diff options
Diffstat (limited to 'src/cmd')
272 files changed, 12655 insertions, 11301 deletions
diff --git a/src/cmd/asm/internal/asm/testdata/arm64.s b/src/cmd/asm/internal/asm/testdata/arm64.s index 5a6db05074..e106ff2ae1 100644 --- a/src/cmd/asm/internal/asm/testdata/arm64.s +++ b/src/cmd/asm/internal/asm/testdata/arm64.s @@ -145,6 +145,37 @@ TEXT foo(SB), DUPOK|NOSPLIT, $-8 VZIP2 V10.D2, V13.D2, V3.D2 // a379ca4e VZIP1 V17.S2, V4.S2, V26.S2 // 9a38910e VZIP2 V25.S2, V14.S2, V25.S2 // d979990e + VUXTL V30.B8, V30.H8 // dea7082f + VUXTL V30.H4, V29.S4 // dda7102f + VUXTL V29.S2, V2.D2 // a2a7202f + VUXTL2 V30.H8, V30.S4 // dea7106f + VUXTL2 V29.S4, V2.D2 // a2a7206f + VUXTL2 V30.B16, V2.H8 // c2a7086f + VBIT V21.B16, V25.B16, V4.B16 // 241fb56e + VBSL V23.B16, V3.B16, V7.B16 // 671c776e + VCMTST V2.B8, V29.B8, V2.B8 // a28f220e + VCMTST V2.D2, V23.D2, V3.D2 // e38ee24e + VSUB V2.B8, V30.B8, V30.B8 // de87222e + VUZP1 V0.B8, V30.B8, V1.B8 // c11b000e + VUZP1 V1.B16, V29.B16, V2.B16 // a21b014e + VUZP1 V2.H4, V28.H4, V3.H4 // 831b420e + VUZP1 V3.H8, V27.H8, V4.H8 // 641b434e + VUZP1 V28.S2, V2.S2, V5.S2 // 45189c0e + VUZP1 V29.S4, V1.S4, V6.S4 // 26189d4e + VUZP1 V30.D2, V0.D2, V7.D2 // 0718de4e + VUZP2 V0.D2, V30.D2, V1.D2 // c15bc04e + VUZP2 V30.D2, V0.D2, V29.D2 // 1d58de4e + VUSHLL $0, V30.B8, V30.H8 // dea7082f + VUSHLL $0, V30.H4, V29.S4 // dda7102f + VUSHLL $0, V29.S2, V2.D2 // a2a7202f + VUSHLL2 $0, V30.B16, V2.H8 // c2a7086f + VUSHLL2 $0, V30.H8, V30.S4 // dea7106f + VUSHLL2 $0, V29.S4, V2.D2 // a2a7206f + VUSHLL $7, V30.B8, V30.H8 // dea70f2f + VUSHLL $15, V30.H4, V29.S4 // dda71f2f + VUSHLL2 $31, V30.S4, V2.D2 // c2a73f6f + VBIF V0.B8, V30.B8, V1.B8 // c11fe02e + VBIF V30.B16, V0.B16, V2.B16 // 021cfe6e MOVD (R2)(R6.SXTW), R4 // 44c866f8 MOVD (R3)(R6), R5 // MOVD (R3)(R6*1), R5 // 656866f8 MOVD (R2)(R6), R4 // MOVD (R2)(R6*1), R4 // 446866f8 @@ -186,6 +217,10 @@ TEXT foo(SB), DUPOK|NOSPLIT, $-8 FMOVS $(0.96875), F3 // 03f02d1e FMOVD $(28.0), F4 // 0490671e +// move a large constant to a Vd. + FMOVD $0x8040201008040201, V20 // FMOVD $-9205322385119247871, V20 + FMOVQ $0x8040201008040202, V29 // FMOVQ $-9205322385119247870, V29 + FMOVS (R2)(R6), F4 // FMOVS (R2)(R6*1), F4 // 446866bc FMOVS (R2)(R6<<2), F4 // 447866bc FMOVD (R2)(R6), F4 // FMOVD (R2)(R6*1), F4 // 446866fc @@ -359,18 +394,22 @@ TEXT foo(SB), DUPOK|NOSPLIT, $-8 VLD4 (R15), [V10.H4, V11.H4, V12.H4, V13.H4] // ea05400c VLD4.P 32(R24), [V31.B8, V0.B8, V1.B8, V2.B8] // 1f03df0c VLD4.P (R13)(R9), [V14.S2, V15.S2, V16.S2, V17.S2] // VLD4.P (R13)(R9*1), [V14.S2,V15.S2,V16.S2,V17.S2] // ae09c90c - VLD1R (R0), [V0.B16] // 00c0404d - VLD1R.P 16(R0), [V0.B16] // 00c0df4d - VLD1R.P (R15)(R1), [V15.H4] // VLD1R.P (R15)(R1*1), [V15.H4] // efc5c10d - VLD2R (R15), [V15.H4, V16.H4] // efc5600d - VLD2R.P 32(R0), [V0.D2, V1.D2] // 00ccff4d - VLD2R.P (R0)(R5), [V31.D1, V0.D1] // VLD2R.P (R0)(R5*1), [V31.D1, V0.D1] // 1fcce50d - VLD3R (RSP), [V31.S2, V0.S2, V1.S2] // ffeb400d - VLD3R.P 24(R15), [V15.H4, V16.H4, V17.H4] // efe5df0d - VLD3R.P (R15)(R6), [V15.H8, V16.H8, V17.H8] // VLD3R.P (R15)(R6*1), [V15.H8, V16.H8, V17.H8] // efe5c64d - VLD4R (R0), [V0.B8, V1.B8, V2.B8, V3.B8] // 00e0600d - VLD4R.P 64(RSP), [V31.S4, V0.S4, V1.S4, V2.S4] // ffebff4d - VLD4R.P (R15)(R9), [V15.H4, V16.H4, V17.H4, V18.H4] // VLD4R.P (R15)(R9*1), [V15.H4, V16.H4, V17.H4, V18.H4] // efe5e90d + VLD1R (R1), [V9.B8] // 29c0400d + VLD1R.P (R1), [V9.B8] // 29c0df0d + VLD1R.P 1(R1), [V2.B8] // 22c0df0d + VLD1R.P 2(R1), [V2.H4] // 22c4df0d + VLD1R (R0), [V0.B16] // 00c0404d + VLD1R.P (R0), [V0.B16] // 00c0df4d + VLD1R.P (R15)(R1), [V15.H4] // VLD1R.P (R15)(R1*1), [V15.H4] // efc5c10d + VLD2R (R15), [V15.H4, V16.H4] // efc5600d + VLD2R.P 16(R0), [V0.D2, V1.D2] // 00ccff4d + VLD2R.P (R0)(R5), [V31.D1, V0.D1] // VLD2R.P (R0)(R5*1), [V31.D1, V0.D1] // 1fcce50d + VLD3R (RSP), [V31.S2, V0.S2, V1.S2] // ffeb400d + VLD3R.P 6(R15), [V15.H4, V16.H4, V17.H4] // efe5df0d + VLD3R.P (R15)(R6), [V15.H8, V16.H8, V17.H8] // VLD3R.P (R15)(R6*1), [V15.H8, V16.H8, V17.H8] // efe5c64d + VLD4R (R0), [V0.B8, V1.B8, V2.B8, V3.B8] // 00e0600d + VLD4R.P 16(RSP), [V31.S4, V0.S4, V1.S4, V2.S4] // ffebff4d + VLD4R.P (R15)(R9), [V15.H4, V16.H4, V17.H4, V18.H4] // VLD4R.P (R15)(R9*1), [V15.H4, V16.H4, V17.H4, V18.H4] // efe5e90d VST1.P [V24.S2], 8(R2) // 58789f0c VST1 [V29.S2, V30.S2], (R29) // bdab000c VST1 [V14.H4, V15.H4, V16.H4], (R27) // 6e67000c diff --git a/src/cmd/asm/internal/asm/testdata/arm64enc.s b/src/cmd/asm/internal/asm/testdata/arm64enc.s index 56cf51c303..e802ee76f5 100644 --- a/src/cmd/asm/internal/asm/testdata/arm64enc.s +++ b/src/cmd/asm/internal/asm/testdata/arm64enc.s @@ -591,7 +591,7 @@ TEXT asmtest(SB),DUPOK|NOSPLIT,$-8 FMOVS R8, F15 // 0f01271e FMOVD F2, F9 // 4940601e FMOVS F4, F27 // 9b40201e - //TODO VFMOV $3.125, V8.2D // 28f5006f + //TODO VFMOV $3.125, V8.D2 // 28f5006f FMSUBS F13, F21, F13, F19 // b3d50d1f FMSUBD F11, F7, F15, F31 // ff9d4b1f //TODO VFMUL V9.S[2], F21, F19 // b39a895f @@ -648,7 +648,7 @@ TEXT asmtest(SB),DUPOK|NOSPLIT,$-8 FSUBS F25, F23, F0 // e03a391e FSUBD F11, F13, F24 // b8396b1e //TODO SCVTFSS F30, F20 // d4db215e - //TODO VSCVTF V7.2S, V17.2S // f1d8210e + //TODO VSCVTF V7.S2, V17.S2 // f1d8210e SCVTFWS R3, F16 // 7000221e SCVTFWD R20, F4 // 8402621e SCVTFS R16, F12 // 0c02229e diff --git a/src/cmd/asm/internal/asm/testdata/arm64error.s b/src/cmd/asm/internal/asm/testdata/arm64error.s index 0661a474b4..20b1f3e9f0 100644 --- a/src/cmd/asm/internal/asm/testdata/arm64error.s +++ b/src/cmd/asm/internal/asm/testdata/arm64error.s @@ -339,4 +339,18 @@ TEXT errors(SB),$0 MRS ICV_EOIR1_EL1, R3 // ERROR "system register is not readable" MRS PMSWINC_EL0, R3 // ERROR "system register is not readable" MRS OSLAR_EL1, R3 // ERROR "system register is not readable" + VLD3R.P 24(R15), [V15.H4,V16.H4,V17.H4] // ERROR "invalid post-increment offset" + VBIT V1.H4, V12.H4, V3.H4 // ERROR "invalid arrangement" + VBSL V1.D2, V12.D2, V3.D2 // ERROR "invalid arrangement" + VUXTL V30.D2, V30.H8 // ERROR "operand mismatch" + VUXTL2 V20.B8, V21.H8 // ERROR "operand mismatch" + VUXTL V3.D2, V4.B8 // ERROR "operand mismatch" + VUZP1 V0.B8, V30.B8, V1.B16 // ERROR "operand mismatch" + VUZP2 V0.Q1, V30.Q1, V1.Q1 // ERROR "invalid