 0x67, 0x3d, 0x22, 0x30, 0x22, 0x3e,
- 0x3b, 0x0a, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x0a, 0x3c,
- 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x20, 0x73, 0x6f, 0x6d, 0x65, 0x74, 0x69,
- 0x6d, 0x65, 0x73, 0x20, 0x63, 0x61, 0x6c, 0x6c, 0x65, 0x64, 0x20, 0x74, 0x68,
- 0x65, 0x64, 0x6f, 0x65, 0x73, 0x20, 0x6e, 0x6f, 0x74, 0x20, 0x6e, 0x65, 0x63,
- 0x65, 0x73, 0x73, 0x61, 0x72, 0x69, 0x6c, 0x79, 0x46, 0x6f, 0x72, 0x20, 0x6d,
- 0x6f, 0x72, 0x65, 0x20, 0x69, 0x6e, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x69,
- 0x6f, 0x6e, 0x61, 0x74, 0x20, 0x74, 0x68, 0x65, 0x20, 0x62, 0x65, 0x67, 0x69,
- 0x6e, 0x6e, 0x69, 0x6e, 0x67, 0x20, 0x6f, 0x66, 0x20, 0x3c, 0x21, 0x44, 0x4f,
- 0x43, 0x54, 0x59, 0x50, 0x45, 0x20, 0x68, 0x74, 0x6d, 0x6c, 0x3e, 0x3c, 0x68,
- 0x74, 0x6d, 0x6c, 0x70, 0x61, 0x72, 0x74, 0x69, 0x63, 0x75, 0x6c, 0x61, 0x72,
- 0x6c, 0x79, 0x20, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x74, 0x79, 0x70,
- 0x65, 0x3d, 0x22, 0x68, 0x69, 0x64, 0x64, 0x65, 0x6e, 0x22, 0x20, 0x6e, 0x61,
- 0x6d, 0x65, 0x3d, 0x22, 0x6a, 0x61, 0x76, 0x61, 0x73, 0x63, 0x72, 0x69, 0x70,
- 0x74, 0x3a, 0x76, 0x6f, 0x69, 0x64, 0x28, 0x30, 0x29, 0x3b, 0x22, 0x65, 0x66,
- 0x66, 0x65, 0x63, 0x74, 0x69, 0x76, 0x65, 0x6e, 0x65, 0x73, 0x73, 0x20, 0x6f,
- 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x61, 0x75, 0x74, 0x6f, 0x63, 0x6f, 0x6d,
- 0x70, 0x6c, 0x65, 0x74, 0x65, 0x3d, 0x22, 0x6f, 0x66, 0x66, 0x22, 0x20, 0x67,
- 0x65, 0x6e, 0x65, 0x72, 0x61, 0x6c, 0x6c, 0x79, 0x20, 0x63, 0x6f, 0x6e, 0x73,
- 0x69, 0x64, 0x65, 0x72, 0x65, 0x64, 0x3e, 0x3c, 0x69, 0x6e, 0x70, 0x75, 0x74,
- 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x74, 0x65, 0x78, 0x74, 0x22, 0x20,
- 0x22, 0x3e, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x0d, 0x0a,
- 0x3c, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x74, 0x68, 0x72, 0x6f, 0x75, 0x67,
- 0x68, 0x6f, 0x75, 0x74, 0x20, 0x74, 0x68, 0x65, 0x20, 0x77, 0x6f, 0x72, 0x6c,
- 0x64, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x20, 0x6d, 0x69, 0x73, 0x63, 0x6f,
- 0x6e, 0x63, 0x65, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x73, 0x73, 0x6f, 0x63,
- 0x69, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x77, 0x69, 0x74, 0x68, 0x20, 0x74,
- 0x68, 0x65, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0a, 0x3c, 0x2f, 0x64, 0x69,
- 0x76, 0x3e, 0x0a, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x63, 0x64, 0x75, 0x72, 0x69,
- 0x6e, 0x67, 0x20, 0x68, 0x69, 0x73, 0x20, 0x6c, 0x69, 0x66, 0x65, 0x74, 0x69,
- 0x6d, 0x65, 0x2c, 0x63, 0x6f, 0x72, 0x72, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x64,
- 0x69, 0x6e, 0x67, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x74, 0x79, 0x70,
- 0x65, 0x3d, 0x22, 0x69, 0x6d, 0x61, 0x67, 0x65, 0x2f, 0x78, 0x2d, 0x69, 0x63,
- 0x6f, 0x6e, 0x22, 0x20, 0x61, 0x6e, 0x20, 0x69, 0x6e, 0x63, 0x72, 0x65, 0x61,
- 0x73, 0x69, 0x6e, 0x67, 0x20, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x64, 0x69,
- 0x70, 0x6c, 0x6f, 0x6d, 0x61, 0x74, 0x69, 0x63, 0x20, 0x72, 0x65, 0x6c, 0x61,
- 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x61, 0x72, 0x65, 0x20, 0x6f, 0x66, 0x74, 0x65,
- 0x6e, 0x20, 0x63, 0x6f, 0x6e, 0x73, 0x69, 0x64, 0x65, 0x72, 0x65, 0x64, 0x6d,
- 0x65, 0x74, 0x61, 0x20, 0x63, 0x68, 0x61, 0x72, 0x73, 0x65, 0x74, 0x3d, 0x22,
- 0x75, 0x74, 0x66, 0x2d, 0x38, 0x22, 0x20, 0x3c, 0x69, 0x6e, 0x70, 0x75, 0x74,
- 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x74, 0x65, 0x78, 0x74, 0x22, 0x20,
- 0x65, 0x78, 0x61, 0x6d, 0x70, 0x6c, 0x65, 0x73, 0x20, 0x69, 0x6e, 0x63, 0x6c,
- 0x75, 0x64, 0x65, 0x20, 0x74, 0x68, 0x65, 0x22, 0x3e, 0x3c, 0x69, 0x6d, 0x67,
- 0x20, 0x73, 0x72, 0x63, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f,
- 0x69, 0x70, 0x61, 0x72, 0x74, 0x69, 0x63, 0x69, 0x70, 0x61, 0x74, 0x69, 0x6f,
- 0x6e, 0x20, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x74, 0x68, 0x65, 0x20, 0x65,
- 0x73, 0x74, 0x61, 0x62, 0x6c, 0x69, 0x73, 0x68, 0x6d, 0x65, 0x6e, 0x74, 0x20,
- 0x6f, 0x66, 0x0a, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0a, 0x3c, 0x64, 0x69,
- 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x26, 0x61, 0x6d, 0x70,
- 0x3b, 0x6e, 0x62, 0x73, 0x70, 0x3b, 0x26, 0x61, 0x6d, 0x70, 0x3b, 0x6e, 0x62,
- 0x73, 0x70, 0x3b, 0x74, 0x6f, 0x20, 0x64, 0x65, 0x74, 0x65, 0x72, 0x6d, 0x69,
- 0x6e, 0x65, 0x20, 0x77, 0x68, 0x65, 0x74, 0x68, 0x65, 0x72, 0x71, 0x75, 0x69,
- 0x74, 0x65, 0x20, 0x64, 0x69, 0x66, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x74, 0x20,
- 0x66, 0x72, 0x6f, 0x6d, 0x6d, 0x61, 0x72, 0x6b, 0x65, 0x64, 0x20, 0x74, 0x68,
- 0x65, 0x20, 0x62, 0x65, 0x67, 0x69, 0x6e, 0x6e, 0x69, 0x6e, 0x67, 0x64, 0x69,
- 0x73, 0x74, 0x61, 0x6e, 0x63, 0x65, 0x20, 0x62, 0x65, 0x74, 0x77, 0x65, 0x65,
- 0x6e, 0x20, 0x74, 0x68, 0x65, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x69, 0x62, 0x75,
- 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x63,
- 0x6f, 0x6e, 0x66, 0x6c, 0x69, 0x63, 0x74, 0x20, 0x62, 0x65, 0x74, 0x77, 0x65,
- 0x65, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x77, 0x69, 0x64, 0x65, 0x6c, 0x79, 0x20,
- 0x63, 0x6f, 0x6e, 0x73, 0x69, 0x64, 0x65, 0x72, 0x65, 0x64, 0x20, 0x74, 0x6f,
- 0x77, 0x61, 0x73, 0x20, 0x6f, 0x6e, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68,
- 0x65, 0x20, 0x66, 0x69, 0x72, 0x73, 0x74, 0x77, 0x69, 0x74, 0x68, 0x20, 0x76,
- 0x61, 0x72, 0x79, 0x69, 0x6e, 0x67, 0x20, 0x64, 0x65, 0x67, 0x72, 0x65, 0x65,
- 0x73, 0x68, 0x61, 0x76, 0x65, 0x20, 0x73, 0x70, 0x65, 0x63, 0x75, 0x6c, 0x61,
- 0x74, 0x65, 0x64, 0x20, 0x74, 0x68, 0x61, 0x74, 0x28, 0x64, 0x6f, 0x63, 0x75,
- 0x6d, 0x65, 0x6e, 0x74, 0x2e, 0x67, 0x65, 0x74, 0x45, 0x6c, 0x65, 0x6d, 0x65,
- 0x6e, 0x74, 0x70, 0x61, 0x72, 0x74, 0x69, 0x63, 0x69, 0x70, 0x61, 0x74, 0x69,
- 0x6e, 0x67, 0x20, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x6f, 0x72, 0x69, 0x67,
- 0x69, 0x6e, 0x61, 0x6c, 0x6c, 0x79, 0x20, 0x64, 0x65, 0x76, 0x65, 0x6c, 0x6f,
- 0x70, 0x65, 0x64, 0x65, 0x74, 0x61, 0x20, 0x63, 0x68, 0x61, 0x72, 0x73, 0x65,
- 0x74, 0x3d, 0x22, 0x75, 0x74, 0x66, 0x2d, 0x38, 0x22, 0x3e, 0x20, 0x74, 0x79,
- 0x70, 0x65, 0x3d, 0x22, 0x74, 0x65, 0x78, 0x74, 0x2f, 0x63, 0x73, 0x73, 0x22,
- 0x20, 0x2f, 0x3e, 0x0a, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x63, 0x68, 0x61, 0x6e,
- 0x67, 0x65, 0x61, 0x62, 0x6c, 0x79, 0x20, 0x77, 0x69, 0x74, 0x68, 0x6d, 0x6f,
- 0x72, 0x65, 0x20, 0x63, 0x6c, 0x6f, 0x73, 0x65, 0x6c, 0x79, 0x20, 0x72, 0x65,
- 0x6c, 0x61, 0x74, 0x65, 0x64, 0x73, 0x6f, 0x63, 0x69, 0x61, 0x6c, 0x20, 0x61,
- 0x6e, 0x64, 0x20, 0x70, 0x6f, 0x6c, 0x69, 0x74, 0x69, 0x63, 0x61, 0x6c, 0x74,
- 0x68, 0x61, 0x74, 0x20, 0x77, 0x6f, 0x75, 0x6c, 0x64, 0x20, 0x6f, 0x74, 0x68,
- 0x65, 0x72, 0x77, 0x69, 0x73, 0x65, 0x70, 0x65, 0x72, 0x70, 0x65, 0x6e, 0x64,
- 0x69, 0x63, 0x75, 0x6c, 0x61, 0x72, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65,
- 0x73, 0x74, 0x79, 0x6c, 0x65, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x74,
- 0x65, 0x78, 0x74, 0x2f, 0x63, 0x73, 0x73, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22,
- 0x73, 0x75, 0x62, 0x6d, 0x69, 0x74, 0x22, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x3d,
- 0x22, 0x66, 0x61, 0x6d, 0x69, 0x6c, 0x69, 0x65, 0x73, 0x20, 0x72, 0x65, 0x73,
- 0x69, 0x64, 0x69, 0x6e, 0x67, 0x20, 0x69, 0x6e, 0x64, 0x65, 0x76, 0x65, 0x6c,
- 0x6f, 0x70, 0x69, 0x6e, 0x67, 0x20, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x72, 0x69,
- 0x65, 0x73, 0x63, 0x6f, 0x6d, 0x70, 0x75, 0x74, 0x65, 0x72, 0x20, 0x70, 0x72,
- 0x6f, 0x67, 0x72, 0x61, 0x6d, 0x6d, 0x69, 0x6e, 0x67, 0x65, 0x63, 0x6f, 0x6e,
- 0x6f, 0x6d, 0x69, 0x63, 0x20, 0x64, 0x65, 0x76, 0x65, 0x6c, 0x6f, 0x70, 0x6d,
- 0x65, 0x6e, 0x74, 0x64, 0x65, 0x74, 0x65, 0x72, 0x6d, 0x69, 0x6e, 0x61, 0x74,
- 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x66, 0x6f, 0x72,
- 0x20, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x69, 0x6e, 0x66, 0x6f, 0x72, 0x6d, 0x61,
- 0x74, 0x69, 0x6f, 0x6e, 0x6f, 0x6e, 0x20, 0x73, 0x65, 0x76, 0x65, 0x72, 0x61,
- 0x6c, 0x20, 0x6f, 0x63, 0x63, 0x61, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x70, 0x6f,
- 0x72, 0x74, 0x75, 0x67, 0x75, 0xc3, 0xaa, 0x73, 0x20, 0x28, 0x45, 0x75, 0x72,
- 0x6f, 0x70, 0x65, 0x75, 0x29, 0xd0, 0xa3, 0xd0, 0xba, 0xd1, 0x80, 0xd0, 0xb0,
- 0xd1, 0x97, 0xd0, 0xbd, 0xd1, 0x81, 0xd1, 0x8c, 0xd0, 0xba, 0xd0, 0xb0, 0xd1,
- 0x83, 0xd0, 0xba, 0xd1, 0x80, 0xd0, 0xb0, 0xd1, 0x97, 0xd0, 0xbd, 0xd1, 0x81,
- 0xd1, 0x8c, 0xd0, 0xba, 0xd0, 0xb0, 0xd0, 0xa0, 0xd0, 0xbe, 0xd1, 0x81, 0xd1,
- 0x81, 0xd0, 0xb8, 0xd0, 0xb9, 0xd1, 0x81, 0xd0, 0xba, 0xd0, 0xbe, 0xd0, 0xb9,
- 0xd0, 0xbc, 0xd0, 0xb0, 0xd1, 0x82, 0xd0, 0xb5, 0xd1, 0x80, 0xd0, 0xb8, 0xd0,
- 0xb0, 0xd0, 0xbb, 0xd0, 0xbe, 0xd0, 0xb2, 0xd0, 0xb8, 0xd0, 0xbd, 0xd1, 0x84,
- 0xd0, 0xbe, 0xd1, 0x80, 0xd0, 0xbc, 0xd0, 0xb0, 0xd1, 0x86, 0xd0, 0xb8, 0xd0,
- 0xb8, 0xd1, 0x83, 0xd0, 0xbf, 0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xb2, 0xd0, 0xbb,
- 0xd0, 0xb5, 0xd0, 0xbd, 0xd0, 0xb8, 0xd1, 0x8f, 0xd0, 0xbd, 0xd0, 0xb5, 0xd0,
- 0xbe, 0xd0, 0xb1, 0xd1, 0x85, 0xd0, 0xbe, 0xd0, 0xb4, 0xd0, 0xb8, 0xd0, 0xbc,
- 0xd0, 0xbe, 0xd0, 0xb8, 0xd0, 0xbd, 0xd1, 0x84, 0xd0, 0xbe, 0xd1, 0x80, 0xd0,
- 0xbc, 0xd0, 0xb0, 0xd1, 0x86, 0xd0, 0xb8, 0xd1, 0x8f, 0xd0, 0x98, 0xd0, 0xbd,
- 0xd1, 0x84, 0xd0, 0xbe, 0xd1, 0x80, 0xd0, 0xbc, 0xd0, 0xb0, 0xd1, 0x86, 0xd0,
- 0xb8, 0xd1, 0x8f, 0xd0, 0xa0, 0xd0, 0xb5, 0xd1, 0x81, 0xd0, 0xbf, 0xd1, 0x83,
- 0xd0, 0xb1, 0xd0, 0xbb, 0xd0, 0xb8, 0xd0, 0xba, 0xd0, 0xb8, 0xd0, 0xba, 0xd0,
- 0xbe, 0xd0, 0xbb, 0xd0, 0xb8, 0xd1, 0x87, 0xd0, 0xb5, 0xd1, 0x81, 0xd1, 0x82,
- 0xd0, 0xb2, 0xd0, 0xbe, 0xd0, 0xb8, 0xd0, 0xbd, 0xd1, 0x84, 0xd0, 0xbe, 0xd1,
- 0x80, 0xd0, 0xbc, 0xd0, 0xb0, 0xd1, 0x86, 0xd0, 0xb8, 0xd1, 0x8e, 0xd1, 0x82,
- 0xd0, 0xb5, 0xd1, 0x80, 0xd1, 0x80, 0xd0, 0xb8, 0xd1, 0x82, 0xd0, 0xbe, 0xd1,
- 0x80, 0xd0, 0xb8, 0xd0, 0xb8, 0xd0, 0xb4, 0xd0, 0xbe, 0xd1, 0x81, 0xd1, 0x82,
- 0xd0, 0xb0, 0xd1, 0x82, 0xd0, 0xbe, 0xd1, 0x87, 0xd0, 0xbd, 0xd0, 0xbe, 0xd8,
- 0xa7, 0xd9, 0x84, 0xd9, 0x85, 0xd8, 0xaa, 0xd9, 0x88, 0xd8, 0xa7, 0xd8, 0xac,
- 0xd8, 0xaf, 0xd9, 0x88, 0xd9, 0x86, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa7, 0xd8,
- 0xb4, 0xd8, 0xaa, 0xd8, 0xb1, 0xd8, 0xa7, 0xd9, 0x83, 0xd8, 0xa7, 0xd8, 0xaa,
- 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa7, 0xd9, 0x82, 0xd8, 0xaa, 0xd8, 0xb1, 0xd8,
- 0xa7, 0xd8, 0xad, 0xd8, 0xa7, 0xd8, 0xaa, 0x68, 0x74, 0x6d, 0x6c, 0x3b, 0x20,
- 0x63, 0x68, 0x61, 0x72, 0x73, 0x65, 0x74, 0x3d, 0x55, 0x54, 0x46, 0x2d, 0x38,
- 0x22, 0x20, 0x73, 0x65, 0x74, 0x54, 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x28,
- 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x28, 0x29, 0x64, 0x69, 0x73,
- 0x70, 0x6c, 0x61, 0x79, 0x3a, 0x69, 0x6e, 0x6c, 0x69, 0x6e, 0x65, 0x2d, 0x62,
- 0x6c, 0x6f, 0x63, 0x6b, 0x3b, 0x3c, 0x69, 0x6e, 0x70, 0x75, 0x74, 0x20, 0x74,
- 0x79, 0x70, 0x65, 0x3d, 0x22, 0x73, 0x75, 0x62, 0x6d, 0x69, 0x74, 0x22, 0x20,
- 0x74, 0x79, 0x70, 0x65, 0x20, 0x3d, 0x20, 0x27, 0x74, 0x65, 0x78, 0x74, 0x2f,
- 0x6a, 0x61, 0x76, 0x61, 0x73, 0x63, 0x72, 0x69, 0x3c, 0x69, 0x6d, 0x67, 0x20,
- 0x73, 0x72, 0x63, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x77,
- 0x77, 0x77, 0x2e, 0x22, 0x20, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f,
- 0x77, 0x77, 0x77, 0x2e, 0x77, 0x33, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x73, 0x68,
- 0x6f, 0x72, 0x74, 0x63, 0x75, 0x74, 0x20, 0x69, 0x63, 0x6f, 0x6e, 0x22, 0x20,
- 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x22, 0x20, 0x61, 0x75, 0x74, 0x6f, 0x63,
- 0x6f, 0x6d, 0x70, 0x6c, 0x65, 0x74, 0x65, 0x3d, 0x22, 0x6f, 0x66, 0x66, 0x22,
- 0x20, 0x3c, 0x2f, 0x61, 0x3e, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x3c, 0x64,
- 0x69, 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x3c, 0x2f, 0x61, 0x3e,
- 0x3c, 0x2f, 0x6c, 0x69, 0x3e, 0x0a, 0x3c, 0x6c, 0x69, 0x20, 0x63, 0x6c, 0x61,
- 0x73, 0x73, 0x3d, 0x22, 0x63, 0x73, 0x73, 0x22, 0x20, 0x74, 0x79, 0x70, 0x65,
- 0x3d, 0x22, 0x74, 0x65, 0x78, 0x74, 0x2f, 0x63, 0x73, 0x73, 0x22, 0x20, 0x3c,
- 0x66, 0x6f, 0x72, 0x6d, 0x20, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x3d, 0x22,
- 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x78, 0x74, 0x2f, 0x63, 0x73, 0x73,
- 0x22, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a,
- 0x2f, 0x2f, 0x6c, 0x69, 0x6e, 0x6b, 0x20, 0x72, 0x65, 0x6c, 0x3d, 0x22, 0x61,
- 0x6c, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x74, 0x65, 0x22, 0x20, 0x0d, 0x0a, 0x3c,
- 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22,
- 0x74, 0x65, 0x78, 0x74, 0x2f, 0x20, 0x6f, 0x6e, 0x63, 0x6c, 0x69, 0x63, 0x6b,
- 0x3d, 0x22, 0x6a, 0x61, 0x76, 0x61, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3a,
- 0x28, 0x6e, 0x65, 0x77, 0x20, 0x44, 0x61, 0x74, 0x65, 0x29, 0x2e, 0x67, 0x65,
- 0x74, 0x54, 0x69, 0x6d, 0x65, 0x28, 0x29, 0x7d, 0x68, 0x65, 0x69, 0x67, 0x68,
- 0x74, 0x3d, 0x22, 0x31, 0x22, 0x20, 0x77, 0x69, 0x64, 0x74, 0x68, 0x3d, 0x22,
- 0x31, 0x22, 0x20, 0x50, 0x65, 0x6f, 0x70, 0x6c, 0x65, 0x27, 0x73, 0x20, 0x52,
- 0x65, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x63, 0x20, 0x6f, 0x66, 0x20, 0x20, 0x3c,
- 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a,
- 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x74, 0x65, 0x78, 0x74, 0x2d, 0x64, 0x65,
- 0x63, 0x6f, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x3a, 0x75, 0x6e, 0x64, 0x65,
- 0x72, 0x74, 0x68, 0x65, 0x20, 0x62, 0x65, 0x67, 0x69, 0x6e, 0x6e, 0x69, 0x6e,
- 0x67, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x3c, 0x2f, 0x64, 0x69,
- 0x76, 0x3e, 0x0a, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0a, 0x3c, 0x2f, 0x64,
- 0x69, 0x76, 0x3e, 0x0a, 0x65, 0x73, 0x74, 0x61, 0x62, 0x6c, 0x69, 0x73, 0x68,
- 0x6d, 0x65, 0x6e, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x3c,
- 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x3c, 0x2f,
- 0x64, 0x69, 0x76, 0x3e, 0x3c, 0x2f, 0x64, 0x23, 0x76, 0x69, 0x65, 0x77, 0x70,
- 0x6f, 0x72, 0x74, 0x7b, 0x6d, 0x69, 0x6e, 0x2d, 0x68, 0x65, 0x69, 0x67, 0x68,
- 0x74, 0x3a, 0x0a, 0x3c, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x20, 0x73, 0x72,
- 0x63, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x6f, 0x70, 0x74,
- 0x69, 0x6f, 0x6e, 0x3e, 0x3c, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x76,
- 0x61, 0x6c, 0x75, 0x65, 0x3d, 0x6f, 0x66, 0x74, 0x65, 0x6e, 0x20, 0x72, 0x65,
- 0x66, 0x65, 0x72, 0x72, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x20, 0x61, 0x73, 0x20,
- 0x2f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x3e, 0x0a, 0x3c, 0x6f, 0x70, 0x74,
- 0x69, 0x6f, 0x6e, 0x20, 0x76, 0x61, 0x6c, 0x75, 0x3c, 0x21, 0x44, 0x4f, 0x43,
- 0x54, 0x59, 0x50, 0x45, 0x20, 0x68, 0x74, 0x6d, 0x6c, 0x3e, 0x0a, 0x3c, 0x21,
- 0x2d, 0x2d, 0x5b, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x74, 0x69, 0x6f,
- 0x6e, 0x61, 0x6c, 0x20, 0x41, 0x69, 0x72, 0x70, 0x6f, 0x72, 0x74, 0x3e, 0x0a,
- 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70,
- 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x3c, 0x2f, 0x61, 0x3e, 0x3c, 0x61, 0x20,
- 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f,
- 0x77, 0xe0, 0xb8, 0xa0, 0xe0, 0xb8, 0xb2, 0xe0, 0xb8, 0xa9, 0xe0, 0xb8, 0xb2,
- 0xe0, 0xb9, 0x84, 0xe0, 0xb8, 0x97, 0xe0, 0xb8, 0xa2, 0xe1, 0x83, 0xa5, 0xe1,
- 0x83, 0x90, 0xe1, 0x83, 0xa0, 0xe1, 0x83, 0x97, 0xe1, 0x83, 0xa3, 0xe1, 0x83,
- 0x9a, 0xe1, 0x83, 0x98, 0xe6, 0xad, 0xa3, 0xe9, 0xab, 0x94, 0xe4, 0xb8, 0xad,
- 0xe6, 0x96, 0x87, 0x20, 0x28, 0xe7, 0xb9, 0x81, 0xe9, 0xab, 0x94, 0x29, 0xe0,
- 0xa4, 0xa8, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4,
- 0xa6, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb6, 0xe0, 0xa4, 0xa1, 0xe0, 0xa4, 0xbe,
- 0xe0, 0xa4, 0x89, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x8b, 0xe0,
- 0xa4, 0xa1, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb7, 0xe0, 0xa5,
- 0x87, 0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0x9c,
- 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xbe, 0xe0,
- 0xa4, 0xb0, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0x82, 0xe0, 0xa4,
- 0xac, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xa7, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xa4,
- 0xe0, 0xa4, 0xb8, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xa5, 0xe0, 0xa4, 0xbe, 0xe0,
- 0xa4, 0xaa, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb8, 0xe0, 0xa5,
- 0x8d, 0xe0, 0xa4, 0xb5, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xbe,
- 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xb8, 0xe0,
- 0xa5, 0x8d, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xa3, 0xe0, 0xa4,
- 0xb8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0x97, 0xe0, 0xa5, 0x8d,
- 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0x9a, 0xe0, 0xa4, 0xbf, 0xe0,
- 0xa4, 0x9f, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xa0, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4,
- 0x82, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0x9c, 0xe0, 0xa5, 0x8d,
- 0xe0, 0xa4, 0x9e, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0x85, 0xe0,
- 0xa4, 0xae, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4,
- 0x95, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xad,
- 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xa8, 0xe0,
- 0xa4, 0x97, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa1, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4,
- 0xaf, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x81, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x8d,
- 0xe0, 0xa4, 0xaf, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0x95, 0xe0,
- 0xa4, 0xbf, 0xe0, 0xa4, 0xb8, 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4,
- 0x95, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb7, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xaa,
- 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0x81, 0xe0, 0xa4, 0x9a, 0xe0,
- 0xa4, 0xa4, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xaa, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4,
- 0xb0, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xa7, 0xe0, 0xa4, 0xa8,
- 0xe0, 0xa4, 0x9f, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xaa, 0xe0, 0xa5, 0x8d, 0xe0,
- 0xa4, 0xaa, 0xe0, 0xa4, 0xa3, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0x95, 0xe0, 0xa5,
- 0x8d, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x87,
- 0xe0, 0xa4, 0x9f, 0xe0, 0xa4, 0xaa, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb0, 0xe0,
- 0xa4, 0xbe, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xad, 0xe0, 0xa4,
- 0xaa, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xaa,
- 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xbe, 0xe0,
- 0xa4, 0xb2, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4,
- 0x82, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xab, 0xe0, 0xa4, 0xbc, 0xe0, 0xa5, 0x8d,
- 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xa8, 0xe0,
- 0xa4, 0xbf, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xae, 0xe0, 0xa4,
- 0xbe, 0xe0, 0xa4, 0xa3, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xae,
- 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0x9f, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xa1, 0x64,
- 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x20, 0x63,