arrangement" + VUSHLL $0, V30.D2, V30.H8 // ERROR "operand mismatch" + VUSHLL2 $0, V20.B8, V21.H8 // ERROR "operand mismatch" + VUSHLL $8, V30.B8, V30.H8 // ERROR "shift amount out of range" + VUSHLL2 $32, V30.S4, V2.D2 // ERROR "shift amount out of range" + VBIF V0.B8, V1.B8, V2.B16 // ERROR "operand mismatch" + VBIF V0.D2, V1.D2, V2.D2 // ERROR "invalid arrangement" RET diff --git a/src/cmd/cgo/doc.go b/src/cmd/cgo/doc.go index ca18c45d9d..b3f371b08c 100644 --- a/src/cmd/cgo/doc.go +++ b/src/cmd/cgo/doc.go @@ -112,6 +112,13 @@ The default C and C++ compilers may be changed by the CC and CXX environment variables, respectively; those environment variables may include command line options. +The cgo tool will always invoke the C compiler with the source file's +directory in the include path; i.e. -I${SRCDIR} is always implied. This +means that if a header file foo/bar.h exists both in the source +directory and also in the system include directory (or some other place +specified by a -I flag), then "#include <foo/bar.h>" will always find the +local version in preference to any other version. + The cgo tool is enabled by default for native builds on systems where it is expected to work. It is disabled by default when cross-compiling. You can control this by setting the CGO_ENABLED diff --git a/src/cmd/cgo/gcc.go b/src/cmd/cgo/gcc.go index a59534ebd0..9179b5490e 100644 --- a/src/cmd/cgo/gcc.go +++ b/src/cmd/cgo/gcc.go @@ -369,7 +369,18 @@ func (p *Package) guessKinds(f *File) []*Name { fmt.Fprintf(&b, "#line 1 \"completed\"\n"+ "int __cgo__1 = __cgo__2;\n") - stderr := p.gccErrors(b.Bytes()) + // We need to parse the output from this gcc command, so ensure that it + // doesn't have any ANSI escape sequences in it. (TERM=dumb is + // insufficient; if the user specifies CGO_CFLAGS=-fdiagnostics-color, + // GCC will ignore TERM, and GCC can also be configured at compile-time + // to ignore TERM.) + stderr := p.gccErrors(b.Bytes(), "-fdiagnostics-color=never") + if strings.Contains(stderr, "unrecognized command line option") { + // We're using an old version of GCC that doesn't understand + // -fdiagnostics-color. Those versions can't print color anyway, + // so just rerun without that option. + stderr = p.gccErrors(b.Bytes()) + } if stderr == "" { fatalf("%s produced no output\non input:\n%s", p.gccBaseCmd()[0], b.Bytes()) } @@ -1970,22 +1981,25 @@ func (p *Package) gccDefines(stdin []byte) string { // gccErrors runs gcc over the C program stdin and returns // the errors that gcc prints. That is, this function expects // gcc to fail. -func (p *Package) gccErrors(stdin []byte) string { +func (p *Package) gccErrors(stdin []byte, extraArgs ...string) string { // TODO(rsc): require failure args := p.gccCmd() // Optimization options can confuse the error messages; remove them. - nargs := make([]string, 0, len(args)) + nargs := make([]string, 0, len(args)+len(extraArgs)) for _, arg := range args { if !strings.HasPrefix(arg, "-O") { nargs = append(nargs, arg) } } - // Force -O0 optimization but keep the trailing "-" at the end. - nargs = append(nargs, "-O0") - nl := len(nargs) - nargs[nl-2], nargs[nl-1] = nargs[nl-1], nargs[nl-2] + // Force -O0 optimization and append extra arguments, but keep the + // trailing "-" at the end. + li := len(nargs) - 1 + last := nargs[li] + nargs[li] = "-O0" + nargs = append(nargs, extraArgs...) + nargs = append(nargs, last) if *debugGcc { fmt.Fprintf(os.Stderr, "$ %s <<EOF\n", strings.Join(nargs, " ")) diff --git a/src/cmd/compile/internal/amd64/ssa.go b/src/cmd/compile/internal/amd64/ssa.go index 9d8a0920b3..4ac877986c 100644 --- a/src/cmd/compile/internal/amd64/ssa.go +++ b/src/cmd/compile/internal/amd64/ssa.go @@ -319,8 +319,8 @@ func ssaGenValue(s *gc.SSAGenState, v *ssa.Value) { // TODO(khr): issue only the -1 fixup code we need. // For instance, if only the quotient is used, no point in zeroing the remainder. - j1.To.Val = n1 - j2.To.Val = s.Pc() + j1.To.SetTarget(n1) + j2.To.SetTarget(s.Pc()) } case ssa.OpAMD64HMULQ, ssa.OpAMD64HMULL, ssa.OpAMD64HMULQU, ssa.OpAMD64HMULLU: diff --git a/src/cmd/compile/internal/arm64/ssa.go b/src/cmd/compile/internal/arm64/ssa.go index b6bb81a847..1d6ea6b9d8 100644 --- a/src/cmd/compile/internal/arm64/ssa.go +++ b/src/cmd/compile/internal/arm64/ssa.go @@ -816,7 +816,7 @@ func ssaGenValue(s *gc.SSAGenState, v *ssa.Value) { } p := s.Prog(v.Op.Asm()) p.From.Type = obj.TYPE_REG // assembler encodes conditional bits in Reg - p.From.Reg = condBits[v.Aux.(ssa.Op)] + p.From.Reg = condBits[ssa.Op(v.AuxInt)] p.Reg = v.Args[0].Reg() p.SetFrom3(obj.Addr{Type: obj.TYPE_REG, Reg: r1}) p.To.Type = obj.TYPE_REG diff --git a/src/cmd/compile/internal/gc/alg.go b/src/cmd/compile/internal/gc/alg.go index e2e2374717..c9d71ea00b 100644 --- a/src/cmd/compile/internal/gc/alg.go +++ b/src/cmd/compile/internal/gc/alg.go @@ -429,8 +429,7 @@ func hashfor(t *types.Type) *Node { } n := newname(sym) - n.SetClass(PFUNC) - n.Sym.SetFunc(true) + setNodeNameFunc(n) n.Type = functype(nil, []*Node{ anonfield(types.NewPtr(t)), anonfield(types.Types[TUINTPTR]), @@ -646,17 +645,11 @@ func geneq(t *types.Type) *obj.LSym { // Build a list of conditions to satisfy. // The conditions are a list-of-lists. Conditions are reorderable // within each inner list. The outer lists must be evaluated in order. - // Even within each inner list, track their order so that we can preserve - // aspects of that order. (TODO: latter part needed?) - type nodeIdx struct { - n *Node - idx int - } - var conds [][]nodeIdx - conds = append(conds, []nodeIdx{}) + var conds [][]*Node + conds = append(conds, []*Node{}) and := func(n *Node) { i := len(conds) - 1 - conds[i] = append(conds[i], nodeIdx{n: n, idx: len(conds[i])}) + conds[i] = append(conds[i], n) } // Walk the struct using memequal for runs of AMEM @@ -674,7 +667,7 @@ func geneq(t *types.Type) *obj.LSym { if !IsRegularMemory(f.Type) { if EqCanPanic(f.Type) { // Enforce ordering by starting a new set of reorderable conditions. - conds = append(conds, []nodeIdx{}) + conds = append(conds, []*Node{}) } p := nodSym(OXDOT, np, f.Sym) q := nodSym(OXDOT, nq, f.Sym) @@ -688,7 +681,7 @@ func geneq(t *types.Type) *obj.LSym { } if EqCanPanic(f.Type) { // Also enforce ordering after something that can panic. - conds = append(conds, []nodeIdx{}) + conds = append(conds, []*Node{}) } i++ continue @@ -713,14 +706,13 @@ func geneq(t *types.Type) *obj.LSym { // Sort conditions to put runtime calls last. // Preserve the rest of the ordering. - var flatConds []nodeIdx + var flatConds []*Node for _, c := range conds { + isCall := func(n *Node) bool { + return n.Op == OCALL || n.Op == OCALLFUNC + } sort.SliceStable(c, func(i, j int) bool { - x, y := c[i], c[j] - if (x.n.Op != OCALL) == (y.n.Op != OCALL) { - return x.idx < y.idx - } - return x.n.Op != OCALL + return !isCall(c[i]) && isCall(c[j]) }) flatConds = append(flatConds, c...) } @@ -729,9 +721,9 @@ func geneq(t *types.Type) *obj.LSym { if len(flatConds) == 0 { cond = nodbool(true) } else { - cond = flatConds[0].n + cond = flatConds[0] for _, c := range flatConds[1:] { - cond = nod(OANDAND, cond, c.n) + cond = nod(OANDAND, cond, c) } } diff --git a/src/cmd/compile/internal/gc/closure.go b/src/cmd/compile/internal/gc/closure.go index 23e48939b4..250be38e5b 100644 --- a/src/cmd/compile/internal/gc/closure.go +++ b/src/cmd/compile/internal/gc/closure.go @@ -107,18 +107,7 @@ func typecheckclosure(clo *Node, top int) { } xfunc.Func.Nname.Sym = closurename(Curfn) - disableExport(xfunc.Func.Nname.Sym) - if xfunc.Func.Nname.Sym.Def != nil { - // The only case we can reach here is when the outer function was redeclared. - // In that case, don't bother to redeclare the closure. Otherwise, we will get - // a spurious error message, see #17758. While we are here, double check that - // we already reported other error. - if nsavederrors+nerrors == 0 { - Fatalf("unexpected symbol collision %v", xfunc.Func.Nname.Sym) - } - } else { - declare(xfunc.Func.Nname, PFUNC) - } + setNodeNameFunc(xfunc.Func.Nname) xfunc = typecheck(xfunc, ctxStmt) // Type check the body now, but only if we're inside a function. @@ -473,7 +462,6 @@ func makepartialcall(fn *Node, t0 *types.Type, meth *types.Sym) *Node { tfn.List.Set(structargs(t0.Params(), true)) tfn.Rlist.Set(structargs(t0.Results(), false)) - disableExport(sym) xfunc := dclfunc(sym, tfn) xfunc.Func.SetDupok(true) xfunc.Func.SetNeedctxt(true) diff --git a/src/cmd/compile/internal/gc/dcl.go b/src/cmd/compile/internal/gc/dcl.go index cd64d9a7bf..69eb13f607 100644 --- a/src/cmd/compile/internal/gc/dcl.go +++ b/src/cmd/compile/internal/gc/dcl.go @@ -90,7 +90,7 @@ func declare(n *Node, ctxt Class) { lineno = n.Pos Fatalf("automatic outside function") } - if Curfn != nil { + if Curfn != nil && ctxt != PFUNC { Curfn.Func.Dcl = append(Curfn.Func.Dcl, n) } if n.Op == OTYPE { @@ -297,6 +297,16 @@ func oldname(s *types.Sym) *Node { return n } +// importName is like oldname, but it reports an error if sym is from another package and not exported. +func importName(sym *types.Sym) *Node { + n := oldname(sym) + if !types.IsExported(sym.Name) && sym.Pkg != localpkg { + n.SetDiag(true) + yyerror("cannot refer to unexported name %s.