- 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x3d, 0x22, 0x64, 0x6f, 0x63, 0x75, 0x6d,
- 0x65, 0x6e, 0x74, 0x2e, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e,
- 0x70, 0x72, 0x6f, 0x74, 0x2e, 0x67, 0x65, 0x74, 0x45, 0x6c, 0x65, 0x6d, 0x65,
- 0x6e, 0x74, 0x73, 0x42, 0x79, 0x54, 0x61, 0x67, 0x4e, 0x61, 0x6d, 0x65, 0x28,
- 0x3c, 0x21, 0x44, 0x4f, 0x43, 0x54, 0x59, 0x50, 0x45, 0x20, 0x68, 0x74, 0x6d,
- 0x6c, 0x3e, 0x0a, 0x3c, 0x68, 0x74, 0x6d, 0x6c, 0x20, 0x3c, 0x6d, 0x65, 0x74,
- 0x61, 0x20, 0x63, 0x68, 0x61, 0x72, 0x73, 0x65, 0x74, 0x3d, 0x22, 0x75, 0x74,
- 0x66, 0x2d, 0x38, 0x22, 0x3e, 0x3a, 0x75, 0x72, 0x6c, 0x22, 0x20, 0x63, 0x6f,
- 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f,
- 0x2f, 0x2e, 0x63, 0x73, 0x73, 0x22, 0x20, 0x72, 0x65, 0x6c, 0x3d, 0x22, 0x73,
- 0x74, 0x79, 0x6c, 0x65, 0x73, 0x68, 0x65, 0x65, 0x74, 0x22, 0x73, 0x74, 0x79,
- 0x6c, 0x65, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x74, 0x65, 0x78, 0x74,
- 0x2f, 0x63, 0x73, 0x73, 0x22, 0x3e, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x74,
- 0x65, 0x78, 0x74, 0x2f, 0x63, 0x73, 0x73, 0x22, 0x20, 0x68, 0x72, 0x65, 0x66,
- 0x3d, 0x22, 0x77, 0x33, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x31, 0x39, 0x39, 0x39,
- 0x2f, 0x78, 0x68, 0x74, 0x6d, 0x6c, 0x22, 0x20, 0x78, 0x6d, 0x6c, 0x74, 0x79,
- 0x70, 0x65, 0x3d, 0x22, 0x74, 0x65, 0x78, 0x74, 0x2f, 0x6a, 0x61, 0x76, 0x61,
- 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x22, 0x20, 0x6d, 0x65, 0x74, 0x68, 0x6f,
- 0x64, 0x3d, 0x22, 0x67, 0x65, 0x74, 0x22, 0x20, 0x61, 0x63, 0x74, 0x69, 0x6f,
- 0x6e, 0x3d, 0x22, 0x6c, 0x69, 0x6e, 0x6b, 0x20, 0x72, 0x65, 0x6c, 0x3d, 0x22,
- 0x73, 0x74, 0x79, 0x6c, 0x65, 0x73, 0x68, 0x65, 0x65, 0x74, 0x22, 0x20, 0x20,
- 0x3d, 0x20, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x2e, 0x67, 0x65,
- 0x74, 0x45, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x74, 0x79, 0x70, 0x65, 0x3d,
- 0x22, 0x69, 0x6d, 0x61, 0x67, 0x65, 0x2f, 0x78, 0x2d, 0x69, 0x63, 0x6f, 0x6e,
- 0x22, 0x20, 0x2f, 0x3e, 0x63, 0x65, 0x6c, 0x6c, 0x70, 0x61, 0x64, 0x64, 0x69,
- 0x6e, 0x67, 0x3d, 0x22, 0x30, 0x22, 0x20, 0x63, 0x65, 0x6c, 0x6c, 0x73, 0x70,
- 0x2e, 0x63, 0x73, 0x73, 0x22, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x74,
- 0x65, 0x78, 0x74, 0x2f, 0x63, 0x73, 0x73, 0x22, 0x20, 0x3c, 0x2f, 0x61, 0x3e,
- 0x3c, 0x2f, 0x6c, 0x69, 0x3e, 0x3c, 0x6c, 0x69, 0x3e, 0x3c, 0x61, 0x20, 0x68,
- 0x72, 0x65, 0x66, 0x3d, 0x22, 0x22, 0x20, 0x77, 0x69, 0x64, 0x74, 0x68, 0x3d,
- 0x22, 0x31, 0x22, 0x20, 0x68, 0x65, 0x69, 0x67, 0x68, 0x74, 0x3d, 0x22, 0x31,
- 0x22, 0x22, 0x3e, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68,
- 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x73, 0x74, 0x79,
- 0x6c, 0x65, 0x3d, 0x22, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x3a, 0x6e,
- 0x6f, 0x6e, 0x65, 0x3b, 0x22, 0x3e, 0x61, 0x6c, 0x74, 0x65, 0x72, 0x6e, 0x61,
- 0x74, 0x65, 0x22, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x61, 0x70, 0x70,
- 0x6c, 0x69, 0x2d, 0x2f, 0x2f, 0x57, 0x33, 0x43, 0x2f, 0x2f, 0x44, 0x54, 0x44,
- 0x20, 0x58, 0x48, 0x54, 0x4d, 0x4c, 0x20, 0x31, 0x2e, 0x30, 0x20, 0x65, 0x6c,
- 0x6c, 0x73, 0x70, 0x61, 0x63, 0x69, 0x6e, 0x67, 0x3d, 0x22, 0x30, 0x22, 0x20,
- 0x63, 0x65, 0x6c, 0x6c, 0x70, 0x61, 0x64, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d,
- 0x22, 0x68, 0x69, 0x64, 0x64, 0x65, 0x6e, 0x22, 0x20, 0x76, 0x61, 0x6c, 0x75,
- 0x65, 0x3d, 0x22, 0x2f, 0x61, 0x3e, 0x26, 0x6e, 0x62, 0x73, 0x70, 0x3b, 0x3c,
- 0x73, 0x70, 0x61, 0x6e, 0x20, 0x72, 0x6f, 0x6c, 0x65, 0x3d, 0x22, 0x73, 0x0a,
- 0x3c, 0x69, 0x6e, 0x70, 0x75, 0x74, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22,
- 0x68, 0x69, 0x64, 0x64, 0x65, 0x6e, 0x22, 0x20, 0x6c, 0x61, 0x6e, 0x67, 0x75,
- 0x61, 0x67, 0x65, 0x3d, 0x22, 0x4a, 0x61, 0x76, 0x61, 0x53, 0x63, 0x72, 0x69,
- 0x70, 0x74, 0x22, 0x20, 0x20, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74,
- 0x2e, 0x67, 0x65, 0x74, 0x45, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x42,
- 0x67, 0x3d, 0x22, 0x30, 0x22, 0x20, 0x63, 0x65, 0x6c, 0x6c, 0x73, 0x70, 0x61,
- 0x63, 0x69, 0x6e, 0x67, 0x3d, 0x22, 0x30, 0x22, 0x20, 0x79, 0x70, 0x65, 0x3d,
- 0x22, 0x74, 0x65, 0x78, 0x74, 0x2f, 0x63, 0x73, 0x73, 0x22, 0x20, 0x6d, 0x65,
- 0x64, 0x69, 0x61, 0x3d, 0x22, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x27, 0x74, 0x65,
- 0x78, 0x74, 0x2f, 0x6a, 0x61, 0x76, 0x61, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
- 0x27, 0x77, 0x69, 0x74, 0x68, 0x20, 0x74, 0x68, 0x65, 0x20, 0x65, 0x78, 0x63,
- 0x65, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x20, 0x79, 0x70, 0x65,
- 0x3d, 0x22, 0x74, 0x65, 0x78, 0x74, 0x2f, 0x63, 0x73, 0x73, 0x22, 0x20, 0x72,
- 0x65, 0x6c, 0x3d, 0x22, 0x73, 0x74, 0x20, 0x68, 0x65, 0x69, 0x67, 0x68, 0x74,
- 0x3d, 0x22, 0x31, 0x22, 0x20, 0x77, 0x69, 0x64, 0x74, 0x68, 0x3d, 0x22, 0x31,
- 0x22, 0x20, 0x3d, 0x27, 0x2b, 0x65, 0x6e, 0x63, 0x6f, 0x64, 0x65, 0x55, 0x52,
- 0x49, 0x43, 0x6f, 0x6d, 0x70, 0x6f, 0x6e, 0x65, 0x6e, 0x74, 0x28, 0x3c, 0x6c,
- 0x69, 0x6e, 0x6b, 0x20, 0x72, 0x65, 0x6c, 0x3d, 0x22, 0x61, 0x6c, 0x74, 0x65,
- 0x72, 0x6e, 0x61, 0x74, 0x65, 0x22, 0x20, 0x0a, 0x62, 0x6f, 0x64, 0x79, 0x2c,
- 0x20, 0x74, 0x72, 0x2c, 0x20, 0x69, 0x6e, 0x70, 0x75, 0x74, 0x2c, 0x20, 0x74,
- 0x65, 0x78, 0x74, 0x6d, 0x65, 0x74, 0x61, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x3d,
- 0x22, 0x72, 0x6f, 0x62, 0x6f, 0x74, 0x73, 0x22, 0x20, 0x63, 0x6f, 0x6e, 0x6d,
- 0x65, 0x74, 0x68, 0x6f, 0x64, 0x3d, 0x22, 0x70, 0x6f, 0x73, 0x74, 0x22, 0x20,
- 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x3d, 0x22, 0x3e, 0x0a, 0x3c, 0x61, 0x20,
- 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f,
- 0x77, 0x77, 0x77, 0x2e, 0x63, 0x73, 0x73, 0x22, 0x20, 0x72, 0x65, 0x6c, 0x3d,
- 0x22, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x73, 0x68, 0x65, 0x65, 0x74, 0x22, 0x20,
- 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x3c,
- 0x64, 0x69, 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x6c, 0x61, 0x6e, 0x67,
- 0x75, 0x61, 0x67, 0x65, 0x3d, 0x22, 0x6a, 0x61, 0x76, 0x61, 0x73, 0x63, 0x72,
- 0x69, 0x70, 0x74, 0x22, 0x3e, 0x61, 0x72, 0x69, 0x61, 0x2d, 0x68, 0x69, 0x64,
- 0x64, 0x65, 0x6e, 0x3d, 0x22, 0x74, 0x72, 0x75, 0x65, 0x22, 0x3e, 0xc2, 0xb7,
- 0x3c, 0x72, 0x69, 0x70, 0x74, 0x22, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22,
- 0x74, 0x65, 0x78, 0x74, 0x2f, 0x6a, 0x61, 0x76, 0x61, 0x73, 0x6c, 0x3d, 0x30,
- 0x3b, 0x7d, 0x29, 0x28, 0x29, 0x3b, 0x0a, 0x28, 0x66, 0x75, 0x6e, 0x63, 0x74,
- 0x69, 0x6f, 0x6e, 0x28, 0x29, 0x7b, 0x62, 0x61, 0x63, 0x6b, 0x67, 0x72, 0x6f,
- 0x75, 0x6e, 0x64, 0x2d, 0x69, 0x6d, 0x61, 0x67, 0x65, 0x3a, 0x20, 0x75, 0x72,
- 0x6c, 0x28, 0x2f, 0x61, 0x3e, 0x3c, 0x2f, 0x6c, 0x69, 0x3e, 0x3c, 0x6c, 0x69,
- 0x3e, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x09, 0x09,
- 0x3c, 0x6c, 0x69, 0x3e, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22,
- 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x61, 0x74, 0x6f, 0x72, 0x22, 0x20,
- 0x61, 0x72, 0x69, 0x61, 0x2d, 0x68, 0x69, 0x64, 0x64, 0x65, 0x6e, 0x3d, 0x22,
- 0x74, 0x72, 0x75, 0x3e, 0x20, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d,
- 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x6c,
- 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x3d, 0x22, 0x6a, 0x61, 0x76, 0x61,
- 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x22, 0x20, 0x2f, 0x6f, 0x70, 0x74, 0x69,
- 0x6f, 0x6e, 0x3e, 0x0a, 0x3c, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x76,
- 0x61, 0x6c, 0x75, 0x65, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x3c, 0x2f, 0x64, 0x69,
- 0x76, 0x3e, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d,
- 0x72, 0x61, 0x74, 0x6f, 0x72, 0x22, 0x20, 0x61, 0x72, 0x69, 0x61, 0x2d, 0x68,
- 0x69, 0x64, 0x64, 0x65, 0x6e, 0x3d, 0x22, 0x74, 0x72, 0x65, 0x3d, 0x28, 0x6e,
- 0x65, 0x77, 0x20, 0x44, 0x61, 0x74, 0x65, 0x29, 0x2e, 0x67, 0x65, 0x74, 0x54,
- 0x69, 0x6d, 0x65, 0x28, 0x29, 0x70, 0x6f, 0x72, 0x74, 0x75, 0x67, 0x75, 0xc3,
- 0xaa, 0x73, 0x20, 0x28, 0x64, 0x6f, 0x20, 0x42, 0x72, 0x61, 0x73, 0x69, 0x6c,
- 0x29, 0xd0, 0xbe, 0xd1, 0x80, 0xd0, 0xb3, 0xd0, 0xb0, 0xd0, 0xbd, 0xd0, 0xb8,
- 0xd0, 0xb7, 0xd0, 0xb0, 0xd1, 0x86, 0xd0, 0xb8, 0xd0, 0xb8, 0xd0, 0xb2, 0xd0,
- 0xbe, 0xd0, 0xb7, 0xd0, 0xbc, 0xd0, 0xbe, 0xd0, 0xb6, 0xd0, 0xbd, 0xd0, 0xbe,
- 0xd1, 0x81, 0xd1, 0x82, 0xd1, 0x8c, 0xd0, 0xbe, 0xd0, 0xb1, 0xd1, 0x80, 0xd0,
- 0xb0, 0xd0, 0xb7, 0xd0, 0xbe, 0xd0, 0xb2, 0xd0, 0xb0, 0xd0, 0xbd, 0xd0, 0xb8,
- 0xd1, 0x8f, 0xd1, 0x80, 0xd0, 0xb5, 0xd0, 0xb3, 0xd0, 0xb8, 0xd1, 0x81, 0xd1,
- 0x82, 0xd1, 0x80, 0xd0, 0xb0, 0xd1, 0x86, 0xd0, 0xb8, 0xd0, 0xb8, 0xd0, 0xb2,
- 0xd0, 0xbe, 0xd0, 0xb7, 0xd0, 0xbc, 0xd0, 0xbe, 0xd0, 0xb6, 0xd0, 0xbd, 0xd0,
- 0xbe, 0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xb8, 0xd0, 0xbe, 0xd0, 0xb1, 0xd1, 0x8f,
- 0xd0, 0xb7, 0xd0, 0xb0, 0xd1, 0x82, 0xd0, 0xb5, 0xd0, 0xbb, 0xd1, 0x8c, 0xd0,
- 0xbd, 0xd0, 0xb0, 0x3c, 0x21, 0x44, 0x4f, 0x43, 0x54, 0x59, 0x50, 0x45, 0x20,
- 0x68, 0x74, 0x6d, 0x6c, 0x20, 0x50, 0x55, 0x42, 0x4c, 0x49, 0x43, 0x20, 0x22,
- 0x6e, 0x74, 0x2d, 0x54, 0x79, 0x70, 0x65, 0x22, 0x20, 0x63, 0x6f, 0x6e, 0x74,
- 0x65, 0x6e, 0x74, 0x3d, 0x22, 0x74, 0x65, 0x78, 0x74, 0x2f, 0x3c, 0x6d, 0x65,
- 0x74, 0x61, 0x20, 0x68, 0x74, 0x74, 0x70, 0x2d, 0x65, 0x71, 0x75, 0x69, 0x76,
- 0x3d, 0x22, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x72, 0x61, 0x6e, 0x73, 0x69, 0x74,
- 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x2f, 0x2f, 0x45, 0x4e, 0x22, 0x20, 0x22, 0x68,
- 0x74, 0x74, 0x70, 0x3a, 0x3c, 0x68, 0x74, 0x6d, 0x6c, 0x20, 0x78, 0x6d, 0x6c,
- 0x6e, 0x73, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x77, 0x77,
- 0x77, 0x2d, 0x2f, 0x2f, 0x57, 0x33, 0x43, 0x2f, 0x2f, 0x44, 0x54, 0x44, 0x20,
- 0x58, 0x48, 0x54, 0x4d, 0x4c, 0x20, 0x31, 0x2e, 0x30, 0x20, 0x54, 0x44, 0x54,
- 0x44, 0x2f, 0x78, 0x68, 0x74, 0x6d, 0x6c, 0x31, 0x2d, 0x74, 0x72, 0x61, 0x6e,
- 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x2f, 0x2f, 0x77, 0x77, 0x77,
- 0x2e, 0x77, 0x33, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x54, 0x52, 0x2f, 0x78, 0x68,
- 0x74, 0x6d, 0x6c, 0x31, 0x2f, 0x70, 0x65, 0x20, 0x3d, 0x20, 0x27, 0x74, 0x65,
- 0x78, 0x74, 0x2f, 0x6a, 0x61, 0x76, 0x61, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
- 0x27, 0x3b, 0x3c, 0x6d, 0x65, 0x74, 0x61, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x3d,
- 0x22, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x70,
- 0x61, 0x72, 0x65, 0x6e, 0x74, 0x4e, 0x6f, 0x64, 0x65, 0x2e, 0x69, 0x6e, 0x73,
- 0x65, 0x72, 0x74, 0x42, 0x65, 0x66, 0x6f, 0x72, 0x65, 0x3c, 0x69, 0x6e, 0x70,
- 0x75, 0x74, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x68, 0x69, 0x64, 0x64,
- 0x65, 0x6e, 0x22, 0x20, 0x6e, 0x61, 0x6a, 0x73, 0x22, 0x20, 0x74, 0x79, 0x70,
- 0x65, 0x3d, 0x22, 0x74, 0x65, 0x78, 0x74, 0x2f, 0x6a, 0x61, 0x76, 0x61, 0x73,
- 0x63, 0x72, 0x69, 0x28, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x29,
- 0x2e, 0x72, 0x65, 0x61, 0x64, 0x79, 0x28, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69,
- 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22,
- 0x74, 0x65, 0x78, 0x74, 0x2f, 0x6a, 0x61, 0x76, 0x61, 0x73, 0x69, 0x6d, 0x61,
- 0x67, 0x65, 0x22, 0x20, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x3d, 0x22,
- 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x55, 0x41, 0x2d, 0x43, 0x6f, 0x6d,
- 0x70, 0x61, 0x74, 0x69, 0x62, 0x6c, 0x65, 0x22, 0x20, 0x63, 0x6f, 0x6e, 0x74,
- 0x65, 0x6e, 0x74, 0x3d, 0x74, 0x6d, 0x6c, 0x3b, 0x20, 0x63, 0x68, 0x61, 0x72,
- 0x73, 0x65, 0x74, 0x3d, 0x75, 0x74, 0x66, 0x2d, 0x38, 0x22, 0x20, 0x2f, 0x3e,
- 0x0a, 0x6c, 0x69, 0x6e, 0x6b, 0x20, 0x72, 0x65, 0x6c, 0x3d, 0x22, 0x73, 0x68,
- 0x6f, 0x72, 0x74, 0x63, 0x75, 0x74, 0x20, 0x69, 0x63, 0x6f, 0x6e, 0x3c, 0x6c,
- 0x69, 0x6e, 0x6b, 0x20, 0x72, 0x65, 0x6c, 0x3d, 0x22, 0x73, 0x74, 0x79, 0x6c,
- 0x65, 0x73, 0x68, 0x65, 0x65, 0x74, 0x22, 0x20, 0x3c, 0x2f, 0x73, 0x63, 0x72,
- 0x69, 0x70, 0x74, 0x3e, 0x0a, 0x3c, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x20,
- 0x74, 0x79, 0x70, 0x65, 0x3d, 0x3d, 0x20, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65,
- 0x6e, 0x74, 0x2e, 0x63, 0x72, 0x65, 0x61, 0x74, 0x65, 0x45, 0x6c, 0x65, 0x6d,
- 0x65, 0x6e, 0x3c, 0x61, 0x20, 0x74, 0x61, 0x72, 0x67, 0x65, 0x74, 0x3d, 0x22,
- 0x5f, 0x62, 0x6c, 0x61, 0x6e, 0x6b, 0x22, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d,
- 0x20, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x2e, 0x67, 0x65, 0x74,
- 0x45, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x42, 0x69, 0x6e, 0x70, 0x75,
- 0x74, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x74, 0x65, 0x78, 0x74, 0x22,
- 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x61, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x20,
- 0x3d, 0x20, 0x27, 0x74, 0x65, 0x78, 0x74, 0x2f, 0x6a, 0x61, 0x76, 0x61, 0x73,
- 0x63, 0x72, 0x69, 0x6e, 0x70, 0x75, 0x74, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d,
- 0x22, 0x68, 0x69, 0x64, 0x64, 0x65, 0x6e, 0x22, 0x20, 0x6e, 0x61, 0x6d, 0x65,
- 0x68, 0x74, 0x6d, 0x6c, 0x3b, 0x20, 0x63, 0x68, 0x61, 0x72, 0x73, 0x65, 0x74,
- 0x3d, 0x75, 0x74, 0x66, 0x2d, 0x38, 0x22, 0x20, 0x2f, 0x3e, 0x64, 0x74, 0x64,
- 0x22, 0x3e, 0x0a, 0x3c, 0x68, 0x74, 0x6d, 0x6c, 0x20, 0x78, 0x6d, 0x6c, 0x6e,
- 0x73, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x2d, 0x2f, 0x2f, 0x57, 0x33, 0x43,
- 0x2f, 0x2f, 0x44, 0x54, 0x44, 0x20, 0x48, 0x54, 0x4d, 0x4c, 0x20, 0x34, 0x2e,
- 0x30, 0x31, 0x20, 0x54, 0x65, 0x6e, 0x74, 0x73, 0x42, 0x79, 0x54, 0x61, 0x67,
- 0x4e, 0x61, 0x6d, 0x65, 0x28, 0x27, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x27,
- 0x29, 0x69, 0x6e, 0x70, 0x75, 0x74, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22,
- 0x68, 0x69, 0x64, 0x64, 0x65, 0x6e, 0x22, 0x20, 0x6e, 0x61, 0x6d, 0x3c, 0x73,
- 0x63, 0x72, 0x69, 0x70, 0x74, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x74,
- 0x65, 0x78, 0x74, 0x2f, 0x6a, 0x61, 0x76, 0x61, 0x73, 0x22, 0x20, 0x73, 0x74,
- 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x3a,
- 0x6e, 0x6f, 0x6e, 0x65, 0x3b, 0x22, 0x3e, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65,
- 0x6e, 0x74, 0x2e, 0x67, 0x65, 0x74, 0x45, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74,
- 0x42, 0x79, 0x49, 0x64, 0x28, 0x3d, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e,
- 0x74, 0x2e, 0x63, 0x72, 0x65, 0x61, 0x74, 0x65, 0x45, 0x6c, 0x65, 0x6d, 0x65,
- 0x6e, 0x74, 0x28, 0x27, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x27, 0x74, 0x65,
- 0x78, 0x74, 0x2f, 0x6a, 0x61, 0x76, 0x61, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
- 0x27, 0x69, 0x6e, 0x70, 0x75, 0x74, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22,
- 0x74, 0x65, 0x78, 0x74, 0x22, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x22, 0x64,
- 0x2e, 0x67, 0x65, 0x74, 0x45, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x42,
- 0x79, 0x54, 0x61, 0x67, 0x4e, 0x61, 0x6d, 0x65, 0x28, 0x73, 0x6e, 0x69, 0x63,
- 0x61, 0x6c, 0x22, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74, 0x74,
- 0x70, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x43, 0x2f, 0x2f, 0x44, 0x54,
- 0x44, 0x20, 0x48, 0x54, 0x4d, 0x4c, 0x20, 0x34, 0x2e, 0x30, 0x31, 0x20, 0x54,
- 0x72, 0x61, 0x6e, 0x73, 0x69, 0x74, 0x3c, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x20,
- 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x74, 0x65, 0x78, 0x74, 0x2f, 0x63, 0x73,
- 0x73, 0x22, 0x3e, 0x0a, 0x0a, 0x3c, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x20, 0x74,
- 0x79, 0x70, 0x65, 0x3d, 0x22, 0x74, 0x65, 0x78, 0x74, 0x2f, 0x63, 0x73, 0x73,
- 0x22, 0x3e, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x2e, 0x64, 0x74, 0x64, 0x22, 0x3e,
- 0x0a, 0x3c, 0x68, 0x74, 0x6d, 0x6c, 0x20, 0x78, 0x6d, 0x6c, 0x6e, 0x73, 0x3d,
- 0x68, 0x74, 0x74, 0x70, 0x2d, 0x65, 0x71, 0x75, 0x69, 0x76, 0x3d, 0x22, 0x43,
- 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x2d, 0x54, 0x79, 0x70, 0x65, 0x64, 0x69,
- 0x6e, 0x67, 0x3d, 0x22, 0x30, 0x22, 0x20, 0x63, 0x65, 0x6c, 0x6c, 0x73, 0x70,
- 0x61, 0x63, 0x69, 0x6e, 0x67, 0x3d, 0x22, 0x30, 0x22, 0x68, 0x74, 0x6d, 0x6c,
- 0x3b, 0x20, 0x63, 0x68, 0x61, 0x72, 0x73, 0x65, 0x74, 0x3d, 0x75, 0x74, 0x66,
- 0x2d, 0x38, 0x22, 0x20, 0x2f, 0x3e, 0x0a, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65,
- 0x3d, 0x22, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x3a, 0x6e, 0x6f, 0x6e,
- 0x65, 0x3b, 0x22, 0x3e, 0x3c, 0x3c, 0x6c, 0x69, 0x3e, 0x3c, 0x61, 0x20, 0x68,
- 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x77,
- 0x77, 0x77, 0x2e, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x27, 0x74, 0x65, 0x78,
- 0x74, 0x2f, 0x6a, 0x61, 0x76, 0x61, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x27,
- 0x3e, 0xd0, 0xb4, 0xd0, 0xb5, 0xd1, 0x8f, 0xd1, 0x82, 0xd0, 0xb5, 0xd0, 0xbb,
- 0xd1, 0x8c, 0xd0, 0xbd, 0xd0, 0xbe, 0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xb8, 0xd1,
- 0x81, 0xd0, 0xbe, 0xd0, 0xbe, 0xd1, 0x82, 0xd0, 0xb2, 0xd0, 0xb5, 0xd1, 0x82,
- 0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xb2, 0xd0, 0xb8, 0xd0, 0xb8, 0xd0, 0xbf, 0xd1,
- 0x80, 0xd0, 0xbe, 0xd0, 0xb8, 0xd0, 0xb7, 0xd0, 0xb2, 0xd0, 0xbe, 0xd0, 0xb4,
- 0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xb2, 0xd0, 0xb0, 0xd0, 0xb1, 0xd0, 0xb5, 0xd0,
- 0xb7, 0xd0, 0xbe, 0xd0, 0xbf, 0xd0, 0xb0, 0xd1, 0x81, 0xd0, 0xbd, 0xd0, 0xbe,
- 0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xb8, 0xe0, 0xa4, 0xaa, 0xe0, 0xa5, 0x81, 0xe0,
- 0xa4, 0xb8, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4,
- 0x95, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x82,
- 0xe0, 0xa4, 0x97, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x87, 0xe0,
- 0xa4, 0xb8, 0xe0, 0xa4, 0x89, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4,
- 0xb9, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x87,
- 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xa7, 0xe0, 0xa4, 0xbe, 0xe0,
- 0xa4, 0xa8, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xad, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4,
- 0xab, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb8,
- 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0xb8, 0xe0,
- 0xa5, 0x81, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4,
- 0xb7, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x89,
- 0xe0, 0xa4, 0xaa, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xbe, 0xe0,
- 0xa4, 0x87, 0xe0, 0xa4, 0x9f, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4,
- 0x9c, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0x9e, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xaa,
- 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb0, 0xe0,
- 0xa5, 0x8d, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4,
- 0x88, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb0,
- 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xbe,
-};
-
-#if defined(__cplusplus) || defined(c_plusplus)
-} /* extern "C" */
-#endif
diff --git a/Source/ThirdParty/brotli/dec/dictionary.h b/Source/ThirdParty/brotli/dec/dictionary.h
deleted file mode 100644
index ae250c2d7..000000000
--- a/Source/ThirdParty/brotli/dec/dictionary.h
+++ /dev/null
@@ -1,38 +0,0 @@
-/* Copyright 2013 Google Inc. All Rights Reserved.