%s", sym.Pkg.Name, sym.Name) + } + return n +} + // := declarations func colasname(n *Node) bool { switch n.Op { @@ -975,10 +985,14 @@ func makefuncsym(s *types.Sym) { } } -// disableExport prevents sym from being included in package export -// data. To be effectual, it must be called before declare. -func disableExport(sym *types.Sym) { - sym.SetOnExportList(true) +// setNodeNameFunc marks a node as a function. +func setNodeNameFunc(n *Node) { + if n.Op != ONAME || n.Class() != Pxxx { + Fatalf("expected ONAME/Pxxx node, got %v", n) + } + + n.SetClass(PFUNC) + n.Sym.SetFunc(true) } func dclfunc(sym *types.Sym, tfn *Node) *Node { @@ -990,7 +1004,7 @@ func dclfunc(sym *types.Sym, tfn *Node) *Node { fn.Func.Nname = newfuncnamel(lineno, sym) fn.Func.Nname.Name.Defn = fn fn.Func.Nname.Name.Param.Ntype = tfn - declare(fn.Func.Nname, PFUNC) + setNodeNameFunc(fn.Func.Nname) funchdr(fn) fn.Func.Nname.Name.Param.Ntype = typecheck(fn.Func.Nname.Name.Param.Ntype, ctxType) return fn diff --git a/src/cmd/compile/internal/gc/esc.go b/src/cmd/compile/internal/gc/esc.go index 4b843aba35..375331d1f5 100644 --- a/src/cmd/compile/internal/gc/esc.go +++ b/src/cmd/compile/internal/gc/esc.go @@ -377,7 +377,7 @@ func (e *Escape) paramTag(fn *Node, narg int, f *types.Field) string { // This really doesn't have much to do with escape analysis per se, // but we are reusing the ability to annotate an individual function // argument and pass those annotations along to importing code. - if f.Type.Etype == TUINTPTR { + if f.Type.IsUintptr() { if Debug['m'] != 0 { Warnl(f.Pos, "assuming %v is unsafe uintptr", name()) } @@ -407,13 +407,13 @@ func (e *Escape) paramTag(fn *Node, narg int, f *types.Field) string { } if fn.Func.Pragma&UintptrEscapes != 0 { - if f.Type.Etype == TUINTPTR { + if f.Type.IsUintptr() { if Debug['m'] != 0 { Warnl(f.Pos, "marking %v as escaping uintptr", name()) } return uintptrEscapesTag } - if f.IsDDD() && f.Type.Elem().Etype == TUINTPTR { + if f.IsDDD() && f.Type.Elem().IsUintptr() { // final argument is ...uintptr. if Debug['m'] != 0 { Warnl(f.Pos, "marking %v as escaping ...uintptr", name()) diff --git a/src/cmd/compile/internal/gc/escape.go b/src/cmd/compile/internal/gc/escape.go index ddf89f6159..75da439bb7 100644 --- a/src/cmd/compile/internal/gc/escape.go +++ b/src/cmd/compile/internal/gc/escape.go @@ -485,7 +485,7 @@ func (e *Escape) exprSkipInit(k EscHole, n *Node) { e.discard(max) case OCONV, OCONVNOP: - if checkPtr(e.curfn, 2) && n.Type.Etype == TUNSAFEPTR && n.Left.Type.IsPtr() { + if checkPtr(e.curfn, 2) && n.Type.IsUnsafePtr() && n.Left.Type.IsPtr() { // When -d=checkptr=2 is enabled, treat // conversions to unsafe.Pointer as an // escaping operation. This allows better @@ -493,7 +493,7 @@ func (e *Escape) exprSkipInit(k EscHole, n *Node) { // easily detect object boundaries on the heap // than the stack. e.assignHeap(n.Left, "conversion to unsafe.Pointer", n) - } else if n.Type.Etype == TUNSAFEPTR && n.Left.Type.Etype == TUINTPTR { + } else if n.Type.IsUnsafePtr() && n.Left.Type.IsUintptr() { e.unsafeValue(k, n.Left) } else { e.expr(k, n.Left) @@ -625,7 +625,7 @@ func (e *Escape) unsafeValue(k EscHole, n *Node) { switch n.Op { case OCONV, OCONVNOP: - if n.Left.Type.Etype == TUNSAFEPTR { + if n.Left.Type.IsUnsafePtr() { e.expr(k, n.Left) } else { e.discard(n.Left) @@ -1029,6 +1029,9 @@ func (e *Escape) newLoc(n *Node, transient bool) *EscLocation { if e.curfn == nil { Fatalf("e.curfn isn't set") } + if n != nil && n.Type != nil && n.Type.NotInHeap() { + yyerrorl(n.Pos, "%v is go:notinheap; stack allocation disallowed", n.Type) + } n = canonicalNode(n) loc := &EscLocation{ diff --git a/src/cmd/compile/internal/gc/fmt.go b/src/cmd/compile/internal/gc/fmt.go index d6cc9fa4cf..866cd0a714 100644 --- a/src/cmd/compile/internal/gc/fmt.go +++ b/src/cmd/compile/internal/gc/fmt.go @@ -1616,7 +1616,8 @@ func (n *Node) exprfmt(s fmt.State, prec int, mode fmtMode) { } n1.exprfmt(s, nprec, mode) } - + case ODDD: + mode.Fprintf(s, "...") default: mode.Fprintf(s, "<node %v>", n.Op) } diff --git a/src/cmd/compile/internal/gc/gsubr.go b/src/cmd/compile/internal/gc/gsubr.go index 15a84a8a43..480d411f49 100644 --- a/src/cmd/compile/internal/gc/gsubr.go +++ b/src/cmd/compile/internal/gc/gsubr.go @@ -342,6 +342,6 @@ func Patch(p *obj.Prog, to *obj.Prog) { if p.To.Type != obj.TYPE_BRANCH { Fatalf("patch: not a branch") } - p.To.Val = to + p.To.SetTarget(to) p.To.Offset = to.Pc } diff --git a/src/cmd/compile/internal/gc/init.go b/src/cmd/compile/internal/gc/init.go index 03e475e85a..94cbcf9846 100644 --- a/src/cmd/compile/internal/gc/init.go +++ b/src/cmd/compile/internal/gc/init.go @@ -45,7 +45,6 @@ func fninit(n []*Node) { if len(nf) > 0 { lineno = nf[0].Pos // prolog/epilog gets line number of first init stmt initializers := lookup("init") - disableExport(initializers) fn := dclfunc(initializers, nod(OTFUNC, nil, nil)) for _, dcl := range dummyInitFn.Func.Dcl { dcl.Name.Curfn = fn diff --git a/src/cmd/compile/internal/gc/noder.go b/src/cmd/compile/internal/gc/noder.go index 802aab2268..5dce533e4b 100644 --- a/src/cmd/compile/internal/gc/noder.go +++ b/src/cmd/compile/internal/gc/noder.go @@ -653,7 +653,7 @@ func (p *noder) expr(expr syntax.Expr) *Node { obj := p.expr(expr.X) if obj.Op == OPACK { obj.Name.SetUsed(true) - return oldname(restrictlookup(expr.Sel.Value, obj.Name.Pkg)) + return importName(obj.Name.Pkg.Lookup(expr.Sel.Value)) } n := nodSym(OXDOT, obj, p.name(expr.Sel)) n.Pos = p.pos(expr) // lineno may have been changed by p.expr(expr.X) @@ -857,7 +857,7 @@ func (p *noder) interfaceType(expr *syntax.InterfaceType) *Node { p.setlineno(method) var n *Node if method.Name == nil { - n = p.nodSym(method, ODCLFIELD, oldname(p.packname(method.Type)), nil) + n = p.nodSym(method, ODCLFIELD, importName(p.packname(method.Type)), nil) } else { mname := p.name(method.Name) sig := p.typeExpr(method.Type) @@ -896,7 +896,7 @@ func (p *noder) packname(expr syntax.Expr) *types.Sym { def.Name.SetUsed(true) pkg = def.Name.Pkg } - return restrictlookup(expr.Sel.Value, pkg) + return pkg.Lookup(expr.Sel.Value) } panic(fmt.Sprintf("unexpected packname: %#v", expr)) } @@ -911,7 +911,7 @@ func (p *noder) embedded(typ syntax.Expr) *Node { } sym := p.packname(typ) - n := p.nodSym(typ, ODCLFIELD, oldname(sym), lookup(sym.Name)) + n := p.nodSym(typ, ODCLFIELD, importName(sym), lookup(sym.Name)) n.SetEmbedded(true) if isStar { @@ -1641,10 +1641,3 @@ func mkname(sym *types.Sym) *Node { } return n } - -func