-
- Distributed under MIT license.
- See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
-*/
-
-/* Collection of static dictionary words. */
-
-#ifndef BROTLI_DEC_DICTIONARY_H_
-#define BROTLI_DEC_DICTIONARY_H_
-
-#include "./types.h"
-
-#if defined(__cplusplus) || defined(c_plusplus)
-extern "C" {
-#endif
-
-extern const uint8_t kBrotliDictionary[122784];
-
-static const uint32_t kBrotliDictionaryOffsetsByLength[] = {
- 0, 0, 0, 0, 0, 4096, 9216, 21504, 35840, 44032, 53248, 63488, 74752, 87040,
- 93696, 100864, 104704, 106752, 108928, 113536, 115968, 118528, 119872, 121280,
- 122016
-};
-
-static const uint8_t kBrotliDictionarySizeBitsByLength[] = {
- 0, 0, 0, 0, 10, 10, 11, 11, 10, 10, 10, 10, 10,
- 9, 9, 8, 7, 7, 8, 7, 7, 6, 6, 5, 5,
-};
-
-static const int kBrotliMinDictionaryWordLength = 4;
-static const int kBrotliMaxDictionaryWordLength = 24;
-
-#if defined(__cplusplus) || defined(c_plusplus)
-} /* extern "C" */
-#endif
-
-#endif /* BROTLI_DEC_DICTIONARY_H_ */
diff --git a/Source/ThirdParty/brotli/dec/huffman.c b/Source/ThirdParty/brotli/dec/huffman.c
index 3775ffe7e..37da2a563 100644
--- a/Source/ThirdParty/brotli/dec/huffman.c
+++ b/Source/ThirdParty/brotli/dec/huffman.c
@@ -10,8 +10,9 @@
#include <string.h> /* memcpy, memset */
+#include "../common/constants.h"
+#include <brotli/types.h>
#include "./port.h"
-#include "./types.h"
#if defined(__cplusplus) || defined(c_plusplus)
extern "C" {
@@ -20,7 +21,8 @@ extern "C" {
#define BROTLI_REVERSE_BITS_MAX 8
#ifdef BROTLI_RBIT
-#define BROTLI_REVERSE_BITS_BASE (32 - BROTLI_REVERSE_BITS_MAX)
+#define BROTLI_REVERSE_BITS_BASE \
+ ((sizeof(reg_t) << 3) - BROTLI_REVERSE_BITS_MAX)
#else
#define BROTLI_REVERSE_BITS_BASE 0
static uint8_t kReverseBits[1 << BROTLI_REVERSE_BITS_MAX] = {
@@ -60,12 +62,12 @@ static uint8_t kReverseBits[1 << BROTLI_REVERSE_BITS_MAX] = {
#endif /* BROTLI_RBIT */
#define BROTLI_REVERSE_BITS_LOWEST \
- (1U << (BROTLI_REVERSE_BITS_MAX - 1 + BROTLI_REVERSE_BITS_BASE))
+ ((reg_t)1 << (BROTLI_REVERSE_BITS_MAX - 1 + BROTLI_REVERSE_BITS_BASE))
/* Returns reverse(num >> BROTLI_REVERSE_BITS_BASE, BROTLI_REVERSE_BITS_MAX),
where reverse(value, len) is the bit-wise reversal of the len least
significant bits of value. */
-static BROTLI_INLINE uint32_t BrotliReverseBits(uint32_t num) {
+static BROTLI_INLINE reg_t BrotliReverseBits(reg_t num) {
#ifdef BROTLI_RBIT
return BROTLI_RBIT(num);
#else
@@ -102,13 +104,13 @@ static BROTLI_INLINE int NextTableBitSize(const uint16_t* const count,
void BrotliBuildCodeLengthsHuffmanTable(HuffmanCode* table,
const uint8_t* const code_lengths,
uint16_t* count) {
- HuffmanCode code; /* current table entry */
- int symbol; /* symbol index in original or sorted table */
- uint32_t key; /* prefix code */
- uint32_t key_step; /* prefix code addend */
- int step; /* step size to replicate values in current table */
- int table_size; /* size of current table */
- int sorted[18]; /* symbols sorted by code length */
+ HuffmanCode code; /* current table entry */
+ int symbol; /* symbol index in original or sorted table */
+ reg_t key; /* prefix code */
+ reg_t key_step; /* prefix code addend */
+ int step; /* step size to replicate values in current table */
+ int table_size; /* size of current table */
+ int sorted[BROTLI_CODE_LENGTH_CODES]; /* symbols sorted by code length */
/* offsets in sorted table for each length */
int offset[BROTLI_HUFFMAN_MAX_CODE_LENGTH_CODE_LENGTH + 1];
int bits;
@@ -125,10 +127,10 @@ void BrotliBuildCodeLengthsHuffmanTable(HuffmanCode* table,
bits++;
});
/* Symbols with code length 0 are placed after all other symbols. */
- offset[0] = 17;
+ offset[0] = BROTLI_CODE_LENGTH_CODES - 1;
/* sort symbols by length, by symbol order within each length */
- symbol = 18;
+ symbol = BROTLI_CODE_LENGTH_CODES;
do {
BROTLI_REPEAT(6, {
symbol--;
@@ -142,7 +144,7 @@ void BrotliBuildCodeLengthsHuffmanTable(HuffmanCode* table,
if (offset[0] == 0) {
code.bits = 0;
code.value = (uint16_t)sorted[0];
- for (key = 0; key < (uint32_t)table_size; ++key) {
+ for (key = 0; key < (reg_t)table_size; ++key) {
table[key] = code;
}
return;
@@ -170,18 +172,18 @@ uint32_t BrotliBuildHuffmanTable(HuffmanCode* root_table,
int root_bits,
const uint16_t* const symbol_lists,
uint16_t* count) {
- HuffmanCode code; /* current table entry */
- HuffmanCode* table; /* next available space in table */
- int len; /* current code length */
- int symbol; /* symbol index in original or sorted table */
- uint32_t key; /* prefix code */
- uint32_t key_step; /* prefix code addend */
- uint32_t sub_key; /* 2nd level table prefix code */
- uint32_t sub_key_step; /* 2nd level table prefix code addend */
- int step; /* step size to replicate values in current table */
- int table_bits; /* key length of current table */
- int table_size; /* size of current table */
- int total_size; /* sum of root table size and 2nd level table sizes */
+ HuffmanCode code; /* current table entry */
+ HuffmanCode* table; /* next available space in table */
+ int len; /* current code length */
+ int symbol; /* symbol index in original or sorted table */
+ reg_t key; /* prefix code */
+ reg_t key_step; /* prefix code addend */
+ reg_t sub_key; /* 2nd level table prefix code */
+ reg_t sub_key_step; /* 2nd level table prefix code addend */
+ int step; /* step size to replicate values in current table */
+ int table_bits; /* key length of current table */
+ int table_size; /* size of current table */
+ int total_size; /* sum of root table size and 2nd level table sizes */
int max_length = -1;
int bits;
int bits_count;
diff --git a/Source/ThirdParty/brotli/dec/huffman.h b/Source/ThirdParty/brotli/dec/huffman.h
index fc880810c..d3b4d53e6 100644
--- a/Source/ThirdParty/brotli/dec/huffman.h
+++ b/Source/ThirdParty/brotli/dec/huffman.h
@@ -9,7 +9,7 @@
#ifndef BROTLI_DEC_HUFFMAN_H_
#define BROTLI_DEC_HUFFMAN_H_
-#include "./types.h"
+#include <brotli/types.h>
#include "./port.h"
#if defined(__cplusplus) || defined(c_plusplus)
@@ -18,16 +18,16 @@ extern "C" {
#define BROTLI_HUFFMAN_MAX_CODE_LENGTH 15
-/* For current format this constant equals to kNumInsertAndCopyCodes */
-#define BROTLI_HUFFMAN_MAX_CODE_LENGTHS_SIZE 704
-
/* Maximum possible Huffman table size for an alphabet size of (index * 32),
* max code length 15 and root table bits 8. */
static const uint16_t kMaxHuffmanTableSize[] = {
256, 402, 436, 468, 500, 534, 566, 598, 630, 662, 694, 726, 758, 790, 822,
854, 886, 920, 952, 984, 1016, 1048, 1080};
+/* BROTLI_NUM_BLOCK_LEN_SYMBOLS == 26 */
#define BROTLI_HUFFMAN_MAX_SIZE_26 396
+/* BROTLI_MAX_BLOCK_TYPE_SYMBOLS == 258 */
#define BROTLI_HUFFMAN_MAX_SIZE_258 632
+/* BROTLI_MAX_CONTEXT_MAP_SYMBOLS == 272 */
#define BROTLI_HUFFMAN_MAX_SIZE_272 646
#define BROTLI_HUFFMAN_MAX_CODE_LENGTH_CODE_LENGTH 5
diff --git a/Source/ThirdParty/brotli/dec/port.h b/Source/ThirdParty/brotli/dec/port.h
index 19b457c75..6b3d7352b 100644
--- a/Source/ThirdParty/brotli/dec/port.h
+++ b/Source/ThirdParty/brotli/dec/port.h
@@ -16,6 +16,7 @@
features and attributes
* BROTLI_BUILD_PORTABLE disables dangerous optimizations, like unaligned
read and overlapping memcpy; this reduces decompression speed by 5%
+ * BROTLI_BUILD_NO_RBIT disables "rbit" optimization for ARM CPUs
* BROTLI_DEBUG dumps file name and line number when decoder detects stream
or memory error
* BROTLI_ENABLE_LOG enables asserts and dumps various state information
@@ -29,27 +30,16 @@
#include <stdio.h>
#endif
-/* Compatibility with non-clang compilers. */
-#ifndef __has_builtin
-#define __has_builtin(x) 0
-#endif
-
-#ifndef __has_attribute
-#define __has_attribute(x) 0
-#endif
-
-#ifndef __has_feature
-#define __has_feature(x) 0
-#endif
+#include <brotli/port.h>
#if defined(__arm__) || defined(__thumb__) || \
- defined(_M_ARM) || defined(_M_ARMT)
+ defined(_M_ARM) || defined(_M_ARMT) || defined(__ARM64_ARCH_8__)
#define BROTLI_TARGET_ARM
-#if (defined(__ARM_ARCH) && (__ARM_ARCH >= 7)) || \
- (defined(M_ARM) && (M_ARM >= 7))
+#if (defined(__ARM_ARCH) && (__ARM_ARCH == 7)) || \
+ (defined(M_ARM) && (M_ARM == 7))
#define BROTLI_TARGET_ARMV7
#endif /* ARMv7 */
-#if defined(__aarch64__)
+#if defined(__aarch64__) || defined(__ARM64_ARCH_8__)
#define BROTLI_TARGET_ARMV8
#endif /* ARMv8 */
#endif /* ARM */
@@ -66,61 +56,16 @@
#define BROTLI_TARGET_POWERPC64
#endif
-#if defined(__GNUC__) && defined(__GNUC_MINOR__)
-#define BROTLI_GCC_VERSION (__GNUC__ * 100 + __GNUC_MINOR__)
-#else
-#define BROTLI_GCC_VERSION 0
-#endif
-
-#if defined(__ICC)
-#define BROTLI_ICC_VERSION __ICC
-#else
-#define BROTLI_ICC_VERSION 0
-#endif
-
-#if defined(BROTLI_BUILD_MODERN_COMPILER)
-#define BROTLI_MODERN_COMPILER 1
-#elif (BROTLI_GCC_VERSION > 300) || (BROTLI_ICC_VERSION >= 1600)
-#define BROTLI_MODERN_COMPILER 1
-#else
-#define BROTLI_MODERN_COMPILER 0
-#endif
-
#ifdef BROTLI_BUILD_PORTABLE
#define BROTLI_ALIGNED_READ (!!1)
#elif defined(BROTLI_TARGET_X86) || defined(BROTLI_TARGET_X64) || \
defined(BROTLI_TARGET_ARMV7) || defined(BROTLI_TARGET_ARMV8)
-/* Allow unaligned read only for whitelisted CPUs. */
+/* Allow unaligned read only for white-listed CPUs. */
#define BROTLI_ALIGNED_READ (!!0)
#else
#define BROTLI_ALIGNED_READ (!!1)
#endif
-/* Define "PREDICT_TRUE" and "PREDICT_FALSE" macros for capable compilers.
-
-To apply compiler hint, enclose the branching condition into macros, like this:
-
- if (PREDICT_TRUE(zero == 0)) {
- // main execution path
- } else {
- // compiler should place this code outside of main execution path
- }
-
-OR:
-
- if (PREDICT_FALSE(something_rare_or_unexpected_happens)) {
- // compiler should place this code outside of main execution path
- }
-
-*/
-#if BROTLI_MODERN_COMPILER || __has_builtin(__builtin_expect)
-#define PREDICT_TRUE(x) (__builtin_expect(!!(x), 1))
-#define PREDICT_FALSE(x) (__builtin_expect(x, 0))
-#else
-#define PREDICT_FALSE(x) (x)
-#define PREDICT_TRUE(x) (x)
-#endif
-
/* IS_CONSTANT macros returns true for compile-time constant expressions. */
#if BROTLI_MODERN_COMPILER || __has_builtin(__builtin_constant_p)
#define IS_CONSTANT(x) (!!__builtin_constant_p(x))
@@ -128,35 +73,6 @@ OR:
#define IS_CONSTANT(x) (!!0)
#endif
-#if BROTLI_MODERN_COMPILER || __has_attribute(always_inline)
-#define ATTRIBUTE_ALWAYS_INLINE __attribute__ ((always_inline))
-#else
-#define ATTRIBUTE_ALWAYS_INLINE
-#endif
-
-#if defined(_WIN32) || defined(__CYGWIN__)
-#define ATTRIBUTE_VISIBILITY_HIDDEN
-#elif BROTLI_MODERN_COMPILER || __has_attribute(visibility)
-#define ATTRIBUTE_VISIBILITY_HIDDEN __attribute__ ((visibility ("hidden")))
-#else
-#define ATTRIBUTE_VISIBILITY_HIDDEN
-#endif
-
-#ifndef BROTLI_INTERNAL
-#define BROTLI_INTERNAL ATTRIBUTE_VISIBILITY_HIDDEN
-#endif
-
-#ifndef _MSC_VER
-#if defined(__cplusplus) || !defined(__STRICT_ANSI__) || \
- __STDC_VERSION__ >= 199901L
-#define BROTLI_INLINE inline ATTRIBUTE_ALWAYS_INLINE
-#else
-#define BROTLI_INLINE
-#endif
-#else /* _MSC_VER */
-#define BROTLI_INLINE __forceinline
-#endif /* _MSC_VER */
-
#ifdef BROTLI_ENABLE_LOG
#define BROTLI_DCHECK(x) assert(x)
#define BROTLI_LOG(x) printf x
@@ -166,7 +82,7 @@ OR:
#endif
#if defined(BROTLI_DEBUG) || defined(BROTLI_ENABLE_LOG)
-static inline void BrotliDump(const char* f, int l, const char* fn) {
+static BROTLI_INLINE void BrotliDump(const char* f, int l, const char* fn) {
fprintf(stderr, "%s:%d (%s)\n", f, l, fn);
fflush(stderr);
}
@@ -186,6 +102,12 @@ static inline void BrotliDump(const char* f, int l, const char* fn) {
#define BROTLI_64_BITS 0
#endif
+#if (BROTLI_64_BITS)
+#define reg_t uint64_t
+#else
+#define reg_t uint32_t
+#endif
+
#if defined(BROTLI_BUILD_BIG_ENDIAN)
#define BROTLI_LITTLE_ENDIAN 0
#define BROTLI_BIG_ENDIAN 1
@@ -211,22 +133,18 @@ static inline void BrotliDump(const char* f, int l, const char* fn) {
#define BROTLI_LITTLE_ENDIAN 0
#endif
-#if BROTLI_MODERN_COMPILER || __has_attribute(noinline)
-#define BROTLI_NOINLINE __attribute__((noinline))
-#else
-#define BROTLI_NOINLINE
-#endif
-
#define BROTLI_REPEAT(N, X) { \
if ((N & 1) != 0) {X;} \
if ((N & 2) != 0) {X; X;} \
if ((N & 4) != 0) {X; X; X; X;} \
}
-#if BROTLI_MODERN_COMPILER || defined(__llvm__)
-#if defined(BROTLI_TARGET_ARMV7)
-static BROTLI_INLINE unsigned BrotliRBit(unsigned input) {
- unsigned output;
+#if (BROTLI_MODERN_COMPILER || defined(__llvm__)) && \
+ !defined(BROTLI_BUILD_NO_RBIT)
+#if defined(BROTLI_TARGET_ARMV7) || defined(BROTLI_TARGET_ARMV8)
+/* TODO: detect ARMv6T2 and enable this code for it. */
+static BROTLI_INLINE reg_t BrotliRBit(reg_t input) {
+ reg_t output;
__asm__("rbit %0, %1\n" : "=r"(output) : "r"(input));
return output;
}
@@ -247,6 +165,4 @@ static BROTLI_INLINE unsigned BrotliRBit(unsigned input) {
X = NULL; \
}
-#define BROTLI_UNUSED(X) (void)(X)
-
#endif /* BROTLI_DEC_PORT_H_ */
diff --git a/Source/ThirdParty/brotli/dec/prefix.h b/Source/ThirdParty/brotli/dec/prefix.h
index eaae37f02..aa776c723 100644
--- a/Source/ThirdParty/brotli/dec/prefix.h
+++ b/Source/ThirdParty/brotli/dec/prefix.h
@@ -11,7 +11,8 @@
#ifndef BROTLI_DEC_PREFIX_H_
#define BROTLI_DEC_PREFIX_H_
-#include "./types.h"
+#include "../common/constants.h"
+#include <brotli/types.h>
/* Represents the range of values belonging to a prefix code: */
/* [offset, offset + 2^nbits) */
@@ -20,7 +21,8 @@ struct PrefixCodeRange {
uint8_t nbits;
};
-static const struct PrefixCodeRange kBlockLengthPrefixCode[] = {
+static const struct PrefixCodeRange
+ kBlockLengthPrefixCode[BROTLI_NUM_BLOCK_LEN_SYMBOLS] = {
{ 1, 2}, { 5, 2}, { 9, 2}, { 13, 2},
{ 17, 3}, { 25, 3}, { 33, 3}, { 41, 3},
{ 49, 4}, { 65, 4}, { 81, 4}, { 97, 4},
@@ -39,7 +41,7 @@ typedef struct CmdLutElement {
uint16_t copy_len_offset;
} CmdLutElement;
-static const CmdLutElement kCmdLut[704] = {
+static const CmdLutElement kCmdLut[BROTLI_NUM_COMMAND_SYMBOLS] = {
{ 0x00, 0x00, 0, 0x00, 0x0000, 0x0002 },
{ 0x00, 0x00, 0, 0x01, 0x0000, 0x0003 },
{ 0x00, 0x00, 0, 0x02, 0x0000, 0x0004 },
diff --git a/Source/ThirdParty/brotli/dec/state.c b/Source/ThirdParty/brotli/dec/state.c
index 358e08d3d..554313d8f 100644
--- a/Source/ThirdParty/brotli/dec/state.c
+++ b/Source/ThirdParty/brotli/dec/state.c
@@ -8,17 +8,13 @@
#include <stdlib.h> /* free, malloc */
+#include <brotli/types.h>
#include "./huffman.h"
-#include "./types.h"
#if defined(__cplusplus) || defined(c_plusplus)
extern "C" {
#endif
-/* Declared in decode.h */
-int BrotliStateIsStreamStart(const BrotliState* s);
-int BrotliStateIsStreamEnd(const BrotliState* s);
-
static void* DefaultAllocFunc(void* opaque, size_t size) {
BROTLI_UNUSED(opaque);
return malloc(size);
@@ -29,11 +25,11 @@ static void DefaultFreeFunc(void* opaque, void* address) {
free(address);
}
-void BrotliStateInit(BrotliState* s) {
- BrotliStateInitWithCustomAllocators(s, 0, 0, 0);
+void BrotliDecoderStateInit(BrotliDecoderState* s) {
+ BrotliDecoderStateInitWithCustomAllocators(s, 0, 0, 0);
}
-void BrotliStateInitWithCustomAllocators(BrotliState* s,
+void BrotliDecoderStateInitWithCustomAllocators(BrotliDecoderState* s,
brotli_alloc_func alloc_func, brotli_free_func free_func, void* opaque) {
if (!alloc_func) {
s->alloc_func = DefaultAllocFunc;
@@ -45,6 +41,8 @@ void BrotliStateInitWithCustomAllocators(BrotliState* s,
s->memory_manager_opaque = opaque;
}
+ s->error_code = 0; /* BROTLI_DECODER_NO_ERROR */
+
BrotliInitBitReader(&s->br);
s->state = BROTLI_STATE_UNINITED;
s->substate_metablock_header = BROTLI_STATE_METABLOCK_HEADER_NONE;
@@ -55,6 +53,8 @@ void BrotliStateInitWithCustomAllocators(BrotliState* s,
s->substate_decode_uint8 = BROTLI_STATE_DECODE_UINT8_NONE;
s->substate_read_block_length = BROTLI_STATE_READ_BLOCK_LENGTH_NONE;
+ s->dictionary = BrotliGetDictionary();
+
s->buffer_length = 0;
s->loop_counter = 0;
s->pos = 0;
@@ -64,6 +64,9 @@ void BrotliStateInitWithCustomAllocators(BrotliState* s,
s->block_type_trees = NULL;
s->block_len_trees = NULL;
s->ringbuffer = NULL;
+ s->ringbuffer_size = 0;
+ s->new_ringbuffer_size = 0;
+ s->ringbuffer_mask = 0;
s->context_map = NULL;
s->context_modes = NULL;
@@ -80,10 +83,12 @@ void BrotliStateInitWithCustomAllocators(BrotliState* s,
s->distance_hgroup.codes = NULL;
s->distance_hgroup.htrees = NULL;
- s->custom_dict = NULL;
- s->custom_dict_size = 0;
-
s->is_last_metablock = 0;
+ s->is_uncompressed = 0;
+ s->is_metadata = 0;
+ s->should_wrap_ringbuffer = 0;
+ s->canny_ringbuffer_allocation = 1;
+
s->window_bits = 0;
s->max_distance = 0;
s->dist_rb[0] = 16;
@@ -97,10 +102,10 @@ void BrotliStateInitWithCustomAllocators(BrotliState* s,
/* Make small negative indexes addressable. */
s->symbol_lists = &s->symbols_lists_array[BROTLI_HUFFMAN_MAX_CODE_LENGTH + 1];
- s->mtf_upper_bound = 255;
+ s->mtf_upper_bound = 63;
}
-void BrotliStateMetablockBegin(BrotliState* s) {
+void BrotliDecoderStateMetablockBegin(BrotliDecoderState* s) {
s->meta_block_remaining_len = 0;
s->block_length[0] = 1U << 28;
s->block_length[1] = 1U << 28;
@@ -131,48 +136,35 @@ void BrotliStateMetablockBegin(BrotliState* s) {
s->distance_hgroup.htrees = NULL;
}
-void BrotliStateCleanupAfterMetablock(BrotliState* s) {
+void BrotliDecoderStateCleanupAfterMetablock(BrotliDecoderState* s) {
BROTLI_FREE(s, s->context_modes);
BROTLI_FREE(s, s->context_map);
BROTLI_FREE(s, s->dist_context_map);
-
- BrotliHuffmanTreeGroupRelease(s, &s->literal_hgroup);
- BrotliHuffmanTreeGroupRelease(s, &s->insert_copy_hgroup);
- BrotliHuffmanTreeGroupRelease(s, &s->distance_hgroup);
+ BROTLI_FREE(s, s->literal_hgroup.htrees);
+ BROTLI_FREE(s, s->insert_copy_hgroup.htrees);
+ BROTLI_FREE(s, s->distance_hgroup.htrees);
}
-void BrotliStateCleanup(BrotliState* s) {
- BrotliStateCleanupAfterMetablock(s);
+void BrotliDecoderStateCleanup(BrotliDecoderState* s) {
+ BrotliDecoderStateCleanupAfterMetablock(s);
BROTLI_FREE(s, s->ringbuffer);
BROTLI_FREE(s, s->block_type_trees);
}
-int BrotliStateIsStreamStart(const BrotliState* s) {
- return (s->state == BROTLI_STATE_UNINITED &&
- BrotliGetAvailableBits(&s->br) == 0);
-}
-
-int BrotliStateIsStreamEnd(const BrotliState* s) {
- return s->state == BROTLI_STATE_DONE;
-}
-
-void BrotliHuffmanTreeGroupInit(BrotliState* s, HuffmanTreeGroup* group,
- uint32_t alphabet_size, uint32_t ntrees) {
+BROTLI_BOOL BrotliDecoderHuffmanTreeGroupInit(BrotliDecoderState* s,
+ HuffmanTreeGroup* group, uint32_t alphabet_size, uint32_t ntrees) {
/* Pack two allocations into one */
const size_t max_table_size = kMaxHuffmanTableSize[(alphabet_size + 31) >> 5];
const size_t code_size = sizeof(HuffmanCode) * ntrees * max_table_size;
const size_t htree_size = sizeof(HuffmanCode*) * ntrees;
- char* p = (char*)BROTLI_ALLOC(s, code_size + htree_size);
+ /* Pointer alignment is, hopefully, wider than sizeof(HuffmanCode). */
+ HuffmanCode** p = (HuffmanCode**)BROTLI_ALLOC(s, code_size + htree_size);
group->alphabet_size = (uint16_t)alphabet_size;
group->num_htrees = (uint16_t)ntrees;
- group->codes = (HuffmanCode*)p;
- group->htrees = (HuffmanCode**)(p + code_size);
-}
-
-void BrotliHuffmanTreeGroupRelease(BrotliState* s, HuffmanTreeGroup* group) {
- BROTLI_FREE(s, group->codes);
- group->htrees = NULL;
+ group->htrees = p;
+ group->codes = (HuffmanCode*)(&p[ntrees]);
+ return !!p;
}
#if defined(__cplusplus) || defined(c_plusplus)
diff --git a/Source/ThirdParty/brotli/dec/state.h b/Source/ThirdParty/brotli/dec/state.h
index 63647ef2b..1d2773b7f 100644
--- a/Source/ThirdParty/brotli/dec/state.h
+++ b/Source/ThirdParty/brotli/dec/state.h
@@ -9,9 +9,11 @@
#ifndef BROTLI_DEC_STATE_H_
#define BROTLI_DEC_STATE_H_
+#include "../common/constants.h"
+#include "../common/dictionary.h"
+#include <brotli/types.h>
#include "./bit_reader.h"
#include "./huffman.h"
-#include "./types.h"
#include "./port.h"
#if defined(__cplusplus) || defined(c_plusplus)
@@ -93,7 +95,7 @@ typedef enum {
BROTLI_STATE_READ_BLOCK_LENGTH_SUFFIX
} BrotliRunningReadBlockLengthState;
-struct BrotliStateStruct {
+struct BrotliDecoderStateStruct {
BrotliRunningState state;
/* This counter is reused for several disjoint loops. */
@@ -114,7 +116,6 @@ struct BrotliStateStruct {
int pos;
int max_backward_distance;
- int max_backward_distance_minus_custom_dict_size;
int max_distance;
int ringbuffer_size;
int ringbuffer_mask;
@@ -140,6 +141,8 @@ struct BrotliStateStruct {
/* This is true if the literal context map histogram type always matches the
block type. It is then not needed to keep the context (faster decoding). */
int trivial_literal_context;
+ /* Distance context is actual after command is decoded and before distance
+ is computed. After distance computation it is used as a temporary variable. */
int distance_context;
int meta_block_remaining_len;
uint32_t block_length_index;
@@ -160,8 +163,8 @@ struct BrotliStateStruct {
int distance_code;
/* For partial write operations */
- size_t rb_roundtrips; /* How many times we went around the ringbuffer */
- size_t partial_pos_out; /* How much output to the user in total (<= rb) */
+ size_t rb_roundtrips; /* How many times we went around the ring-buffer */
+ size_t partial_pos_out; /* How much output to the user in total */
/* For ReadHuffmanCode */
uint32_t symbol;
@@ -169,14 +172,14 @@ struct BrotliStateStruct {
uint32_t space;
HuffmanCode table[32];
- /* List of of symbol chains. */
+ /* List of heads of symbol chains. */
uint16_t* symbol_lists;
/* Storage from symbol_lists. */
uint16_t symbols_lists_array[BROTLI_HUFFMAN_MAX_CODE_LENGTH + 1 +
- BROTLI_HUFFMAN_MAX_CODE_LENGTHS_SIZE];
+ BROTLI_NUM_COMMAND_SYMBOLS];
/* Tails of symbol chains. */
int next_symbol[32];
- uint8_t code_length_code_lengths[18];
+ uint8_t code_length_code_lengths[BROTLI_CODE_LENGTH_CODES];
/* Population counts for the code lengths */
uint16_t code_length_histo[16];
@@ -192,11 +195,7 @@ struct BrotliStateStruct {
/* For InverseMoveToFrontTransform */
uint32_t mtf_upper_bound;
- uint8_t mtf[256 + 4];
-
- /* For custom dictionaries */
- const uint8_t* custom_dict;
- int custom_dict_size;
+ uint32_t mtf[64 + 1];
/* less used attributes are in the end of this struct */
/* States inside function calls */
@@ -208,32 +207,38 @@ struct BrotliStateStruct {
BrotliRunningDecodeUint8State substate_decode_uint8;
BrotliRunningReadBlockLengthState substate_read_block_length;
- uint8_t is_last_metablock;
- uint8_t is_uncompressed;
- uint8_t is_metadata;
- uint8_t size_nibbles;
+ unsigned int is_last_metablock : 1;
+ unsigned int is_uncompressed : 1;
+ unsigned int is_metadata : 1;
+ unsigned int should_wrap_ringbuffer : 1;
+ unsigned int canny_ringbuffer_allocation : 1;
+ unsigned int size_nibbles : 8;
uint32_t window_bits;
+ int new_ringbuffer_size;
+
uint32_t num_literal_htrees;
uint8_t* context_map;
uint8_t* context_modes;
+ const BrotliDictionary* dictionary;
uint32_t trivial_literal_contexts[8]; /* 256 bits */
};
-typedef struct BrotliStateStruct BrotliStateInternal;
-#define BrotliState BrotliStateInternal
-
-BROTLI_INTERNAL void BrotliStateInit(BrotliState* s);
-BROTLI_INTERNAL void BrotliStateInitWithCustomAllocators(BrotliState* s,
- brotli_alloc_func alloc_func, brotli_free_func free_func, void* opaque);
-BROTLI_INTERNAL void BrotliStateCleanup(BrotliState* s);
-BROTLI_INTERNAL void BrotliStateMetablockBegin(BrotliState* s);
-BROTLI_INTERNAL void BrotliStateCleanupAfterMetablock(BrotliState* s);
-BROTLI_INTERNAL void BrotliHuffmanTreeGroupInit(BrotliState* s,
- HuffmanTreeGroup* group, uint32_t alphabet_size, uint32_t ntrees);
-BROTLI_INTERNAL void BrotliHuffmanTreeGroupRelease(BrotliState* s,
- HuffmanTreeGroup* group);
+typedef struct BrotliDecoderStateStruct BrotliDecoderStateInternal;
+#define BrotliDecoderState BrotliDecoderStateInternal
+
+BROTLI_INTERNAL void BrotliDecoderStateInit(BrotliDecoderState* s);
+BROTLI_INTERNAL void BrotliDecoderStateInitWithCustomAllocators(
+ BrotliDecoderState* s, brotli_alloc_func alloc_func,
+ brotli_free_func free_func, void* opaque);
+BROTLI_INTERNAL void BrotliDecoderStateCleanup(BrotliDecoderState* s);
+BROTLI_INTERNAL void BrotliDecoderStateMetablockBegin(BrotliDecoderState* s);
+BROTLI_INTERNAL void BrotliDecoderStateCleanupAfterMetablock(
+ BrotliDecoderState* s);
+BROTLI_INTERNAL BROTLI_BOOL BrotliDecoderHuffmanTreeGroupInit(
+ BrotliDecoderState* s, HuffmanTreeGroup* group, uint32_t alphabet_size,
+ uint32_t ntrees);
#if defined(__cplusplus) || defined(c_plusplus)
} /* extern "C" */
diff --git a/Source/ThirdParty/brotli/dec/transform.h b/Source/ThirdParty/brotli/dec/transform.h
index 8c08f3fc0..fde3cdfdf 100644
--- a/Source/ThirdParty/brotli/dec/transform.h
+++ b/Source/ThirdParty/brotli/dec/transform.h
@@ -9,8 +9,8 @@
#ifndef BROTLI_DEC_TRANSFORM_H_
#define BROTLI_DEC_TRANSFORM_H_
+#include <brotli/types.h>
#include "./port.h"
-#include "./types.h"
#if defined(__cplusplus) || defined(c_plusplus)
extern "C" {
@@ -247,7 +247,7 @@ static int ToUpperCase(uint8_t* p) {
}
return 1;
}
- /* An overly simplified uppercasing model for utf-8. */
+ /* An overly simplified uppercasing model for UTF-8. */
if (p[0] < 0xe0) {
p[1] ^= 32;
return 2;
diff --git a/Source/ThirdParty/brotli/dec/types.h b/Source/ThirdParty/brotli/dec/types.h
deleted file mode 100644
index 0f7a0216a..000000000
--- a/Source/ThirdParty/brotli/dec/types.h
+++ /dev/null
@@ -1,38 +0,0 @@
-/* Copyright 2013 Google Inc. All Rights Reserved.
-
- Distributed under MIT license.
- See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
-*/
-
-/* Common types */
-
-#ifndef BROTLI_DEC_TYPES_H_
-#define BROTLI_DEC_TYPES_H_
-
-#include <stddef.h> /* for size_t */
-
-#if defined(_MSC_VER) && (_MSC_VER < 1600)
-typedef __int8 int8_t;
-typedef unsigned __int8 uint8_t;
-typedef __int16 int16_t;
-typedef unsigned __int16 uint16_t;
-typedef __int32 int32_t;
-typedef unsigned __int32 uint32_t;
-typedef unsigned __int64 uint64_t;
-typedef __int64 int64_t;
-#else
-#include <stdint.h>
-#endif /* defined(_MSC_VER) && (_MSC_VER < 1600) */
-
-/* Allocating function pointer. Function MUST return 0 in the case of failure.
- Otherwise it MUST return a valid pointer to a memory region of at least
- size length. Neither items nor size are allowed to be 0.
- opaque argument is a pointer provided by client and could be used to bind
- function to specific object (memory pool). */
-typedef void* (*brotli_alloc_func)(void* opaque, size_t size);
-
-/* Deallocating function pointer. Function SHOULD be no-op in the case the
- address is 0. */
-typedef void (*brotli_free_func)(void* opaque, void* address);
-
-#endif /* BROTLI_DEC_TYPES_H_ */
diff --git a/Source/ThirdParty/brotli/include/brotli/decode.h b/Source/ThirdParty/brotli/include/brotli/decode.h
new file mode 100755
index 000000000..d1d21c42d
--- /dev/null
+++ b/Source/ThirdParty/brotli/include/brotli/decode.h
@@ -0,0 +1,339 @@
+/* Copyright 2013 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/**
+ * @file
+ * API for Brotli decompression.
+ */
+
+#ifndef BROTLI_DEC_DECODE_H_
+#define BROTLI_DEC_DECODE_H_
+
+#include <brotli/port.h>
+#include <brotli/types.h>
+
+#if defined(__cplusplus) || defined(c_plusplus)
+extern "C" {
+#endif
+
+/**
+ * Opaque structure that holds decoder state.
+ *
+ * Allocated and initialized with ::BrotliDecoderCreateInstance.
+ * Cleaned up and deallocated with ::BrotliDecoderDestroyInstance.
+ */
+typedef struct BrotliDecoderStateStruct BrotliDecoderState;
+
+/**
+ * Result type for ::BrotliDecoderDecompress and
+ * ::BrotliDecoderDecompressStream functions.
+ */
+typedef enum {
+ /** Decoding error, e.g. corrupted input or memory allocation problem. */
+ BROTLI_DECODER_RESULT_ERROR = 0,
+ /** Decoding successfully completed */
+ BROTLI_DECODER_RESULT_SUCCESS = 1,
+ /** Partially done; should be called again with more input */
+ BROTLI_DECODER_RESULT_NEEDS_MORE_INPUT = 2,
+ /** Partially done; should be called again with more output */
+ BROTLI_DECODER_RESULT_NEEDS_MORE_OUTPUT = 3
+} BrotliDecoderResult;
+
+/**
+ * Template that evaluates items of ::BrotliDecoderErrorCode.
+ *
+ * Example: @code {.cpp}
+ * // Log Brotli error code.
+ * switch (brotliDecoderErrorCode) {
+ * #define CASE_(PREFIX, NAME, CODE) \
+ * case BROTLI_DECODER ## PREFIX ## NAME: \
+ * LOG(INFO) << "error code:" << #NAME; \
+ * break;
+ * #define NEWLINE_
+ * BROTLI_DECODER_ERROR_CODES_LIST(CASE_, NEWLINE_)
+ * #undef CASE_
+ * #undef NEWLINE_
+ * default: LOG(FATAL) << "unknown brotli error code";
+ * }
+ * @endcode
+ */
+#define BROTLI_DECODER_ERROR_CODES_LIST(BROTLI_ERROR_CODE, SEPARATOR) \
+ BROTLI_ERROR_CODE(_, NO_ERROR, 0) SEPARATOR \
+ /* Same as BrotliDecoderResult values */ \
+ BROTLI_ERROR_CODE(_, SUCCESS, 1) SEPARATOR \
+ BROTLI_ERROR_CODE(_, NEEDS_MORE_INPUT, 2) SEPARATOR \
+ BROTLI_ERROR_CODE(_, NEEDS_MORE_OUTPUT, 3) SEPARATOR \
+ \
+ /* Errors caused by invalid input */ \
+ BROTLI_ERROR_CODE(_ERROR_FORMAT_, EXUBERANT_NIBBLE, -1) SEPARATOR \
+ BROTLI_ERROR_CODE(_ERROR_FORMAT_, RESERVED, -2) SEPARATOR \
+ BROTLI_ERROR_CODE(_ERROR_FORMAT_, EXUBERANT_META_NIBBLE, -3) SEPARATOR \
+ BROTLI_ERROR_CODE(_ERROR_FORMAT_, SIMPLE_HUFFMAN_ALPHABET, -4) SEPARATOR \
+ BROTLI_ERROR_CODE(_ERROR_FORMAT_, SIMPLE_HUFFMAN_SAME, -5) SEPARATOR \
+ BROTLI_ERROR_CODE(_ERROR_FORMAT_, CL_SPACE, -6) SEPARATOR \
+ BROTLI_ERROR_CODE(_ERROR_FORMAT_, HUFFMAN_SPACE, -7) SEPARATOR \
+ BROTLI_ERROR_CODE(_ERROR_FORMAT_, CONTEXT_MAP_REPEAT, -8) SEPARATOR \
+ BROTLI_ERROR_CODE(_ERROR_FORMAT_, BLOCK_LENGTH_1, -9) SEPARATOR \
+ BROTLI_ERROR_CODE(_ERROR_FORMAT_, BLOCK_LENGTH_2, -10) SEPARATOR \
+ BROTLI_ERROR_CODE(_ERROR_FORMAT_, TRANSFORM, -11) SEPARATOR \
+ BROTLI_ERROR_CODE(_ERROR_FORMAT_, DICTIONARY, -12) SEPARATOR \
+ BROTLI_ERROR_CODE(_ERROR_FORMAT_, WINDOW_BITS, -13) SEPARATOR \
+ BROTLI_ERROR_CODE(_ERROR_FORMAT_, PADDING_1, -14) SEPARATOR \
+ BROTLI_ERROR_CODE(_ERROR_FORMAT_, PADDING_2, -15) SEPARATOR \
+ \
+ /* -16..-17 codes are reserved */ \
+ \
+ BROTLI_ERROR_CODE(_ERROR_, COMPOUND_DICTIONARY, -18) SEPARATOR \
+ BROTLI_ERROR_CODE(_ERROR_, DICTIONARY_NOT_SET, -19) SEPARATOR \
+ BROTLI_ERROR_CODE(_ERROR_, INVALID_ARGUMENTS, -20) SEPARATOR \
+ \
+ /* Memory allocation problems */ \
+ BROTLI_ERROR_CODE(_ERROR_ALLOC_, CONTEXT_MODES, -21) SEPARATOR \
+ /* Literal, insert and distance trees together */ \
+ BROTLI_ERROR_CODE(_ERROR_ALLOC_, TREE_GROUPS, -22) SEPARATOR \
+ /* -23..-24 codes are reserved for distinct tree groups */ \
+ BROTLI_ERROR_CODE(_ERROR_ALLOC_, CONTEXT_MAP, -25) SEPARATOR \
+ BROTLI_ERROR_CODE(_ERROR_ALLOC_, RING_BUFFER_1, -26) SEPARATOR \
+ BROTLI_ERROR_CODE(_ERROR_ALLOC_, RING_BUFFER_2, -27) SEPARATOR \
+ /* -28..-29 codes are reserved for dynamic ring-buffer allocation */ \
+ BROTLI_ERROR_CODE(_ERROR_ALLOC_, BLOCK_TYPE_TREES, -30) SEPARATOR \
+ \
+ /* "Impossible" states */ \
+ BROTLI_ERROR_CODE(_ERROR_, UNREACHABLE, -31)
+
+/**
+ * Error code for detailed logging / production debugging.
+ *
+ * See ::BrotliDecoderGetErrorCode and ::BROTLI_LAST_ERROR_CODE.
+ */
+typedef enum {
+#define BROTLI_COMMA_ ,
+#define BROTLI_ERROR_CODE_ENUM_ITEM_(PREFIX, NAME, CODE) \
+ BROTLI_DECODER ## PREFIX ## NAME = CODE
+ BROTLI_DECODER_ERROR_CODES_LIST(BROTLI_ERROR_CODE_ENUM_ITEM_, BROTLI_COMMA_)
+} BrotliDecoderErrorCode;
+#undef BROTLI_ERROR_CODE_ENUM_ITEM_
+#undef BROTLI_COMMA_
+
+/**
+ * The value of the last error code, negative integer.
+ *
+ * All other error code values are in the range from ::BROTLI_LAST_ERROR_CODE
+ * to @c -1. There are also 4 other possible non-error codes @c 0 .. @c 3 in
+ * ::BrotliDecoderErrorCode enumeration.
+ */
+#define BROTLI_LAST_ERROR_CODE BROTLI_DECODER_ERROR_UNREACHABLE
+
+/** Options to be used with ::BrotliDecoderSetParameter. */
+typedef enum BrotliDecoderParameter {
+ /**
+ * Disable "canny" ring buffer allocation strategy.
+ *
+ * Ring buffer is allocated according to window size, despite the real size of
+ * the content.
+ */
+ BROTLI_DECODER_PARAM_DISABLE_RING_BUFFER_REALLOCATION = 0
+} BrotliDecoderParameter;
+
+/**
+ * Sets the specified parameter to the given decoder instance.
+ *
+ * @param state decoder instance
+ * @param param parameter to set
+ * @param value new parameter value
+ * @returns ::BROTLI_FALSE if parameter is unrecognized, or value is invalid
+ * @returns ::BROTLI_TRUE if value is accepted
+ */
+BROTLI_DEC_API BROTLI_BOOL BrotliDecoderSetParameter(
+ BrotliDecoderState* state, BrotliDecoderParameter param, uint32_t value);
+
+/**
+ * Creates an instance of ::BrotliDecoderState and initializes it.
+ *
+ * The instance can be used once for decoding and should then be destroyed with
+ * ::BrotliDecoderDestroyInstance, it cannot be reused for a new decoding
+ * session.
+ *
+ * @p alloc_func and @p free_func @b MUST be both zero or both non-zero. In the
+ * case they are both zero, default memory allocators are used. @p opaque is
+ * passed to @p alloc_func and @p free_func when they are called.
+ *
+ * @param alloc_func custom memory allocation function
+ * @param free_func custom memory fee function
+ * @param opaque custom memory manager handle
+ * @returns @c 0 if instance can not be allocated or initialized
+ * @returns pointer to initialized ::BrotliDecoderState otherwise
+ */
+BROTLI_DEC_API BrotliDecoderState* BrotliDecoderCreateInstance(
+ brotli_alloc_func alloc_func, brotli_free_func free_func, void* opaque);
+
+/**
+ * Deinitializes and frees ::BrotliDecoderState instance.
+ *
+ * @param state decoder instance to be cleaned up and deallocated
+ */
+BROTLI_DEC_API void BrotliDecoderDestroyInstance(BrotliDecoderState* state);
+
+/**
+ * Performs one-shot memory-to-memory decompression.
+ *
+ * Decompresses the data in @p encoded_buffer into @p decoded_buffer, and sets
+ * @p *decoded_size to the decompressed length.
+ *
+ * @param encoded_size size of @p encoded_buffer
+ * @param encoded_buffer compressed data buffer with at least @p encoded_size
+ * addressable bytes
+ * @param[in, out] decoded_size @b in: size of @p decoded_buffer; \n
+ * @b out: length of decompressed data written to
+ * @p decoded_buffer
+ * @param decoded_buffer decompressed data destination buffer
+ * @returns ::BROTLI_DECODER_RESULT_ERROR if input is corrupted, memory
+ * allocation failed, or @p decoded_buffer is not large enough;
+ * @returns ::BROTLI_DECODER_RESULT_SUCCESS otherwise
+ */
+BROTLI_DEC_API BrotliDecoderResult BrotliDecoderDecompress(
+ size_t encoded_size,
+ const uint8_t encoded_buffer[BROTLI_ARRAY_PARAM(encoded_size)],
+ size_t* decoded_size,
+ uint8_t decoded_buffer[BROTLI_ARRAY_PARAM(*decoded_size)]);
+
+/**
+ * Decompresses the input stream to the output stream.
+ *
+ * The values @p *available_in and @p *available_out must specify the number of
+ * bytes addressable at @p *next_in and @p *next_out respectively.
+ * When @p *available_out is @c 0, @p next_out is allowed to be @c NULL.
+ *
+ * After each call, @p *available_in will be decremented by the amount of input
+ * bytes consumed, and the @p *next_in pointer will be incremented by that
+ * amount. Similarly, @p *available_out will be decremented by the amount of
+ * output bytes written, and the @p *next_out pointer will be incremented by
+ * that amount.
+ *
+ * @p total_out, if it is not a null-pointer, will be set to the number
+ * of bytes decompressed since the last @p state initialization.
+ *
+ * @note Input is never overconsumed, so @p next_in and @p available_in could be
+ * passed to the next consumer after decoding is complete.
+ *
+ * @param state decoder instance
+ * @param[in, out] available_in @b in: amount of available input; \n
+ * @b out: amount of unused input
+ * @param[in, out] next_in pointer to the next compressed byte
+ * @param[in, out] available_out @b in: length of output buffer; \n
+ * @b out: remaining size of output buffer
+ * @param[in, out] next_out output buffer cursor;
+ * can be @c NULL if @p available_out is @c 0
+ * @param[out] total_out number of bytes decompressed so far; can be @c NULL
+ * @returns ::BROTLI_DECODER_RESULT_ERROR if input is corrupted, memory
+ * allocation failed, arguments were invalid, etc.;
+ * use ::BrotliDecoderGetErrorCode to get detailed error code
+ * @returns ::BROTLI_DECODER_RESULT_NEEDS_MORE_INPUT decoding is blocked until
+ * more input data is provided
+ * @returns ::BROTLI_DECODER_RESULT_NEEDS_MORE_OUTPUT decoding is blocked until
+ * more output space is provided
+ * @returns ::BROTLI_DECODER_RESULT_SUCCESS decoding is finished, no more
+ * input might be consumed and no more output will be produced
+ */
+BROTLI_DEC_API BrotliDecoderResult BrotliDecoderDecompressStream(
+ BrotliDecoderState* state, size_t* available_in, const uint8_t** next_in,
+ size_t* available_out, uint8_t** next_out, size_t* total_out);
+
+/**
+ * Checks if decoder has more output.
+ *
+ * @param state decoder instance
+ * @returns ::BROTLI_TRUE, if decoder has some unconsumed output
+ * @returns ::BROTLI_FALSE otherwise
+ */
+BROTLI_DEC_API BROTLI_BOOL BrotliDecoderHasMoreOutput(
+ const BrotliDecoderState* state);
+
+/**
+ * Acquires pointer to internal output buffer.
+ *
+ * This method is used to make language bindings easier and more efficient:
+ * -# push data to ::BrotliDecoderDecompressStream,
+ * until ::BROTLI_DECODER_RESULT_NEEDS_MORE_OUTPUT is reported
+ * -# use ::BrotliDecoderTakeOutput to peek bytes and copy to language-specific
+ * entity
+ *
+ * Also this could be useful if there is an output stream that is able to
+ * consume all the provided data (e.g. when data is saved to file system).
+ *
+ * @attention After every call to ::BrotliDecoderTakeOutput @p *size bytes of
+ * output are considered consumed for all consecutive calls to the
+ * instance methods; returned pointer becomes invalidated as well.
+ *
+ * @note Decoder output is not guaranteed to be contiguous. This means that
+ * after the size-unrestricted call to ::BrotliDecoderTakeOutput,
+ * immediate next call to ::BrotliDecoderTakeOutput may return more data.
+ *
+ * @param state decoder instance
+ * @param[in, out] size @b in: number of bytes caller is ready to take, @c 0 if
+ * any amount could be handled; \n
+ * @b out: amount of data pointed by returned pointer and
+ * considered consumed; \n
+ * out value is never greater than in value, unless it is @c 0
+ * @returns pointer to output data
+ */
+BROTLI_DEC_API const uint8_t* BrotliDecoderTakeOutput(
+ BrotliDecoderState* state, size_t* size);
+
+/**
+ * Checks if instance has already consumed input.
+ *
+ * Instance that returns ::BROTLI_FALSE is considered "fresh" and could be
+ * reused.
+ *
+ * @param state decoder instance
+ * @returns ::BROTLI_TRUE if decoder has already used some input bytes
+ * @returns ::BROTLI_FALSE otherwise
+ */
+BROTLI_DEC_API BROTLI_BOOL BrotliDecoderIsUsed(const BrotliDecoderState* state);
+
+/**
+ * Checks if decoder instance reached the final state.
+ *
+ * @param state decoder instance
+ * @returns ::BROTLI_TRUE if decoder is in a state where it reached the end of
+ * the input and produced all of the output
+ * @returns ::BROTLI_FALSE otherwise
+ */
+BROTLI_DEC_API BROTLI_BOOL BrotliDecoderIsFinished(
+ const BrotliDecoderState* state);
+
+/**
+ * Acquires a detailed error code.
+ *
+ * Should be used only after ::BrotliDecoderDecompressStream returns
+ * ::BROTLI_DECODER_RESULT_ERROR.
+ *
+ * See also ::BrotliDecoderErrorString
+ *
+ * @param state decoder instance
+ * @returns last saved error code
+ */
+BROTLI_DEC_API BrotliDecoderErrorCode BrotliDecoderGetErrorCode(
+ const BrotliDecoderState* state);
+
+/**
+ * Converts error code to a c-string.
+ */
+BROTLI_DEC_API const char* BrotliDecoderErrorString(BrotliDecoderErrorCode c);
+
+/**
+ * Gets a decoder library version.
+ *
+ * Look at BROTLI_VERSION for more information.
+ */
+BROTLI_DEC_API uint32_t BrotliDecoderVersion(void);
+
+#if defined(__cplusplus) || defined(c_plusplus)
+} /* extern "C" */
+#endif
+
+#endif /* BROTLI_DEC_DECODE_H_ */
diff --git a/Source/ThirdParty/brotli/include/brotli/encode.h b/Source/ThirdParty/brotli/include/brotli/encode.h
new file mode 100755
index 000000000..e4cf18b72
--- /dev/null
+++ b/Source/ThirdParty/brotli/include/brotli/encode.h
@@ -0,0 +1,402 @@
+/* Copyright 2013 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/**
+ * @file
+ * API for Brotli compression.
+ */
+
+#ifndef BROTLI_ENC_ENCODE_H_
+#define BROTLI_ENC_ENCODE_H_
+
+#include <brotli/port.h>
+#include <brotli/types.h>
+
+#if defined(__cplusplus) || defined(c_plusplus)
+extern "C" {
+#endif
+
+/** Minimal value for ::BROTLI_PARAM_LGWIN parameter. */
+#define BROTLI_MIN_WINDOW_BITS 10
+/**
+ * Maximal value for ::BROTLI_PARAM_LGWIN parameter.
+ *
+ * @note equal to @c BROTLI_MAX_DISTANCE_BITS constant.
+ */
+#define BROTLI_MAX_WINDOW_BITS 24
+/** Minimal value for ::BROTLI_PARAM_LGBLOCK parameter. */
+#define BROTLI_MIN_INPUT_BLOCK_BITS 16
+/** Maximal value for ::BROTLI_PARAM_LGBLOCK parameter. */
+#define BROTLI_MAX_INPUT_BLOCK_BITS 24
+/** Minimal value for ::BROTLI_PARAM_QUALITY parameter. */
+#define BROTLI_MIN_QUALITY 0
+/** Maximal value for ::BROTLI_PARAM_QUALITY parameter. */
+#define BROTLI_MAX_QUALITY 11
+
+/** Options for ::BROTLI_PARAM_MODE parameter. */
+typedef enum BrotliEncoderMode {
+ /**
+ * Default compression mode.
+ *
+ * In this mode compressor does not know anything in advance about the
+ * properties of the input.
+ */
+ BROTLI_MODE_GENERIC = 0,
+ /** Compression mode for UTF-8 formatted text input. */
+ BROTLI_MODE_TEXT = 1,
+ /** Compression mode used in WOFF 2.0. */
+ BROTLI_MODE_FONT = 2
+} BrotliEncoderMode;
+
+/** Default value for ::BROTLI_PARAM_QUALITY parameter. */
+#define BROTLI_DEFAULT_QUALITY 11
+/** Default value for ::BROTLI_PARAM_LGWIN parameter. */
+#define BROTLI_DEFAULT_WINDOW 22
+/** Default value for ::BROTLI_PARAM_MODE parameter. */
+#define BROTLI_DEFAULT_MODE BROTLI_MODE_GENERIC
+
+/** Operations that can be performed by streaming encoder. */
+typedef enum BrotliEncoderOperation {
+ /**
+ * Process input.
+ *
+ * Encoder may postpone producing output, until it has processed enough input.
+ */
+ BROTLI_OPERATION_PROCESS = 0,
+ /**
+ * Produce output for all processed input.
+ *
+ * Actual flush is performed when input stream is depleted and there is enough
+ * space in output stream. This means that client should repeat
+ * ::BROTLI_OPERATION_FLUSH operation until @p available_in becomes @c 0, and
+ * ::BrotliEncoderHasMoreOutput returns ::BROTLI_FALSE. If output is acquired
+ * via ::BrotliEncoderTakeOutput, then operation should be repeated after
+ * output buffer is drained.
+ *
+ * @warning Until flush is complete, client @b SHOULD @b NOT swap,
+ * reduce or extend input stream.
+ *
+ * When flush is complete, output data will be sufficient for decoder to
+ * reproduce all the given input.
+ */
+ BROTLI_OPERATION_FLUSH = 1,
+ /**
+ * Finalize the stream.
+ *
+ * Actual finalization is performed when input stream is depleted and there is
+ * enough space in output stream. This means that client should repeat
+ * ::BROTLI_OPERATION_FINISH operation until @p available_in becomes @c 0, and
+ * ::BrotliEncoderHasMoreOutput returns ::BROTLI_FALSE. If output is acquired
+ * via ::BrotliEncoderTakeOutput, then operation should be repeated after
+ * output buffer is drained.
+ *
+ * @warning Until finalization is complete, client @b SHOULD @b NOT swap,
+ * reduce or extend input stream.
+ *
+ * Helper function ::BrotliEncoderIsFinished checks if stream is finalized and
+ * output fully dumped.
+ *
+ * Adding more input data to finalized stream is impossible.
+ */
+ BROTLI_OPERATION_FINISH = 2,
+ /**
+ * Emit metadata block to stream.
+ *
+ * Metadata is opaque to Brotli: neither encoder, nor decoder processes this
+ * data or relies on it. It may be used to pass some extra information from
+ * encoder client to decoder client without interfering with main data stream.
+ *
+ * @note Encoder may emit empty metadata blocks internally, to pad encoded
+ * stream to byte boundary.
+ *
+ * @warning Until emitting metadata is complete client @b SHOULD @b NOT swap,
+ * reduce or extend input stream.
+ *
+ * @warning The whole content of input buffer is considered to be the content
+ * of metadata block. Do @b NOT @e append metadata to input stream,
+ * before it is depleted with other operations.
+ *
+ * Stream is soft-flushed before metadata block is emitted. Metadata block
+ * @b MUST be no longer than than 16MiB.
+ */
+ BROTLI_OPERATION_EMIT_METADATA = 3
+} BrotliEncoderOperation;
+
+/** Options to be used with ::BrotliEncoderSetParameter. */
+typedef enum BrotliEncoderParameter {
+ /**
+ * Tune encoder for specific input.
+ *
+ * ::BrotliEncoderMode enumerates all available values.
+ */
+ BROTLI_PARAM_MODE = 0,
+ /**
+ * The main compression speed-density lever.
+ *
+ * The higher the quality, the slower the compression. Range is
+ * from ::BROTLI_MIN_QUALITY to ::BROTLI_MAX_QUALITY.
+ */
+ BROTLI_PARAM_QUALITY = 1,
+ /**
+ * Recommended sliding LZ77 window size.
+ *
+ * Encoder may reduce this value, e.g. if input is much smaller than
+ * window size.
+ *
+ * Window size is `(1 << value) - 16`.
+ *
+ * Range is from ::BROTLI_MIN_WINDOW_BITS to ::BROTLI_MAX_WINDOW_BITS.
+ */
+ BROTLI_PARAM_LGWIN = 2,
+ /**
+ * Recommended input block size.
+ *
+ * Encoder may reduce this value, e.g. if input is much smaller than input
+ * block size.
+ *
+ * Range is from ::BROTLI_MIN_INPUT_BLOCK_BITS to
+ * ::BROTLI_MAX_INPUT_BLOCK_BITS.
+ *
+ * @note Bigger input block size allows better compression, but consumes more
+ * memory. \n The rough formula of memory used for temporary input
+ * storage is `3 << lgBlock`.
+ */
+ BROTLI_PARAM_LGBLOCK = 3,
+ /**
+ * Flag that affects usage of "literal context modeling" format feature.
+ *
+ * This flag is a "decoding-speed vs compression ratio" trade-off.
+ */
+ BROTLI_PARAM_DISABLE_LITERAL_CONTEXT_MODELING = 4,
+ /**
+ * Estimated total input size for all ::BrotliEncoderCompressStream calls.
+ *
+ * The default value is 0, which means that the total input size is unknown.
+ */
+ BROTLI_PARAM_SIZE_HINT = 5
+} BrotliEncoderParameter;
+
+/**
+ * Opaque structure that holds encoder state.
+ *
+ * Allocated and initialized with ::BrotliEncoderCreateInstance.
+ * Cleaned up and deallocated with ::BrotliEncoderDestroyInstance.
+ */
+typedef struct BrotliEncoderStateStruct BrotliEncoderState;
+
+/**
+ * Sets the specified parameter to the given encoder instance.
+ *
+ * @param state encoder instance
+ * @param param parameter to set
+ * @param value new parameter value
+ * @returns ::BROTLI_FALSE if parameter is unrecognized, or value is invalid
+ * @returns ::BROTLI_FALSE if value of parameter can not be changed at current
+ * encoder state (e.g. when encoding is started, window size might be
+ * already encoded and therefore it is impossible to change it)
+ * @returns ::BROTLI_TRUE if value is accepted
+ * @warning invalid values might be accepted in case they would not break
+ * encoding process.
+ */
+BROTLI_ENC_API BROTLI_BOOL BrotliEncoderSetParameter(
+ BrotliEncoderState* state, BrotliEncoderParameter param, uint32_t value);
+
+/**
+ * Creates an instance of ::BrotliEncoderState and initializes it.
+ *
+ * @p alloc_func and @p free_func @b MUST be both zero or both non-zero. In the
+ * case they are both zero, default memory allocators are used. @p opaque is
+ * passed to @p alloc_func and @p free_func when they are called.
+ *
+ * @param alloc_func custom memory allocation function
+ * @param free_func custom memory fee function
+ * @param opaque custom memory manager handle
+ * @returns @c 0 if instance can not be allocated or initialized
+ * @returns pointer to initialized ::BrotliEncoderState otherwise
+ */
+BROTLI_ENC_API BrotliEncoderState* BrotliEncoderCreateInstance(
+ brotli_alloc_func alloc_func, brotli_free_func free_func, void* opaque);
+
+/**
+ * Deinitializes and frees ::BrotliEncoderState instance.
+ *
+ * @param state decoder instance to be cleaned up and deallocated
+ */
+BROTLI_ENC_API void BrotliEncoderDestroyInstance(BrotliEncoderState* state);
+
+/**
+ * Calculates the output size bound for the given @p input_size.
+ *
+ * @warning Result is not applicable to ::BrotliEncoderCompressStream output,
+ * because every "flush" adds extra overhead bytes, and some encoder
+ * settings (e.g. quality @c 0 and @c 1) might imply a "soft flush"
+ * after every chunk of input.
+ *
+ * @param input_size size of projected input
+ * @returns @c 0 if result does not fit @c size_t
+ */
+BROTLI_ENC_API size_t BrotliEncoderMaxCompressedSize(size_t input_size);
+
+/**
+ * Performs one-shot memory-to-memory compression.
+ *
+ * Compresses the data in @p input_buffer into @p encoded_buffer, and sets
+ * @p *encoded_size to the compressed length.
+ *
+ * @note If ::BrotliEncoderMaxCompressedSize(@p input_size) returns non-zero
+ * value, then output is guaranteed to be no longer than that.
+ *
+ * @param quality quality parameter value, e.g. ::BROTLI_DEFAULT_QUALITY
+ * @param lgwin lgwin parameter value, e.g. ::BROTLI_DEFAULT_WINDOW
+ * @param mode mode parameter value, e.g. ::BROTLI_DEFAULT_MODE
+ * @param input_size size of @p input_buffer
+ * @param input_buffer input data buffer with at least @p input_size
+ * addressable bytes
+ * @param[in, out] encoded_size @b in: size of @p encoded_buffer; \n
+ * @b out: length of compressed data written to
+ * @p encoded_buffer, or @c 0 if compression fails
+ * @param encoded_buffer compressed data destination buffer
+ * @returns ::BROTLI_FALSE in case of compression error
+ * @returns ::BROTLI_FALSE if output buffer is too small
+ * @returns ::BROTLI_TRUE otherwise
+ */
+BROTLI_ENC_API BROTLI_BOOL BrotliEncoderCompress(
+ int quality, int lgwin, BrotliEncoderMode mode, size_t input_size,
+ const uint8_t input_buffer[BROTLI_ARRAY_PARAM(input_size)],
+ size_t* encoded_size,
+ uint8_t encoded_buffer[BROTLI_ARRAY_PARAM(*encoded_size)]);
+
+/**
+ * Compresses input stream to output stream.
+ *
+ * The values @p *available_in and @p *available_out must specify the number of
+ * bytes addressable at @p *next_in and @p *next_out respectively.
+ * When @p *available_out is @c 0, @p next_out is allowed to be @c NULL.
+ *
+ * After each call, @p *available_in will be decremented by the amount of input
+ * bytes consumed, and the @p *next_in pointer will be incremented by that
+ * amount. Similarly, @p *available_out will be decremented by the amount of
+ * output bytes written, and the @p *next_out pointer will be incremented by
+ * that amount.
+ *
+ * @p total_out, if it is not a null-pointer, will be set to the number
+ * of bytes decompressed since the last @p state initialization.
+ *
+ *
+ *
+ * Internally workflow consists of 3 tasks:
+ * -# (optionally) copy input data to internal buffer
+ * -# actually compress data and (optionally) store it to internal buffer
+ * -# (optionally) copy compressed bytes from internal buffer to output stream
+ *
+ * Whenever all 3 tasks can't move forward anymore, or error occurs, this
+ * method returns the control flow to caller.
+ *
+ * @p op is used to perform flush, finish the stream, or inject metadata block.
+ * See ::BrotliEncoderOperation for more information.
+ *
+ * Flushing the stream means forcing encoding of all input passed to encoder and
+ * completing the current output block, so it could be fully decoded by stream
+ * decoder. To perform flush set @p op to ::BROTLI_OPERATION_FLUSH.
+ * Under some circumstances (e.g. lack of output stream capacity) this operation
+ * would require several calls to ::BrotliEncoderCompressStream. The method must
+ * be called again until both input stream is depleted and encoder has no more
+ * output (see ::BrotliEncoderHasMoreOutput) after the method is called.
+ *
+ * Finishing the stream means encoding of all input passed to encoder and
+ * adding specific "final" marks, so stream decoder could determine that stream
+ * is complete. To perform finish set @p op to ::BROTLI_OPERATION_FINISH.
+ * Under some circumstances (e.g. lack of output stream capacity) this operation
+ * would require several calls to ::BrotliEncoderCompressStream. The method must
+ * be called again until both input stream is depleted and encoder has no more
+ * output (see ::BrotliEncoderHasMoreOutput) after the method is called.
+ *
+ * @warning When flushing and finishing, @p op should not change until operation
+ * is complete; input stream should not be swapped, reduced or
+ * extended as well.
+ *
+ * @param state encoder instance
+ * @param op requested operation
+ * @param[in, out] available_in @b in: amount of available input; \n
+ * @b out: amount of unused input
+ * @param[in, out] next_in pointer to the next input byte
+ * @param[in, out] available_out @b in: length of output buffer; \n
+ * @b out: remaining size of output buffer
+ * @param[in, out] next_out compressed output buffer cursor;
+ * can be @c NULL if @p available_out is @c 0
+ * @param[out] total_out number of bytes produced so far; can be @c NULL
+ * @returns ::BROTLI_FALSE if there was an error
+ * @returns ::BROTLI_TRUE otherwise
+ */
+BROTLI_ENC_API BROTLI_BOOL BrotliEncoderCompressStream(
+ BrotliEncoderState* state, BrotliEncoderOperation op, size_t* available_in,
+ const uint8_t** next_in, size_t* available_out, uint8_t** next_out,
+ size_t* total_out);
+
+/**
+ * Checks if encoder instance reached the final state.
+ *
+ * @param state encoder instance
+ * @returns ::BROTLI_TRUE if encoder is in a state where it reached the end of
+ * the input and produced all of the output
+ * @returns ::BROTLI_FALSE otherwise
+ */
+BROTLI_ENC_API BROTLI_BOOL BrotliEncoderIsFinished(BrotliEncoderState* state);
+
+/**
+ * Checks if encoder has more output.
+ *
+ * @param state encoder instance
+ * @returns ::BROTLI_TRUE, if encoder has some unconsumed output
+ * @returns ::BROTLI_FALSE otherwise
+ */
+BROTLI_ENC_API BROTLI_BOOL BrotliEncoderHasMoreOutput(
+ BrotliEncoderState* state);
+
+/**
+ * Acquires pointer to internal output buffer.
+ *
+ * This method is used to make language bindings easier and more efficient:
+ * -# push data to ::BrotliEncoderCompressStream,
+ * until ::BrotliEncoderHasMoreOutput returns BROTL_TRUE
+ * -# use ::BrotliEncoderTakeOutput to peek bytes and copy to language-specific
+ * entity
+ *
+ * Also this could be useful if there is an output stream that is able to
+ * consume all the provided data (e.g. when data is saved to file system).
+ *
+ * @attention After every call to ::BrotliEncoderTakeOutput @p *size bytes of
+ * output are considered consumed for all consecutive calls to the
+ * instance methods; returned pointer becomes invalidated as well.
+ *
+ * @note Encoder output is not guaranteed to be contiguous. This means that
+ * after the size-unrestricted call to ::BrotliEncoderTakeOutput,
+ * immediate next call to ::BrotliEncoderTakeOutput may return more data.
+ *
+ * @param state encoder instance
+ * @param[in, out] size @b in: number of bytes caller is ready to take, @c 0 if
+ * any amount could be handled; \n
+ * @b out: amount of data pointed by returned pointer and
+ * considered consumed; \n
+ * out value is never greater than in value, unless it is @c 0
+ * @returns pointer to output data
+ */
+BROTLI_ENC_API const uint8_t* BrotliEncoderTakeOutput(
+ BrotliEncoderState* state, size_t* size);
+
+
+/**
+ * Gets an encoder library version.
+ *
+ * Look at BROTLI_VERSION for more information.
+ */
+BROTLI_ENC_API uint32_t BrotliEncoderVersion(void);
+
+#if defined(__cplusplus) || defined(c_plusplus)
+} /* extern "C" */
+#endif
+
+#endif /* BROTLI_ENC_ENCODE_H_ */
diff --git a/Source/ThirdParty/brotli/include/brotli/port.h b/Source/ThirdParty/brotli/include/brotli/port.h
new file mode 100755
index 000000000..16c31d426
--- /dev/null
+++ b/Source/ThirdParty/brotli/include/brotli/port.h
@@ -0,0 +1,146 @@
+/* Copyright 2016 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/* Macros for compiler / platform specific features and build options. */
+
+#ifndef BROTLI_COMMON_PORT_H_
+#define BROTLI_COMMON_PORT_H_
+
+/* Compatibility with non-clang compilers. */
+#ifndef __has_builtin
+#define __has_builtin(x) 0
+#endif
+
+#ifndef __has_attribute
+#define __has_attribute(x) 0
+#endif
+
+#ifndef __has_feature
+#define __has_feature(x) 0
+#endif
+
+#if defined(__GNUC__) && defined(__GNUC_MINOR__)
+#define BROTLI_GCC_VERSION (__GNUC__ * 100 + __GNUC_MINOR__)
+#else
+#define BROTLI_GCC_VERSION 0
+#endif
+
+#if defined(__ICC)
+#define BROTLI_ICC_VERSION __ICC
+#else
+#define BROTLI_ICC_VERSION 0
+#endif
+
+#if defined(BROTLI_BUILD_MODERN_COMPILER)
+#define BROTLI_MODERN_COMPILER 1
+#elif BROTLI_GCC_VERSION >= 304 || BROTLI_ICC_VERSION >= 1600
+#define BROTLI_MODERN_COMPILER 1
+#else
+#define BROTLI_MODERN_COMPILER 0
+#endif
+
+/* Define "BROTLI_PREDICT_TRUE" and "BROTLI_PREDICT_FALSE" macros for capable
+ compilers.
+
+To apply compiler hint, enclose the branching condition into macros, like this:
+
+ if (BROTLI_PREDICT_TRUE(zero == 0)) {
+ // main execution path
+ } else {
+ // compiler should place this code outside of main execution path
+ }
+
+OR:
+
+ if (BROTLI_PREDICT_FALSE(something_rare_or_unexpected_happens)) {
+ // compiler should place this code outside of main execution path
+ }
+
+*/
+#if BROTLI_MODERN_COMPILER || __has_builtin(__builtin_expect)
+#define BROTLI_PREDICT_TRUE(x) (__builtin_expect(!!(x), 1))
+#define BROTLI_PREDICT_FALSE(x) (__builtin_expect(x, 0))
+#else
+#define BROTLI_PREDICT_FALSE(x) (x)
+#define BROTLI_PREDICT_TRUE(x) (x)
+#endif
+
+#if BROTLI_MODERN_COMPILER || __has_attribute(always_inline)
+#define BROTLI_ATTRIBUTE_ALWAYS_INLINE __attribute__ ((always_inline))
+#else
+#define BROTLI_ATTRIBUTE_ALWAYS_INLINE
+#endif
+
+#if defined(_WIN32) || defined(__CYGWIN__)
+#define BROTLI_ATTRIBUTE_VISIBILITY_HIDDEN
+#elif BROTLI_MODERN_COMPILER || __has_attribute(visibility)
+#define BROTLI_ATTRIBUTE_VISIBILITY_HIDDEN \
+ __attribute__ ((visibility ("hidden")))
+#else
+#define BROTLI_ATTRIBUTE_VISIBILITY_HIDDEN
+#endif
+
+#ifndef BROTLI_INTERNAL
+#define BROTLI_INTERNAL BROTLI_ATTRIBUTE_VISIBILITY_HIDDEN
+#endif
+
+#if defined(BROTLI_SHARED_COMPILATION) && defined(_WIN32)
+#if defined(BROTLICOMMON_SHARED_COMPILATION)
+#define BROTLI_COMMON_API __declspec(dllexport)
+#else
+#define BROTLI_COMMON_API __declspec(dllimport)
+#endif /* BROTLICOMMON_SHARED_COMPILATION */
+#if defined(BROTLIDEC_SHARED_COMPILATION)
+#define BROTLI_DEC_API __declspec(dllexport)
+#else
+#define BROTLI_DEC_API __declspec(dllimport)
+#endif /* BROTLIDEC_SHARED_COMPILATION */
+#if defined(BROTLIENC_SHARED_COMPILATION)
+#define BROTLI_ENC_API __declspec(dllexport)
+#else
+#define BROTLI_ENC_API __declspec(dllimport)
+#endif /* BROTLIENC_SHARED_COMPILATION */
+#else /* BROTLI_SHARED_COMPILATION && _WIN32 */
+#define BROTLI_COMMON_API
+#define BROTLI_DEC_API
+#define BROTLI_ENC_API
+#endif
+
+#ifndef _MSC_VER
+#if defined(__cplusplus) || !defined(__STRICT_ANSI__) || \
+ (defined(__STDC_VERSION__) && __STDC_VERSION__ >= 199901L)
+#define BROTLI_INLINE inline BROTLI_ATTRIBUTE_ALWAYS_INLINE
+#else
+#define BROTLI_INLINE
+#endif
+#else /* _MSC_VER */
+#define BROTLI_INLINE __forceinline
+#endif /* _MSC_VER */
+
+#if !defined(__cplusplus) && !defined(c_plusplus) && \
+ (defined(__STDC_VERSION__) && __STDC_VERSION__ >= 199901L)
+#define BROTLI_RESTRICT restrict
+#elif BROTLI_GCC_VERSION > 295 || defined(__llvm__)
+#define BROTLI_RESTRICT __restrict
+#else
+#define BROTLI_RESTRICT
+#endif
+
+#if BROTLI_MODERN_COMPILER || __has_attribute(noinline)
+#define BROTLI_NOINLINE __attribute__((noinline))
+#else
+#define BROTLI_NOINLINE
+#endif
+
+#if BROTLI_MODERN_COMPILER || __has_attribute(deprecated)
+#define BROTLI_DEPRECATED __attribute__((deprecated))
+#else
+#define BROTLI_DEPRECATED
+#endif
+
+#define BROTLI_UNUSED(X) (void)(X)
+
+#endif /* BROTLI_COMMON_PORT_H_ */
diff --git a/Source/ThirdParty/brotli/include/brotli/types.h b/Source/ThirdParty/brotli/include/brotli/types.h
new file mode 100755
index 000000000..fcb271028
--- /dev/null
+++ b/Source/ThirdParty/brotli/include/brotli/types.h
@@ -0,0 +1,90 @@
+/* Copyright 2013 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/**
+ * @file
+ * Common types used in decoder and encoder API.
+ */
+
+#ifndef BROTLI_COMMON_TYPES_H_
+#define BROTLI_COMMON_TYPES_H_
+
+#include <stddef.h> /* for size_t */
+
+#if defined(_MSC_VER) && (_MSC_VER < 1600)
+typedef __int8 int8_t;
+typedef unsigned __int8 uint8_t;
+typedef __int16 int16_t;
+typedef unsigned __int16 uint16_t;
+typedef __int32 int32_t;
+typedef unsigned __int32 uint32_t;
+typedef unsigned __int64 uint64_t;
+typedef __int64 int64_t;
+#else
+#include <stdint.h>
+#endif /* defined(_MSC_VER) && (_MSC_VER < 1600) */
+
+/**
+ * A portable @c bool replacement.
+ *
+ * ::BROTLI_BOOL is a "documentation" type: actually it is @c int, but in API it
+ * denotes a type, whose only values are ::BROTLI_TRUE and ::BROTLI_FALSE.
+ *
+ * ::BROTLI_BOOL values passed to Brotli should either be ::BROTLI_TRUE or
+ * ::BROTLI_FALSE, or be a result of ::TO_BROTLI_BOOL macros.
+ *
+ * ::BROTLI_BOOL values returned by Brotli should not be tested for equality
+ * with @c true, @c false, ::BROTLI_TRUE, ::BROTLI_FALSE, but rather should be
+ * evaluated, for example: @code{.cpp}
+ * if (SomeBrotliFunction(encoder, BROTLI_TRUE) &&
+ * !OtherBrotliFunction(decoder, BROTLI_FALSE)) {
+ * bool x = !!YetAnotherBrotliFunction(encoder, TO_BROLTI_BOOL(2 * 2 == 4));
+ * DoSomething(x);
+ * }
+ * @endcode
+ */
+#define BROTLI_BOOL int
+/** Portable @c true replacement. */
+#define BROTLI_TRUE 1
+/** Portable @c false replacement. */
+#define BROTLI_FALSE 0
+/** @c bool to ::BROTLI_BOOL conversion macros. */
+#define TO_BROTLI_BOOL(X) (!!(X) ? BROTLI_TRUE : BROTLI_FALSE)
+
+#define BROTLI_MAKE_UINT64_T(high, low) ((((uint64_t)(high)) << 32) | low)
+
+#define BROTLI_UINT32_MAX (~((uint32_t)0))
+#define BROTLI_SIZE_MAX (~((size_t)0))
+
+/**
+ * Allocating function pointer type.
+ *
+ * @param opaque custom memory manager handle provided by client
+ * @param size requested memory region size; can not be @c 0
+ * @returns @c 0 in the case of failure
+ * @returns a valid pointer to a memory region of at least @p size bytes
+ * long otherwise
+ */
+typedef void* (*brotli_alloc_func)(void* opaque, size_t size);
+
+/**
+ * Deallocating function pointer type.
+ *
+ * This function @b SHOULD do nothing if @p address is @c 0.
+ *
+ * @param opaque custom memory manager handle provided by client
+ * @param address memory region pointer returned by ::brotli_alloc_func, or @c 0
+ */
+typedef void (*brotli_free_func)(void* opaque, void* address);
+
+#if defined(__STDC_VERSION__) && (__STDC_VERSION__ >= 199901L) && \
+ !defined(__cplusplus) && !defined(__PGI)
+#define BROTLI_ARRAY_PARAM(L) L
+#else
+#define BROTLI_ARRAY_PARAM(L)
+#endif
+
+#endif /* BROTLI_COMMON_TYPES_H_ */
diff --git a/Source/ThirdParty/brotli/update.sh b/Source/ThirdParty/brotli/update.sh
index 752a47884..5b6aeebb6 100755
--- a/Source/ThirdParty/brotli/update.sh
+++ b/Source/ThirdParty/brotli/update.sh
@@ -10,8 +10,10 @@ git clone https://github.com/google/brotli ${MY_TEMP_DIR}/brotli
COMMIT=`(cd ${MY_TEMP_DIR}/brotli && git log | head -n 1)`
perl -p -i -e "s/\[commit [0-9a-f]{40}\]/[${COMMIT}]/" README.webkit;
-rm -rf dec
-mv ${MY_TEMP_DIR}/brotli/dec dec
+rm -rf dec common include/brotli
+mv ${MY_TEMP_DIR}/brotli/c/dec dec
+mv ${MY_TEMP_DIR}/brotli/c/common common
+mv ${MY_TEMP_DIR}/brotli/c/include/brotli include/brotli
rm -rf ${MY_TEMP_DIR}
echo "###"
diff --git a/Source/ThirdParty/woff2/CMakeLists.txt b/Source/ThirdParty/woff2/CMakeLists.txt
index e8f7cf2aa..3f907f120 100644
--- a/Source/ThirdParty/woff2/CMakeLists.txt
+++ b/Source/ThirdParty/woff2/CMakeLists.txt
@@ -1,6 +1,7 @@
set(WOFF2_DIR "${THIRDPARTY_DIR}/woff2")
set(WOFF2_INCLUDE_DIRECTORIES
+ "${WOFF2_DIR}/include"
"${WOFF2_DIR}/src"
)
@@ -12,7 +13,7 @@ set(WOFF2_SOURCES
${WOFF2_DIR}/src/woff2_out.cc
)
-include_directories("${THIRDPARTY_DIR}/brotli/dec")
+include_directories("${THIRDPARTY_DIR}/brotli/include")
include_directories("${WOFF2_INCLUDE_DIRECTORIES}")
add_library(woff2 STATIC ${WOFF2_SOURCES})
target_link_libraries(woff2 brotli)
diff --git a/Source/ThirdParty/woff2/README.webkit b/Source/ThirdParty/woff2/README.webkit
index 9348171e5..28b9adbac 100644
--- a/Source/ThirdParty/woff2/README.webkit
+++ b/Source/ThirdParty/woff2/README.webkit
@@ -11,4 +11,4 @@ The in-tree copy is updated by running
sh update.sh
from within the modules/woff2 directory.
-Current version: [commit 63b8fb6d0d797f04e77ee825fd8fcf7ea6205aac].
+Current version: [commit 22c256bc457777744ba14b7325a6e8e0e7dec91c].
diff --git a/Source/ThirdParty/woff2/src/woff2_dec.h b/Source/ThirdParty/woff2/include/woff2/decode.h
index b889812fb..6ef3b8e76 100644
--- a/Source/ThirdParty/woff2/src/woff2_dec.h
+++ b/Source/ThirdParty/woff2/include/woff2/decode.h
@@ -1,25 +1,17 @@
-// Copyright 2014 Google Inc. All Rights Reserved.
-//
-// Licensed under the Apache License, Version 2.0 (the "License");
-// you may not use this file except in compliance with the License.
-// You may obtain a copy of the License at
-//
-// http://www.apache.org/licenses/LICENSE-2.0
-//
-// Unless required by applicable law or agreed to in writing, software
-// distributed under the License is distributed on an "AS IS" BASIS,
-// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-// See the License for the specific language governing permissions and
-// limitations under the License.
-//
-// Library for converting WOFF2 format font files to their TTF versions.
+/* Copyright 2014 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/* Library for converting WOFF2 format font files to their TTF versions. */
#ifndef WOFF2_WOFF2_DEC_H_
#define WOFF2_WOFF2_DEC_H_
#include <stddef.h>
#include <inttypes.h>
-#include "./woff2_out.h"
+#include <woff2/output.h>
namespace woff2 {
diff --git a/Source/ThirdParty/woff2/src/woff2_enc.h b/Source/ThirdParty/woff2/include/woff2/encode.h
index 3ac8c3ab1..34b772297 100644
--- a/Source/ThirdParty/woff2/src/woff2_enc.h
+++ b/Source/ThirdParty/woff2/include/woff2/encode.h
@@ -1,18 +1,10 @@
-// Copyright 2014 Google Inc. All Rights Reserved.
-//
-// Licensed under the Apache License, Version 2.0 (the "License");
-// you may not use this file except in compliance with the License.
-// You may obtain a copy of the License at
-//
-// http://www.apache.org/licenses/LICENSE-2.0
-//
-// Unless required by applicable law or agreed to in writing, software
-// distributed under the License is distributed on an "AS IS" BASIS,
-// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-// See the License for the specific language governing permissions and
-// limitations under the License.
-//
-// Library for converting WOFF2 format font files to their TTF versions.
+/* Copyright 2014 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/* Library for converting WOFF2 format font files to their TTF versions. */
#ifndef WOFF2_WOFF2_ENC_H_
#define WOFF2_WOFF2_ENC_H_
@@ -21,16 +13,13 @@
#include <inttypes.h>
#include <string>
-using std::string;
-
-
namespace woff2 {
struct WOFF2Params {
WOFF2Params() : extended_metadata(""), brotli_quality(11),
allow_transforms(true) {}
- string extended_metadata;
+ std::string extended_metadata;
int brotli_quality;
bool allow_transforms;
};
@@ -38,7 +27,7 @@ struct WOFF2Params {
// Returns an upper bound on the size of the compressed file.
size_t MaxWOFF2CompressedSize(const uint8_t* data, size_t length);
size_t MaxWOFF2CompressedSize(const uint8_t* data, size_t length,
- const string& extended_metadata);
+ const std::string& extended_metadata);
// Compresses the font into the target buffer. *result_length should be at least
// the value returned by MaxWOFF2CompressedSize(), upon return, it is set to the
diff --git a/Source/ThirdParty/woff2/src/woff2_out.h b/Source/ThirdParty/woff2/include/woff2/output.h
index c956afa0e..c325f67be 100644
--- a/Source/ThirdParty/woff2/src/woff2_out.h
+++ b/Source/ThirdParty/woff2/include/woff2/output.h
@@ -1,34 +1,10 @@
-// Copyright 2016 Google Inc. All Rights Reserved.
-//
-// Licensed under the Apache License, Version 2.0 (the "License");
-// you may not use this file except in compliance with the License.
-// You may obtain a copy of the License at
-//
-// http://www.apache.org/licenses/LICENSE-2.0
-//
-// Unless required by applicable law or agreed to in writing, software
-// distributed under the License is distributed on an "AS IS" BASIS,
-// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-// See the License for the specific language governing permissions and
-// limitations under the License.
-//
-// Output buffer for WOFF2 decompression.
-
-// Copyright 2016 Google Inc. All Rights Reserved.
-//
-// Licensed under the Apache License, Version 2.0 (the "License");
-// you may not use this file except in compliance with the License.
-// You may obtain a copy of the License at
-//
-// http://www.apache.org/licenses/LICENSE-2.0
-//
-// Unless required by applicable law or agreed to in writing, software
-// distributed under the License is distributed on an "AS IS" BASIS,
-// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-// See the License for the specific language governing permissions and
-// limitations under the License.
-//
-// Output buffer for WOFF2 decompression.
+/* Copyright 2016 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/* Output buffer for WOFF2 decompression. */
#ifndef WOFF2_WOFF2_OUT_H_
#define WOFF2_WOFF2_OUT_H_
@@ -37,16 +13,12 @@
#include <cstring>
#include <memory>
#include <string>
-#include "./port.h"
namespace woff2 {
// Suggested max size for output.
const size_t kDefaultMaxSize = 30 * 1024 * 1024;
-using std::string;
-
-
/**
* Output interface for the woff2 decoding.
*
@@ -79,7 +51,7 @@ class WOFF2StringOut : public WOFF2Out {
// Create a writer that writes its data to buf.
// buf->size() will grow to at most max_size
// buf may be sized (e.g. using EstimateWOFF2FinalSize) or empty.
- explicit WOFF2StringOut(string* buf);
+ explicit WOFF2StringOut(std::string* buf);
bool Write(const void *buf, size_t n) override;
bool Write(const void *buf, size_t offset, size_t n) override;
@@ -87,7 +59,7 @@ class WOFF2StringOut : public WOFF2Out {
size_t MaxSize() { return max_size_; }
void SetMaxSize(size_t max_size);
private:
- string* buf_;
+ std::string* buf_;
size_t max_size_;
size_t offset_;
};
diff --git a/Source/ThirdParty/woff2/src/buffer.h b/Source/ThirdParty/woff2/src/buffer.h
index 588ac0d33..7240e5181 100644
--- a/Source/ThirdParty/woff2/src/buffer.h
+++ b/Source/ThirdParty/woff2/src/buffer.h
@@ -1,19 +1,11 @@
-// Copyright 2013 Google Inc. All Rights Reserved.
-//
-// Licensed under the Apache License, Version 2.0 (the "License");
-// you may not use this file except in compliance with the License.
-// You may obtain a copy of the License at
-//
-// http://www.apache.org/licenses/LICENSE-2.0
-//
-// Unless required by applicable law or agreed to in writing, software
-// distributed under the License is distributed on an "AS IS" BASIS,
-// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-// See the License for the specific language governing permissions and
-// limitations under the License.
-//
-// The parts of ots.h & opentype-sanitiser.h that we need, taken from the
-// https://code.google.com/p/ots/ project.
+/* Copyright 2013 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/* The parts of ots.h & opentype-sanitiser.h that we need, taken from the
+ https://code.google.com/p/ots/ project. */
#ifndef WOFF2_BUFFER_H_
#define WOFF2_BUFFER_H_
@@ -65,8 +57,8 @@ inline bool Failure(const char *f, int l, const char *fn) {
// -----------------------------------------------------------------------------
class Buffer {
public:
- Buffer(const uint8_t *buffer, size_t len)
- : buffer_(buffer),
+ Buffer(const uint8_t *data, size_t len)
+ : buffer_(data),
length_(len),
offset_(0) { }
@@ -74,7 +66,7 @@ class Buffer {
return Read(NULL, n_bytes);
}
- bool Read(uint8_t *buffer, size_t n_bytes) {
+ bool Read(uint8_t *data, size_t n_bytes) {
if (n_bytes > 1024 * 1024 * 1024) {
return FONT_COMPRESSION_FAILURE();
}
@@ -82,8 +74,8 @@ class Buffer {
(offset_ > length_ - n_bytes)) {
return FONT_COMPRESSION_FAILURE();
}
- if (buffer) {
- std::memcpy(buffer, buffer_ + offset_, n_bytes);
+ if (data) {
+ std::memcpy(data, buffer_ + offset_, n_bytes);
}
offset_ += n_bytes;
return true;
diff --git a/Source/ThirdParty/woff2/src/convert_woff2ttf_fuzzer.cc b/Source/ThirdParty/woff2/src/convert_woff2ttf_fuzzer.cc
new file mode 100644
index 000000000..2d977a3ef
--- /dev/null
+++ b/Source/ThirdParty/woff2/src/convert_woff2ttf_fuzzer.cc
@@ -0,0 +1,13 @@
+#include <stddef.h>
+#include <stdint.h>
+
+#include <woff2/decode.h>
+
+// Entry point for LibFuzzer.
+extern "C" int LLVMFuzzerTestOneInput(const uint8_t* data, size_t size) {
+ std::string buf;
+ woff2::WOFF2StringOut out(&buf);
+ out.SetMaxSize(30 * 1024 * 1024);
+ woff2::ConvertWOFF2ToTTF(data, size, &out);
+ return 0;
+}
diff --git a/Source/ThirdParty/woff2/src/convert_woff2ttf_fuzzer_new_entry.cc b/Source/ThirdParty/woff2/src/convert_woff2ttf_fuzzer_new_entry.cc
new file mode 100644
index 000000000..5ad93364b
--- /dev/null
+++ b/Source/ThirdParty/woff2/src/convert_woff2ttf_fuzzer_new_entry.cc
@@ -0,0 +1,12 @@
+#include <string>
+#include <woff2/decode.h>
+
+extern "C" int LLVMFuzzerTestOneInput(const uint8_t *data, size_t data_size) {
+ // Decode using newer entry pattern.
+ // Same pattern as woff2_decompress.
+ std::string output(std::min(woff2::ComputeWOFF2FinalSize(data, data_size),
+ woff2::kDefaultMaxSize), 0);
+ woff2::WOFF2StringOut out(&output);
+ woff2::ConvertWOFF2ToTTF(data, data_size, &out);
+ return 0;
+}
diff --git a/Source/ThirdParty/woff2/src/file.h b/Source/ThirdParty/woff2/src/file.h
index 7afcb315f..61318776b 100644
--- a/Source/ThirdParty/woff2/src/file.h
+++ b/Source/ThirdParty/woff2/src/file.h
@@ -1,18 +1,10 @@
-// Copyright 2013 Google Inc. All Rights Reserved.
-//
-// Licensed under the Apache License, Version 2.0 (the "License");
-// you may not use this file except in compliance with the License.
-// You may obtain a copy of the License at
-//
-// http://www.apache.org/licenses/LICENSE-2.0
-//
-// Unless required by applicable law or agreed to in writing, software
-// distributed under the License is distributed on an "AS IS" BASIS,
-// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-// See the License for the specific language governing permissions and
-// limitations under the License.
-//
-// File IO helpers.
+/* Copyright 2013 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/* File IO helpers. */
#ifndef WOFF2_FILE_H_
#define WOFF2_FILE_H_
diff --git a/Source/ThirdParty/woff2/src/font.cc b/Source/ThirdParty/woff2/src/font.cc
index 060673005..6b72f6da9 100644
--- a/Source/ThirdParty/woff2/src/font.cc
+++ b/Source/ThirdParty/woff2/src/font.cc
@@ -1,18 +1,10 @@
-// Copyright 2013 Google Inc. All Rights Reserved.
-//
-// Licensed under the Apache License, Version 2.0 (the "License");
-// you may not use this file except in compliance with the License.
-// You may obtain a copy of the License at
-//
-// http://www.apache.org/licenses/LICENSE-2.0
-//
-// Unless required by applicable law or agreed to in writing, software
-// distributed under the License is distributed on an "AS IS" BASIS,
-// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-// See the License for the specific language governing permissions and
-// limitations under the License.
-//
-// Font management utilities
+/* Copyright 2013 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/* Font management utilities */
#include "./font.h"
@@ -105,6 +97,12 @@ bool ReadTrueTypeFont(Buffer* file, const uint8_t* data, size_t len,
last_offset = i.first + i.second;
}
+ // Sanity check key tables
+ const Font::Table* head_table = font->FindTable(kHeadTableTag);
+ if (head_table != NULL && head_table->length < 52) {
+ return FONT_COMPRESSION_FAILURE();
+ }
+
return true;
}
@@ -325,8 +323,11 @@ int NumGlyphs(const Font& font) {
return 0;
}
int index_fmt = IndexFormat(font);
- int num_glyphs = (loca_table->length / (index_fmt == 0 ? 2 : 4)) - 1;
- return num_glyphs;
+ int loca_record_size = (index_fmt == 0 ? 2 : 4);
+ if (loca_table->length < loca_record_size) {
+ return 0;
+ }
+ return (loca_table->length / loca_record_size) - 1;
}
int IndexFormat(const Font& font) {
diff --git a/Source/ThirdParty/woff2/src/font.h b/Source/ThirdParty/woff2/src/font.h
index 93806e6b5..7b8ddddc5 100644
--- a/Source/ThirdParty/woff2/src/font.h
+++ b/Source/ThirdParty/woff2/src/font.h
@@ -1,19 +1,11 @@
-// Copyright 2013 Google Inc. All Rights Reserved.
-//
-// Licensed under the Apache License, Version 2.0 (the "License");
-// you may not use this file except in compliance with the License.
-// You may obtain a copy of the License at
-//
-// http://www.apache.org/licenses/LICENSE-2.0
-//
-// Unless required by applicable law or agreed to in writing, software
-// distributed under the License is distributed on an "AS IS" BASIS,
-// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-// See the License for the specific language governing permissions and
-// limitations under the License.
-//
-// Data model for a font file in sfnt format, reading and writing functions and
-// accessors for the glyph data.
+/* Copyright 2013 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/* Data model for a font file in sfnt format, reading and writing functions and
+ accessors for the glyph data. */
#ifndef WOFF2_FONT_H_
#define WOFF2_FONT_H_
diff --git a/Source/ThirdParty/woff2/src/glyph.cc b/Source/ThirdParty/woff2/src/glyph.cc
index 1dadafcb7..057174de2 100644
--- a/Source/ThirdParty/woff2/src/glyph.cc
+++ b/Source/ThirdParty/woff2/src/glyph.cc
@@ -1,18 +1,10 @@
-// Copyright 2013 Google Inc. All Rights Reserved.
-//
-// Licensed under the Apache License, Version 2.0 (the "License");
-// you may not use this file except in compliance with the License.
-// You may obtain a copy of the License at
-//
-// http://www.apache.org/licenses/LICENSE-2.0
-//
-// Unless required by applicable law or agreed to in writing, software
-// distributed under the License is distributed on an "AS IS" BASIS,
-// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-// See the License for the specific language governing permissions and
-// limitations under the License.
-//
-// Glyph manipulation
+/* Copyright 2013 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/* Glyph manipulation */
#include "./glyph.h"
@@ -118,25 +110,27 @@ bool ReadGlyph(const uint8_t* data, size_t len, Glyph* glyph) {
// Read the run-length coded flags.
std::vector<std::vector<uint8_t> > flags(num_contours);
- uint8_t flag = 0;
- uint8_t flag_repeat = 0;
- for (int i = 0; i < num_contours; ++i) {
- flags[i].resize(glyph->contours[i].size());
- for (size_t j = 0; j < glyph->contours[i].size(); ++j) {
- if (flag_repeat == 0) {
- if (!buffer.ReadU8(&flag)) {
- return FONT_COMPRESSION_FAILURE();
- }
- if (flag & kFLAG_REPEAT) {
- if (!buffer.ReadU8(&flag_repeat)) {
+ {
+ uint8_t flag = 0;
+ uint8_t flag_repeat = 0;
+ for (int i = 0; i < num_contours; ++i) {
+ flags[i].resize(glyph->contours[i].size());
+ for (size_t j = 0; j < glyph->contours[i].size(); ++j) {
+ if (flag_repeat == 0) {
+ if (!buffer.ReadU8(&flag)) {
return FONT_COMPRESSION_FAILURE();
}
+ if (flag & kFLAG_REPEAT) {
+ if (!buffer.ReadU8(&flag_repeat)) {
+ return FONT_COMPRESSION_FAILURE();
+ }
+ }
+ } else {
+ flag_repeat--;
}
- } else {
- flag_repeat--;
+ flags[i][j] = flag;
+ glyph->contours[i][j].on_curve = flag & kFLAG_ONCURVE;
}
- flags[i][j] = flag;
- glyph->contours[i][j].on_curve = flag & kFLAG_ONCURVE;
}
}
diff --git a/Source/ThirdParty/woff2/src/glyph.h b/Source/ThirdParty/woff2/src/glyph.h
index 0ee755c2f..f24056f4c 100644
--- a/Source/ThirdParty/woff2/src/glyph.h
+++ b/Source/ThirdParty/woff2/src/glyph.h
@@ -1,19 +1,11 @@
-// Copyright 2013 Google Inc. All Rights Reserved.
-//
-// Licensed under the Apache License, Version 2.0 (the "License");
-// you may not use this file except in compliance with the License.
-// You may obtain a copy of the License at
-//
-// http://www.apache.org/licenses/LICENSE-2.0
-//
-// Unless required by applicable law or agreed to in writing, software
-// distributed under the License is distributed on an "AS IS" BASIS,
-// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-// See the License for the specific language governing permissions and
-// limitations under the License.
-//
-// Data model and I/O for glyph data within sfnt format files for the purpose of
-// performing the preprocessing step of the WOFF 2.0 conversion.
+/* Copyright 2013 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/* Data model and I/O for glyph data within sfnt format files for the purpose of
+ performing the preprocessing step of the WOFF 2.0 conversion. */
#ifndef WOFF2_GLYPH_H_
#define WOFF2_GLYPH_H_
diff --git a/Source/ThirdParty/woff2/src/normalize.cc b/Source/ThirdParty/woff2/src/normalize.cc
index b538b91a8..39f9405fd 100644
--- a/Source/ThirdParty/woff2/src/normalize.cc
+++ b/Source/ThirdParty/woff2/src/normalize.cc
@@ -1,18 +1,10 @@
-// Copyright 2013 Google Inc. All Rights Reserved.
-//
-// Licensed under the Apache License, Version 2.0 (the "License");
-// you may not use this file except in compliance with the License.
-// You may obtain a copy of the License at
-//
-// http://www.apache.org/licenses/LICENSE-2.0
-//
-// Unless required by applicable law or agreed to in writing, software
-// distributed under the License is distributed on an "AS IS" BASIS,
-// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-// See the License for the specific language governing permissions and
-// limitations under the License.
-//
-// Glyph normalization
+/* Copyright 2013 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/* Glyph normalization */
#include "./normalize.h"
@@ -52,7 +44,7 @@ bool WriteNormalizedLoca(int index_fmt, int num_glyphs, Font* font) {
loca_table->buffer.resize(Round4(num_glyphs + 1) * glyph_sz);
loca_table->length = (num_glyphs + 1) * glyph_sz;
- uint8_t* glyf_dst = &glyf_table->buffer[0];
+ uint8_t* glyf_dst = num_glyphs ? &glyf_table->buffer[0] : NULL;
uint8_t* loca_dst = &loca_table->buffer[0];
uint32_t glyf_offset = 0;
size_t loca_offset = 0;
@@ -78,16 +70,13 @@ bool WriteNormalizedLoca(int index_fmt, int num_glyphs, Font* font) {
}
glyf_offset += glyf_dst_size;
}
- if (glyf_offset == 0) {
- return false;
- }
StoreLoca(index_fmt, glyf_offset, &loca_offset, loca_dst);
glyf_table->buffer.resize(glyf_offset);
- glyf_table->data = &glyf_table->buffer[0];
+ glyf_table->data = glyf_offset ? &glyf_table->buffer[0] : NULL;
glyf_table->length = glyf_offset;
- loca_table->data = &loca_table->buffer[0];
+ loca_table->data = loca_offset ? &loca_table->buffer[0] : NULL;
return true;
}
diff --git a/Source/ThirdParty/woff2/src/normalize.h b/Source/ThirdParty/woff2/src/normalize.h
index e0153488e..c6fee74db 100644
--- a/Source/ThirdParty/woff2/src/normalize.h
+++ b/Source/ThirdParty/woff2/src/normalize.h
@@ -1,20 +1,12 @@
-// Copyright 2013 Google Inc. All Rights Reserved.
-//
-// Licensed under the Apache License, Version 2.0 (the "License");
-// you may not use this file except in compliance with the License.
-// You may obtain a copy of the License at
-//
-// http://www.apache.org/licenses/LICENSE-2.0
-//
-// Unless required by applicable law or agreed to in writing, software
-// distributed under the License is distributed on an "AS IS" BASIS,
-// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-// See the License for the specific language governing permissions and
-// limitations under the License.
-//
-// Functions for normalizing fonts. Since the WOFF 2.0 decoder creates font
-// files in normalized form, the WOFF 2.0 conversion is guaranteed to be
-// lossless (in a bitwise sense) only for normalized font files.
+/* Copyright 2013 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/* Functions for normalizing fonts. Since the WOFF 2.0 decoder creates font
+ files in normalized form, the WOFF 2.0 conversion is guaranteed to be
+ lossless (in a bitwise sense) only for normalized font files. */
#ifndef WOFF2_NORMALIZE_H_
#define WOFF2_NORMALIZE_H_
diff --git a/Source/ThirdParty/woff2/src/port.h b/Source/ThirdParty/woff2/src/port.h
index bac47a93a..8b60fee8b 100644
--- a/Source/ThirdParty/woff2/src/port.h
+++ b/Source/ThirdParty/woff2/src/port.h
@@ -1,18 +1,10 @@
-// Copyright 2013 Google Inc. All Rights Reserved.
-//
-// Licensed under the Apache License, Version 2.0 (the "License");
-// you may not use this file except in compliance with the License.
-// You may obtain a copy of the License at
-//
-// http://www.apache.org/licenses/LICENSE-2.0
-//
-// Unless required by applicable law or agreed to in writing, software
-// distributed under the License is distributed on an "AS IS" BASIS,
-// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-// See the License for the specific language governing permissions and
-// limitations under the License.
-//
-// Helper function for bit twiddling and macros for branch prediction.
+/* Copyright 2013 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/* Helper function for bit twiddling and macros for branch prediction. */
#ifndef WOFF2_PORT_H_
#define WOFF2_PORT_H_
@@ -60,4 +52,15 @@ inline int Log2Floor(uint32 n) {
#define PREDICT_TRUE(x) (x)
#endif
+#if (defined(__ARM_ARCH) && (__ARM_ARCH == 7)) || \
+ (defined(M_ARM) && (M_ARM == 7)) || \
+ defined(__aarch64__) || defined(__ARM64_ARCH_8__) || defined(__i386) || \
+ defined(_M_IX86) || defined(__x86_64__) || defined(_M_X64)
+#if defined(__BYTE_ORDER__) && (__BYTE_ORDER__ == __ORDER_LITTLE_ENDIAN__)
+#define WOFF_LITTLE_ENDIAN
+#elif defined(__BYTE_ORDER__) && (__BYTE_ORDER__ == __ORDER_BIG_ENDIAN__)
+#define WOFF_BIG_ENDIAN
+#endif /* endianness */
+#endif /* CPU whitelist */
+
#endif // WOFF2_PORT_H_
diff --git a/Source/ThirdParty/woff2/src/round.h b/Source/ThirdParty/woff2/src/round.h
index abb81f823..e5b2cb122 100644
--- a/Source/ThirdParty/woff2/src/round.h
+++ b/Source/ThirdParty/woff2/src/round.h
@@ -1,18 +1,10 @@
-// Copyright 2013 Google Inc. All Rights Reserved.
-//
-// Licensed under the Apache License, Version 2.0 (the "License");
-// you may not use this file except in compliance with the License.
-// You may obtain a copy of the License at
-//
-// http://www.apache.org/licenses/LICENSE-2.0
-//
-// Unless required by applicable law or agreed to in writing, software
-// distributed under the License is distributed on an "AS IS" BASIS,
-// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-// See the License for the specific language governing permissions and
-// limitations under the License.
-//
-// Helper for rounding
+/* Copyright 2013 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/* Helper for rounding */
#ifndef WOFF2_ROUND_H_
#define WOFF2_ROUND_H_
diff --git a/Source/ThirdParty/woff2/src/store_bytes.h b/Source/ThirdParty/woff2/src/store_bytes.h
index 74b279c42..fff3c62f8 100644
--- a/Source/ThirdParty/woff2/src/store_bytes.h
+++ b/Source/ThirdParty/woff2/src/store_bytes.h
@@ -1,19 +1,11 @@
-// Copyright 2013 Google Inc. All Rights Reserved.
-//
-// Licensed under the Apache License, Version 2.0 (the "License");
-// you may not use this file except in compliance with the License.
-// You may obtain a copy of the License at
-//
-// http://www.apache.org/licenses/LICENSE-2.0
-//
-// Unless required by applicable law or agreed to in writing, software
-// distributed under the License is distributed on an "AS IS" BASIS,
-// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-// See the License for the specific language governing permissions and
-// limitations under the License.
-//
-// Helper functions for storing integer values into byte streams.
-// No bounds checking is performed, that is the responsibility of the caller.
+/* Copyright 2013 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/* Helper functions for storing integer values into byte streams.
+ No bounds checking is performed, that is the responsibility of the caller. */
#ifndef WOFF2_STORE_BYTES_H_
#define WOFF2_STORE_BYTES_H_
@@ -22,6 +14,8 @@
#include <stddef.h>
#include <string.h>
+#include "./port.h"
+
namespace woff2 {
inline size_t StoreU32(uint8_t* dst, size_t offset, uint32_t x) {
@@ -33,10 +27,10 @@ inline size_t StoreU32(uint8_t* dst, size_t offset, uint32_t x) {
}
inline size_t Store16(uint8_t* dst, size_t offset, int x) {
-#if (defined(__BYTE_ORDER__) && (__BYTE_ORDER__ == __ORDER_LITTLE_ENDIAN__))
+#if defined(WOFF_LITTLE_ENDIAN)
*reinterpret_cast<uint16_t*>(dst + offset) =
((x & 0xFF) << 8) | ((x & 0xFF00) >> 8);
-#elif (defined(__BYTE_ORDER__) && (__BYTE_ORDER__ == __ORDER_BIG_ENDIAN__))
+#elif defined(WOFF_BIG_ENDIAN)
*reinterpret_cast<uint16_t*>(dst + offset) = static_cast<uint16_t>(x);
#else
dst[offset] = x >> 8;
@@ -53,11 +47,11 @@ inline void StoreU32(uint32_t val, size_t* offset, uint8_t* dst) {
}
inline void Store16(int val, size_t* offset, uint8_t* dst) {
-#if (defined(__BYTE_ORDER__) && (__BYTE_ORDER__ == __ORDER_LITTLE_ENDIAN__))
+#if defined(WOFF_LITTLE_ENDIAN)
*reinterpret_cast<uint16_t*>(dst + *offset) =
((val & 0xFF) << 8) | ((val & 0xFF00) >> 8);
*offset += 2;
-#elif (defined(__BYTE_ORDER__) && (__BYTE_ORDER__ == __ORDER_BIG_ENDIAN__))
+#elif defined(WOFF_BIG_ENDIAN)
*reinterpret_cast<uint16_t*>(dst + *offset) = static_cast<uint16_t>(val);
*offset += 2;
#else
diff --git a/Source/ThirdParty/woff2/src/table_tags.cc b/Source/ThirdParty/woff2/src/table_tags.cc
index 0071e00b0..dca3ec8d2 100644
--- a/Source/ThirdParty/woff2/src/table_tags.cc
+++ b/Source/ThirdParty/woff2/src/table_tags.cc
@@ -1,18 +1,10 @@
-// Copyright 2014 Google Inc. All Rights Reserved.
-//
-// Licensed under the Apache License, Version 2.0 (the "License");
-// you may not use this file except in compliance with the License.
-// You may obtain a copy of the License at
-//
-// http://www.apache.org/licenses/LICENSE-2.0
-//
-// Unless required by applicable law or agreed to in writing, software
-// distributed under the License is distributed on an "AS IS" BASIS,
-// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-// See the License for the specific language governing permissions and
-// limitations under the License.
-//
-// Font table tags
+/* Copyright 2014 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/* Font table tags */
#include "./table_tags.h"
diff --git a/Source/ThirdParty/woff2/src/table_tags.h b/Source/ThirdParty/woff2/src/table_tags.h
index daa5d9215..42dc0ae1c 100644
--- a/Source/ThirdParty/woff2/src/table_tags.h
+++ b/Source/ThirdParty/woff2/src/table_tags.h
@@ -1,18 +1,10 @@
-// Copyright 2014 Google Inc. All Rights Reserved.
-//
-// Licensed under the Apache License, Version 2.0 (the "License");
-// you may not use this file except in compliance with the License.
-// You may obtain a copy of the License at
-//
-// http://www.apache.org/licenses/LICENSE-2.0
-//
-// Unless required by applicable law or agreed to in writing, software
-// distributed under the License is distributed on an "AS IS" BASIS,
-// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-// See the License for the specific language governing permissions and
-// limitations under the License.
-//
-// Font table tags
+/* Copyright 2014 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/* Font table tags */
#ifndef WOFF2_TABLE_TAGS_H_
#define WOFF2_TABLE_TAGS_H_
diff --git a/Source/ThirdParty/woff2/src/transform.cc b/Source/ThirdParty/woff2/src/transform.cc
index 2ad8b163c..999bef374 100644
--- a/Source/ThirdParty/woff2/src/transform.cc
+++ b/Source/ThirdParty/woff2/src/transform.cc
@@ -1,18 +1,10 @@
-// Copyright 2013 Google Inc. All Rights Reserved.
-//
-// Licensed under the Apache License, Version 2.0 (the "License");
-// you may not use this file except in compliance with the License.
-// You may obtain a copy of the License at
-//
-// http://www.apache.org/licenses/LICENSE-2.0
-//
-// Unless required by applicable law or agreed to in writing, software
-// distributed under the License is distributed on an "AS IS" BASIS,
-// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-// See the License for the specific language governing permissions and
-// limitations under the License.
-//
-// Library for preprocessing fonts as part of the WOFF 2.0 conversion.
+/* Copyright 2013 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/* Library for preprocessing fonts as part of the WOFF 2.0 conversion. */
#include "./transform.h"
diff --git a/Source/ThirdParty/woff2/src/transform.h b/Source/ThirdParty/woff2/src/transform.h
index e9d1b0d3d..a4583d16c 100644
--- a/Source/ThirdParty/woff2/src/transform.h
+++ b/Source/ThirdParty/woff2/src/transform.h
@@ -1,18 +1,10 @@
-// Copyright 2013 Google Inc. All Rights Reserved.
-//
-// Licensed under the Apache License, Version 2.0 (the "License");
-// you may not use this file except in compliance with the License.
-// You may obtain a copy of the License at
-//
-// http://www.apache.org/licenses/LICENSE-2.0
-//
-// Unless required by applicable law or agreed to in writing, software
-// distributed under the License is distributed on an "AS IS" BASIS,
-// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-// See the License for the specific language governing permissions and
-// limitations under the License.
-//
-// Library for preprocessing fonts as part of the WOFF 2.0 conversion.
+/* Copyright 2014 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/* Library for preprocessing fonts as part of the WOFF 2.0 conversion. */
#ifndef WOFF2_TRANSFORM_H_
#define WOFF2_TRANSFORM_H_
diff --git a/Source/ThirdParty/woff2/src/variable_length.cc b/Source/ThirdParty/woff2/src/variable_length.cc
index 944a17f2e..4f348d5e5 100644
--- a/Source/ThirdParty/woff2/src/variable_length.cc
+++ b/Source/ThirdParty/woff2/src/variable_length.cc
@@ -1,18 +1,10 @@
-// Copyright 2015 Google Inc. All Rights Reserved.
-//
-// Licensed under the Apache License, Version 2.0 (the "License");
-// you may not use this file except in compliance with the License.
-// You may obtain a copy of the License at
-//
-// http://www.apache.org/licenses/LICENSE-2.0
-//
-// Unless required by applicable law or agreed to in writing, software
-// distributed under the License is distributed on an "AS IS" BASIS,
-// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-// See the License for the specific language governing permissions and
-// limitations under the License.
-//
-// Helper functions for woff2 variable length types: 255UInt16 and UIntBase128
+/* Copyright 2015 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/* Helper functions for woff2 variable length types: 255UInt16 and UIntBase128 */
#include "./variable_length.h"
@@ -49,8 +41,8 @@ void Write255UShort(std::vector<uint8_t>* out, int value) {
void Store255UShort(int val, size_t* offset, uint8_t* dst) {
std::vector<uint8_t> packed;
Write255UShort(&packed, val);
- for (uint8_t val : packed) {
- dst[(*offset)++] = val;
+ for (uint8_t packed_byte : packed) {
+ dst[(*offset)++] = packed_byte;
}
}
diff --git a/Source/ThirdParty/woff2/src/variable_length.h b/Source/ThirdParty/woff2/src/variable_length.h
index 2816ae23a..208010653 100644
--- a/Source/ThirdParty/woff2/src/variable_length.h
+++ b/Source/ThirdParty/woff2/src/variable_length.h
@@ -1,18 +1,10 @@
-// Copyright 2015 Google Inc. All Rights Reserved.
-//
-// Licensed under the Apache License, Version 2.0 (the "License");
-// you may not use this file except in compliance with the License.
-// You may obtain a copy of the License at
-//
-// http://www.apache.org/licenses/LICENSE-2.0
-//
-// Unless required by applicable law or agreed to in writing, software
-// distributed under the License is distributed on an "AS IS" BASIS,
-// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-// See the License for the specific language governing permissions and
-// limitations under the License.
-//
-// Helper functions for woff2 variable length types: 255UInt16 and UIntBase128
+/* Copyright 2015 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/* Helper functions for woff2 variable length types: 255UInt16 and UIntBase128 */
#ifndef WOFF2_VARIABLE_LENGTH_H_
#define WOFF2_VARIABLE_LENGTH_H_
diff --git a/Source/ThirdParty/woff2/src/woff2_common.cc b/Source/ThirdParty/woff2/src/woff2_common.cc
index eba6a46e2..fe0a3beda 100644
--- a/Source/ThirdParty/woff2/src/woff2_common.cc
+++ b/Source/ThirdParty/woff2/src/woff2_common.cc
@@ -1,23 +1,17 @@
-// Copyright 2013 Google Inc. All Rights Reserved.
-//
-// Licensed under the Apache License, Version 2.0 (the "License");
-// you may not use this file except in compliance with the License.
-// You may obtain a copy of the License at
-//
-// http://www.apache.org/licenses/LICENSE-2.0
-//
-// Unless required by applicable law or agreed to in writing, software
-// distributed under the License is distributed on an "AS IS" BASIS,
-// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-// See the License for the specific language governing permissions and
-// limitations under the License.
-//
-// Helpers common across multiple parts of woff2
+/* Copyright 2013 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/* Helpers common across multiple parts of woff2 */
#include <algorithm>
#include "./woff2_common.h"
+#include "./port.h"
+
namespace woff2 {
@@ -25,11 +19,11 @@ uint32_t ComputeULongSum(const uint8_t* buf, size_t size) {
uint32_t checksum = 0;
size_t aligned_size = size & ~3;
for (size_t i = 0; i < aligned_size; i += 4) {
-#if (defined(__BYTE_ORDER__) && (__BYTE_ORDER__ == __ORDER_LITTLE_ENDIAN__))
+#if defined(WOFF_LITTLE_ENDIAN)
uint32_t v = *reinterpret_cast<const uint32_t*>(buf + i);
checksum += (((v & 0xFF) << 24) | ((v & 0xFF00) << 8) |
((v & 0xFF0000) >> 8) | ((v & 0xFF000000) >> 24));
-#elif (defined(__BYTE_ORDER__) && (__BYTE_ORDER__ == __ORDER_BIG_ENDIAN__))
+#elif defined(WOFF_BIG_ENDIAN)
checksum += *reinterpret_cast<const uint32_t*>(buf + i);
#else
checksum += (buf[i] << 24) | (buf[i + 1] << 16) |
diff --git a/Source/ThirdParty/woff2/src/woff2_common.h b/Source/ThirdParty/woff2/src/woff2_common.h
index a8c45af80..51fd4a7bf 100644
--- a/Source/ThirdParty/woff2/src/woff2_common.h
+++ b/Source/ThirdParty/woff2/src/woff2_common.h
@@ -1,18 +1,10 @@
-// Copyright 2014 Google Inc. All Rights Reserved.
-//
-// Licensed under the Apache License, Version 2.0 (the "License");
-// you may not use this file except in compliance with the License.
-// You may obtain a copy of the License at
-//
-// http://www.apache.org/licenses/LICENSE-2.0
-//
-// Unless required by applicable law or agreed to in writing, software
-// distributed under the License is distributed on an "AS IS" BASIS,
-// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-// See the License for the specific language governing permissions and
-// limitations under the License.
-//
-// Common definition for WOFF2 encoding/decoding
+/* Copyright 2014 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/* Common definition for WOFF2 encoding/decoding */
#ifndef WOFF2_WOFF2_COMMON_H_
#define WOFF2_WOFF2_COMMON_H_
diff --git a/Source/ThirdParty/woff2/src/woff2_compress.cc b/Source/ThirdParty/woff2/src/woff2_compress.cc
index e5cf710f7..80e310866 100644
--- a/Source/ThirdParty/woff2/src/woff2_compress.cc
+++ b/Source/ThirdParty/woff2/src/woff2_compress.cc
@@ -1,23 +1,15 @@
-// Copyright 2013 Google Inc. All Rights Reserved.
-//
-// Licensed under the Apache License, Version 2.0 (the "License");
-// you may not use this file except in compliance with the License.
-// You may obtain a copy of the License at
-//
-// http://www.apache.org/licenses/LICENSE-2.0
-//
-// Unless required by applicable law or agreed to in writing, software
-// distributed under the License is distributed on an "AS IS" BASIS,
-// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-// See the License for the specific language governing permissions and
-// limitations under the License.
-//
-// A commandline tool for compressing ttf format files to woff2.
+/* Copyright 2013 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/* A commandline tool for compressing ttf format files to woff2. */
#include <string>
#include "file.h"
-#include "./woff2_enc.h"
+#include <woff2/encode.h>
int main(int argc, char **argv) {
diff --git a/Source/ThirdParty/woff2/src/woff2_dec.cc b/Source/ThirdParty/woff2/src/woff2_dec.cc
index ec75775a0..8186c8e5d 100644
--- a/Source/ThirdParty/woff2/src/woff2_dec.cc
+++ b/Source/ThirdParty/woff2/src/woff2_dec.cc
@@ -1,20 +1,12 @@
-// Copyright 2014 Google Inc. All Rights Reserved.
-//
-// Licensed under the Apache License, Version 2.0 (the "License");
-// you may not use this file except in compliance with the License.
-// You may obtain a copy of the License at
-//
-// http://www.apache.org/licenses/LICENSE-2.0
-//
-// Unless required by applicable law or agreed to in writing, software
-// distributed under the License is distributed on an "AS IS" BASIS,
-// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-// See the License for the specific language governing permissions and
-// limitations under the License.
-//
-// Library for converting WOFF2 format font files to their TTF versions.
-
-#include "./woff2_dec.h"
+/* Copyright 2014 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/* Library for converting WOFF2 format font files to their TTF versions. */
+
+#include <woff2/decode.h>
#include <stdlib.h>
#include <algorithm>
@@ -27,7 +19,7 @@
#include <memory>
#include <utility>
-#include "./decode.h"
+#include <brotli/decode.h>
#include "./buffer.h"
#include "./port.h"
#include "./round.h"
@@ -411,6 +403,14 @@ bool ReconstructGlyf(const uint8_t* data, Table* glyf_table,
return FONT_COMPRESSION_FAILURE();
}
+ // https://dev.w3.org/webfonts/WOFF2/spec/#conform-mustRejectLoca
+ // dst_length here is origLength in the spec
+ uint32_t expected_loca_dst_length = (info->index_format ? 4 : 2)
+ * (static_cast<uint32_t>(info->num_glyphs) + 1);
+ if (PREDICT_FALSE(loca_table->dst_length != expected_loca_dst_length)) {
+ return FONT_COMPRESSION_FAILURE();
+ }
+
unsigned int offset = (2 + kNumSubStreams) * 4;
if (PREDICT_FALSE(offset > glyf_table->transform_length)) {
return FONT_COMPRESSION_FAILURE();
@@ -592,6 +592,14 @@ bool ReconstructGlyf(const uint8_t* data, Table* glyf_table,
instruction_size, glyph_buf.get(), glyph_buf_size, &glyph_size))) {
return FONT_COMPRESSION_FAILURE();
}
+ } else {
+ // n_contours == 0; empty glyph. Must NOT have a bbox.
+ if (PREDICT_FALSE(have_bbox)) {
+#ifdef FONT_COMPRESSION_BIN
+ fprintf(stderr, "Empty glyph has a bbox\n");
+#endif
+ return FONT_COMPRESSION_FAILURE();
+ }
}
loca_values[i] = out->Size() - glyf_start;
@@ -669,6 +677,14 @@ bool ReconstructTransformedHmtx(const uint8_t* transformed_buf,
bool has_proportional_lsbs = (hmtx_flags & 1) == 0;
bool has_monospace_lsbs = (hmtx_flags & 2) == 0;
+ // Bits 2-7 are reserved and MUST be zero.
+ if ((hmtx_flags & 0xFC) != 0) {
+#ifdef FONT_COMPRESSION_BIN
+ fprintf(stderr, "Illegal hmtx flags; bits 2-7 must be 0\n");
+#endif
+ return FONT_COMPRESSION_FAILURE();
+ }
+
// you say you transformed but there is little evidence of it
if (has_proportional_lsbs && has_monospace_lsbs) {
return FONT_COMPRESSION_FAILURE();
@@ -742,9 +758,10 @@ bool ReconstructTransformedHmtx(const uint8_t* transformed_buf,
bool Woff2Uncompress(uint8_t* dst_buf, size_t dst_size,
const uint8_t* src_buf, size_t src_size) {
size_t uncompressed_size = dst_size;
- int ok = BrotliDecompressBuffer(src_size, src_buf,
- &uncompressed_size, dst_buf);
- if (PREDICT_FALSE(!ok || uncompressed_size != dst_size)) {
+ BrotliDecoderResult result = BrotliDecoderDecompress(
+ src_size, src_buf, &uncompressed_size, dst_buf);
+ if (PREDICT_FALSE(result != BROTLI_DECODER_RESULT_SUCCESS ||
+ uncompressed_size != dst_size)) {
return FONT_COMPRESSION_FAILURE();
}
return true;
@@ -875,11 +892,26 @@ bool ReconstructFont(uint8_t* transformed_buf,
std::vector<Table*> tables = Tables(hdr, font_index);
// 'glyf' without 'loca' doesn't make sense
- if (PREDICT_FALSE(static_cast<bool>(FindTable(&tables, kGlyfTableTag)) !=
- static_cast<bool>(FindTable(&tables, kLocaTableTag)))) {
+ const Table* glyf_table = FindTable(&tables, kGlyfTableTag);
+ const Table* loca_table = FindTable(&tables, kLocaTableTag);
+ if (PREDICT_FALSE(static_cast<bool>(glyf_table) !=
+ static_cast<bool>(loca_table))) {
+#ifdef FONT_COMPRESSION_BIN
+ fprintf(stderr, "Cannot have just one of glyf/loca\n");
+#endif
return FONT_COMPRESSION_FAILURE();
}
+ if (glyf_table != NULL) {
+ if (PREDICT_FALSE((glyf_table->flags & kWoff2FlagsTransform)
+ != (loca_table->flags & kWoff2FlagsTransform))) {
+#ifdef FONT_COMPRESSION_BIN
+ fprintf(stderr, "Cannot transform just one of glyf/loca\n");
+#endif
+ return FONT_COMPRESSION_FAILURE();
+ }
+ }
+
uint32_t font_checksum = metadata->header_checksum;
if (hdr->header_version) {
font_checksum = hdr->ttc_fonts[font_index].header_checksum;
@@ -898,7 +930,7 @@ bool ReconstructFont(uint8_t* transformed_buf,
// TODO(user) a collection with optimized hmtx that reused glyf/loca
// would fail. We don't optimize hmtx for collections yet.
- if (PREDICT_FALSE(static_cast<uint64_t>(table.src_offset + table.src_length)
+ if (PREDICT_FALSE(static_cast<uint64_t>(table.src_offset) + table.src_length
> transformed_buf_size)) {
return FONT_COMPRESSION_FAILURE();
}
@@ -1099,8 +1131,9 @@ bool ReadWOFF2Header(const uint8_t* data, size_t length, WOFF2Header* hdr) {
ttc_font.table_indices.resize(num_tables);
- const Table* glyf_table = NULL;
- const Table* loca_table = NULL;
+
+ unsigned int glyf_idx = 0;
+ unsigned int loca_idx = 0;
for (uint32_t j = 0; j < num_tables; j++) {
unsigned int table_idx;
@@ -1112,19 +1145,23 @@ bool ReadWOFF2Header(const uint8_t* data, size_t length, WOFF2Header* hdr) {
const Table& table = hdr->tables[table_idx];
if (table.tag == kLocaTableTag) {
- loca_table = &table;
+ loca_idx = table_idx;
}
if (table.tag == kGlyfTableTag) {
- glyf_table = &table;
+ glyf_idx = table_idx;
}
}
- if (PREDICT_FALSE((glyf_table == NULL) != (loca_table == NULL))) {
+ // if we have both glyf and loca make sure they are consecutive
+ // if we have just one we'll reject the font elsewhere
+ if (glyf_idx > 0 || loca_idx > 0) {
+ if (PREDICT_FALSE(glyf_idx > loca_idx || loca_idx - glyf_idx != 1)) {
#ifdef FONT_COMPRESSION_BIN
- fprintf(stderr, "Cannot have just one of glyf/loca\n");
+ fprintf(stderr, "TTC font %d has non-consecutive glyf/loca\n", i);
#endif
- return FONT_COMPRESSION_FAILURE();
+ return FONT_COMPRESSION_FAILURE();
+ }
}
}
}
@@ -1298,6 +1335,9 @@ bool ConvertWOFF2ToTTF(const uint8_t* data, size_t length,
const uint8_t* src_buf = data + hdr.compressed_offset;
std::vector<uint8_t> uncompressed_buf(hdr.uncompressed_size);
+ if (PREDICT_FALSE(hdr.uncompressed_size < 1)) {
+ return FONT_COMPRESSION_FAILURE();
+ }
if (PREDICT_FALSE(!Woff2Uncompress(&uncompressed_buf[0],
hdr.uncompressed_size, src_buf,
hdr.compressed_length))) {
diff --git a/Source/ThirdParty/woff2/src/woff2_decompress.cc b/Source/ThirdParty/woff2/src/woff2_decompress.cc
index f29c797cb..de088b9ec 100644
--- a/Source/ThirdParty/woff2/src/woff2_decompress.cc
+++ b/Source/ThirdParty/woff2/src/woff2_decompress.cc
@@ -1,24 +1,16 @@
-// Copyright 2013 Google Inc. All Rights Reserved.
-//
-// Licensed under the Apache License, Version 2.0 (the "License");
-// you may not use this file except in compliance with the License.
-// You may obtain a copy of the License at
-//
-// http://www.apache.org/licenses/LICENSE-2.0
-//
-// Unless required by applicable law or agreed to in writing, software
-// distributed under the License is distributed on an "AS IS" BASIS,
-// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-// See the License for the specific language governing permissions and
-// limitations under the License.
-//
-// A very simple commandline tool for decompressing woff2 format files to true
-// type font files.
+/* Copyright 2013 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/* A very simple commandline tool for decompressing woff2 format files to true
+ type font files. */
#include <string>
#include "./file.h"
-#include "./woff2_dec.h"
+#include <woff2/decode.h>
int main(int argc, char **argv) {
@@ -32,6 +24,7 @@ int main(int argc, char **argv) {
string filename(argv[1]);
string outfilename = filename.substr(0, filename.find_last_of(".")) + ".ttf";
+ // Note: update woff2_dec_fuzzer_new_entry.cc if this pattern changes.
string input = woff2::GetFileContent(filename);
const uint8_t* raw_input = reinterpret_cast<const uint8_t*>(input.data());
string output(std::min(woff2::ComputeWOFF2FinalSize(raw_input, input.size()),
diff --git a/Source/ThirdParty/woff2/src/woff2_enc.cc b/Source/ThirdParty/woff2/src/woff2_enc.cc
index d100ad51b..ec00878bc 100644
--- a/Source/ThirdParty/woff2/src/woff2_enc.cc
+++ b/Source/ThirdParty/woff2/src/woff2_enc.cc
@@ -1,20 +1,12 @@
-// Copyright 2014 Google Inc. All Rights Reserved.
-//
-// Licensed under the Apache License, Version 2.0 (the "License");
-// you may not use this file except in compliance with the License.
-// You may obtain a copy of the License at
-//
-// http://www.apache.org/licenses/LICENSE-2.0
-//
-// Unless required by applicable law or agreed to in writing, software
-// distributed under the License is distributed on an "AS IS" BASIS,
-// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-// See the License for the specific language governing permissions and
-// limitations under the License.
-//
-// Library for converting TTF format font files to their WOFF2 versions.
-
-#include "./woff2_enc.h"
+/* Copyright 2014 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/* Library for converting TTF format font files to their WOFF2 versions. */
+
+#include <woff2/encode.h>
#include <stdlib.h>
#include <complex>
@@ -23,7 +15,7 @@
#include <string>
#include <vector>
-#include "./compressor.h"
+#include <brotli/encode.h>
#include "./buffer.h"
#include "./font.h"
#include "./normalize.h"
@@ -34,7 +26,6 @@
#include "./variable_length.h"
#include "./woff2_common.h"
-
namespace woff2 {
namespace {
@@ -47,16 +38,11 @@ using std::vector;
const size_t kWoff2HeaderSize = 48;
const size_t kWoff2EntrySize = 20;
-
-bool Compress(const uint8_t* data, const size_t len,
- uint8_t* result, uint32_t* result_len,
- brotli::BrotliParams::Mode mode, int quality) {
+bool Compress(const uint8_t* data, const size_t len, uint8_t* result,
+ uint32_t* result_len, BrotliEncoderMode mode, int quality) {
size_t compressed_len = *result_len;
- brotli::BrotliParams params;
- params.mode = mode;
- params.quality = quality;
- if (brotli::BrotliCompressBuffer(params, len, data, &compressed_len, result)
- == 0) {
+ if (BrotliEncoderCompress(quality, BROTLI_DEFAULT_WINDOW, mode, len, data,
+ &compressed_len, result) == 0) {
return false;
}
*result_len = compressed_len;
@@ -67,14 +53,14 @@ bool Woff2Compress(const uint8_t* data, const size_t len,
uint8_t* result, uint32_t* result_len,
int quality) {
return Compress(data, len, result, result_len,
- brotli::BrotliParams::MODE_FONT, quality);
+ BROTLI_MODE_FONT, quality);
}
bool TextCompress(const uint8_t* data, const size_t len,
uint8_t* result, uint32_t* result_len,
int quality) {
return Compress(data, len, result, result_len,
- brotli::BrotliParams::MODE_TEXT, quality);
+ BROTLI_MODE_TEXT, quality);
}
int KnownTableIndex(uint32_t tag) {
@@ -111,7 +97,8 @@ size_t TableEntrySize(const Table& table) {
size_t ComputeWoff2Length(const FontCollection& font_collection,
const std::vector<Table>& tables,
- std::map<uint32_t, uint16_t> index_by_offset,
+ std::map<std::pair<uint32_t, uint32_t>, uint16_t>
+ index_by_tag_offset,
size_t compressed_data_length,
size_t extended_metadata_length) {
size_t size = kWoff2HeaderSize;
@@ -134,7 +121,8 @@ size_t ComputeWoff2Length(const FontCollection& font_collection,
// no collection entry for xform table
if (table.tag & 0x80808080) continue;
- uint16_t table_index = index_by_offset[table.offset];
+ std::pair<uint32_t, uint32_t> tag_offset(table.tag, table.offset);
+ uint16_t table_index = index_by_tag_offset[tag_offset];
size += Size255UShort(table_index); // 255UInt16 index entry
}
}
@@ -326,7 +314,7 @@ bool ConvertTTFToWOFF2(const uint8_t *data, size_t length,
}
std::vector<Table> tables;
- std::map<uint32_t, uint16_t> index_by_offset;
+ std::map<std::pair<uint32_t, uint32_t>, uint16_t> index_by_tag_offset;
for (const auto& font : font_collection.fonts) {
@@ -336,8 +324,9 @@ bool ConvertTTFToWOFF2(const uint8_t *data, size_t length,
continue;
}
- if (index_by_offset.find(src_table.offset) == index_by_offset.end()) {
- index_by_offset[src_table.offset] = tables.size();
+ std::pair<uint32_t, uint32_t> tag_offset(src_table.tag, src_table.offset);
+ if (index_by_tag_offset.find(tag_offset) == index_by_tag_offset.end()) {
+ index_by_tag_offset[tag_offset] = tables.size();
} else {
return false;
}
@@ -362,7 +351,8 @@ bool ConvertTTFToWOFF2(const uint8_t *data, size_t length,
}
size_t woff2_length = ComputeWoff2Length(font_collection, tables,
- index_by_offset, total_compressed_length, compressed_metadata_buf_length);
+ index_by_tag_offset, total_compressed_length,
+ compressed_metadata_buf_length);
if (woff2_length > *result_length) {
#ifdef FONT_COMPRESSION_BIN
fprintf(stderr, "Result allocation was too small (%zd vs %zd bytes).\n",
@@ -435,14 +425,15 @@ bool ConvertTTFToWOFF2(const uint8_t *data, size_t length,
table.IsReused() ? table.reuse_of->offset : table.offset;
uint32_t table_length =
table.IsReused() ? table.reuse_of->length : table.length;
- if (index_by_offset.find(table_offset) == index_by_offset.end()) {
+ std::pair<uint32_t, uint32_t> tag_offset(table.tag, table_offset);
+ if (index_by_tag_offset.find(tag_offset) == index_by_tag_offset.end()) {
#ifdef FONT_COMPRESSION_BIN
- fprintf(stderr, "Missing table index for offset 0x%08x\n",
+fprintf(stderr, "Missing table index for offset 0x%08x\n",
table_offset);
#endif
return FONT_COMPRESSION_FAILURE();
}
- uint16_t index = index_by_offset[table_offset];
+ uint16_t index = index_by_tag_offset[tag_offset];
Store255UShort(index, &offset, result);
}
diff --git a/Source/ThirdParty/woff2/src/woff2_info.cc b/Source/ThirdParty/woff2/src/woff2_info.cc
new file mode 100644
index 000000000..2b51adcb6
--- /dev/null
+++ b/Source/ThirdParty/woff2/src/woff2_info.cc
@@ -0,0 +1,144 @@
+/* Copyright 2014 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/* A commandline tool for dumping info about a woff2 file. */
+
+#include <string>
+
+#include "file.h"
+#include "./woff2_common.h"
+#include "./buffer.h"
+#include "./font.h"
+#include "./table_tags.h"
+#include "./variable_length.h"
+
+std::string PrintTag(int tag) {
+ if (tag & 0x80808080) {
+ return std::string("_xfm"); // print _xfm for xform tables (else garbage)
+ }
+ char printable[] = {
+ static_cast<char>((tag >> 24) & 0xFF),
+ static_cast<char>((tag >> 16) & 0xFF),
+ static_cast<char>((tag >> 8) & 0xFF),
+ static_cast<char>(tag & 0xFF)
+ };
+ return std::string(printable, 4);
+}
+
+int main(int argc, char **argv) {
+ using std::string;
+
+ if (argc != 2) {
+ fprintf(stderr, "One argument, the input filename, must be provided.\n");
+ return 1;
+ }
+
+ string filename(argv[1]);
+ string outfilename = filename.substr(0, filename.find_last_of(".")) + ".woff2";
+ fprintf(stdout, "Processing %s => %s\n",
+ filename.c_str(), outfilename.c_str());
+ string input = woff2::GetFileContent(filename);
+
+ woff2::Buffer file(reinterpret_cast<const uint8_t*>(input.data()),
+ input.size());
+
+ printf("WOFF2Header\n");
+ uint32_t signature, flavor, length, totalSfntSize, totalCompressedSize;
+ uint32_t metaOffset, metaLength, metaOrigLength, privOffset, privLength;
+ uint16_t num_tables, reserved, major, minor;
+ if (!file.ReadU32(&signature)) return 1;
+ if (!file.ReadU32(&flavor)) return 1;
+ if (!file.ReadU32(&length)) return 1;
+ if (!file.ReadU16(&num_tables)) return 1;
+ if (!file.ReadU16(&reserved)) return 1;
+ if (!file.ReadU32(&totalSfntSize)) return 1;
+ if (!file.ReadU32(&totalCompressedSize)) return 1;
+ if (!file.ReadU16(&major)) return 1;
+ if (!file.ReadU16(&minor)) return 1;
+ if (!file.ReadU32(&metaOffset)) return 1;
+ if (!file.ReadU32(&metaLength)) return 1;
+ if (!file.ReadU32(&metaOrigLength)) return 1;
+ if (!file.ReadU32(&privOffset)) return 1;
+ if (!file.ReadU32(&privLength)) return 1;
+
+ if (signature != 0x774F4632) {
+ printf("Invalid signature: %08x\n", signature);
+ return 1;
+ }
+ printf("signature 0x%08x\n", signature);
+ printf("flavor 0x%08x\n", flavor);
+ printf("length %d\n", length);
+ printf("numTables %d\n", num_tables);
+ printf("reserved %d\n", reserved);
+ printf("totalSfntSize %d\n", totalSfntSize);
+ printf("totalCompressedSize %d\n", totalCompressedSize);
+ printf("majorVersion %d\n", major);
+ printf("minorVersion %d\n", minor);
+ printf("metaOffset %d\n", metaOffset);
+ printf("metaLength %d\n", metaLength);
+ printf("metaOrigLength %d\n", metaOrigLength);
+ printf("privOffset %d\n", privOffset);
+ printf("privLength %d\n", privLength);
+
+ std::vector<uint32_t> table_tags;
+ printf("TableDirectory starts at +%zu\n", file.offset());
+ printf("Entry offset flags tag origLength txLength\n");
+ for (auto i = 0; i < num_tables; i++) {
+ size_t offset = file.offset();
+ uint8_t flags;
+ uint32_t tag, origLength, transformLength;
+ if (!file.ReadU8(&flags)) return 1;
+ if ((flags & 0x3f) == 0x3f) {
+ if (!file.ReadU32(&tag)) return 1;
+ } else {
+ tag = woff2::kKnownTags[flags & 0x3f];
+ }
+ table_tags.push_back(tag);
+ if (!ReadBase128(&file, &origLength)) return 1;
+
+ printf("%5d %6zu 0x%02x %s %10d", i, offset, flags,
+ PrintTag(tag).c_str(), origLength);
+
+ uint8_t xform_version = (flags >> 6) & 0x3;
+ if (tag == woff2::kGlyfTableTag || tag == woff2::kLocaTableTag) {
+ if (xform_version == 0) {
+ if (!ReadBase128(&file, &transformLength)) return 1;
+ printf(" %8d", transformLength);
+ }
+ } else if (xform_version > 0) {
+ if (!ReadBase128(&file, &transformLength)) return 1;
+ printf(" %8d", transformLength);
+ }
+ printf("\n");
+ }
+
+ // Collection header
+ if (flavor == woff2::kTtcFontFlavor) {
+ uint32_t version, numFonts;
+ if (!file.ReadU32(&version)) return 1;
+ if (!woff2::Read255UShort(&file, &numFonts)) return 1;
+ printf("CollectionHeader 0x%08x %d fonts\n", version, numFonts);
+
+ for (auto i = 0; i < numFonts; i++) {
+ uint32_t numTables, flavor;
+ if (!woff2::Read255UShort(&file, &numTables)) return 1;
+ if (!file.ReadU32(&flavor)) return 1;
+ printf("CollectionFontEntry %d flavor 0x%08x %d tables\n", i, flavor,
+ numTables);
+ for (auto j = 0; j < numTables; j++) {
+ uint32_t table_idx;
+ if (!woff2::Read255UShort(&file, &table_idx)) return 1;
+ if (table_idx >= table_tags.size()) return 1;
+ printf(" %d %s (idx %d)\n", j,
+ PrintTag(table_tags[table_idx]).c_str(), table_idx);
+ }
+ }
+ }
+
+ printf("TableDirectory ends at +%zu\n", file.offset());
+
+ return 0;
+}
diff --git a/Source/ThirdParty/woff2/src/woff2_out.cc b/Source/ThirdParty/woff2/src/woff2_out.cc
index 888230644..8ab32681f 100644
--- a/Source/ThirdParty/woff2/src/woff2_out.cc
+++ b/Source/ThirdParty/woff2/src/woff2_out.cc
@@ -1,20 +1,14 @@
-// Copyright 2014 Google Inc. All Rights Reserved.
-//
-// Licensed under the Apache License, Version 2.0 (the "License");
-// you may not use this file except in compliance with the License.
-// You may obtain a copy of the License at
-//
-// http://www.apache.org/licenses/LICENSE-2.0
-//
-// Unless required by applicable law or agreed to in writing, software
-// distributed under the License is distributed on an "AS IS" BASIS,
-// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-// See the License for the specific language governing permissions and
-// limitations under the License.
-//
-// Output buffer for WOFF2 decompression.
+/* Copyright 2014 Google Inc. All Rights Reserved.
-#include "./woff2_out.h"
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/* Output buffer for WOFF2 decompression. */
+
+#include <woff2/output.h>
+
+using std::string;
namespace woff2 {
diff --git a/Source/ThirdParty/woff2/update.sh b/Source/ThirdParty/woff2/update.sh
index c67cb43f1..7e15f564f 100755
--- a/Source/ThirdParty/woff2/update.sh
+++ b/Source/ThirdParty/woff2/update.sh
@@ -10,8 +10,9 @@ git clone https://github.com/google/woff2 ${MY_TEMP_DIR}/woff2
COMMIT=`(cd ${MY_TEMP_DIR}/woff2 && git log | head -n 1)`
perl -p -i -e "s/\[commit [0-9a-f]{40}\]/[${COMMIT}]/" README.webkit;
-rm -rf src
+rm -rf src include
mv ${MY_TEMP_DIR}/woff2/src src
+mv ${MY_TEMP_DIR}/woff2/include include
rm -rf ${MY_TEMP_DIR}
echo "###"