unparen(x *Node) *Node { - for x.Op == OPAREN { - x = x.Left - } - return x -} diff --git a/src/cmd/compile/internal/gc/order.go b/src/cmd/compile/internal/gc/order.go index aa91160e5c..412f073a8d 100644 --- a/src/cmd/compile/internal/gc/order.go +++ b/src/cmd/compile/internal/gc/order.go @@ -502,6 +502,7 @@ func (o *Order) call(n *Node) { x := o.copyExpr(arg.Left, arg.Left.Type, false) x.Name.SetKeepalive(true) arg.Left = x + n.SetNeedsWrapper(true) } } diff --git a/src/cmd/compile/internal/gc/pgen.go b/src/cmd/compile/internal/gc/pgen.go index ca8cccf4ae..74262595b0 100644 --- a/src/cmd/compile/internal/gc/pgen.go +++ b/src/cmd/compile/internal/gc/pgen.go @@ -507,7 +507,7 @@ func createSimpleVar(fnsym *obj.LSym, n *Node) *dwarf.Var { if Ctxt.FixedFrameSize() == 0 { offs -= int64(Widthptr) } - if objabi.Framepointer_enabled(objabi.GOOS, objabi.GOARCH) || objabi.GOARCH == "arm64" { + if objabi.Framepointer_enabled || objabi.GOARCH == "arm64" { // There is a word space for FP on ARM64 even if the frame pointer is disabled offs -= int64(Widthptr) } @@ -703,7 +703,7 @@ func stackOffset(slot ssa.LocalSlot) int32 { if Ctxt.FixedFrameSize() == 0 { base -= int64(Widthptr) } - if objabi.Framepointer_enabled(objabi.GOOS, objabi.GOARCH) || objabi.GOARCH == "arm64" { + if objabi.Framepointer_enabled || objabi.GOARCH == "arm64" { // There is a word space for FP on ARM64 even if the frame pointer is disabled base -= int64(Widthptr) } diff --git a/src/cmd/compile/internal/gc/pgen_test.go b/src/cmd/compile/internal/gc/pgen_test.go index 41f0808a1c..b1db29825c 100644 --- a/src/cmd/compile/internal/gc/pgen_test.go +++ b/src/cmd/compile/internal/gc/pgen_test.go @@ -20,7 +20,7 @@ func typeWithoutPointers() *types.Type { func typeWithPointers() *types.Type { t := types.New(TSTRUCT) - f := &types.Field{Type: types.New(TPTR)} + f := &types.Field{Type: types.NewPtr(types.New(TINT))} t.SetFields([]*types.Field{f}) return t } @@ -181,14 +181,6 @@ func TestStackvarSort(t *testing.T) { nodeWithClass(Node{Type: &types.Type{}, Sym: &types.Sym{Name: "xyz"}}, PAUTO), nodeWithClass(Node{Type: typeWithoutPointers(), Sym: &types.Sym{}}, PAUTO), } - // haspointers updates Type.Haspointers as a side effect, so - // exercise this function on all inputs so that reflect.DeepEqual - // doesn't produce false positives. - for i := range want { - want[i].Type.HasPointers() - inp[i].Type.HasPointers() - } - sort.Sort(byStackVar(inp)) if !reflect.DeepEqual(want, inp) { t.Error("sort failed") diff --git a/src/cmd/compile/internal/gc/plive.go b/src/cmd/compile/internal/gc/plive.go index 398bfe5baa..8976ed657a 100644 --- a/src/cmd/compile/internal/gc/plive.go +++ b/src/cmd/compile/internal/gc/plive.go @@ -436,7 +436,7 @@ func (lv *Liveness) regEffects(v *ssa.Value) (uevar, kill liveRegMask) { case ssa.LocalSlot: return mask case *ssa.Register: - if ptrOnly && !v.Type.HasHeapPointer() { + if ptrOnly && !v.Type.HasPointers() { return mask } regs[0] = loc @@ -451,7 +451,7 @@ func (lv *Liveness) regEffects(v *ssa.Value) (uevar, kill liveRegMask) { if loc1 == nil { continue } - if ptrOnly && !v.Type.FieldType(i).HasHeapPointer() { + if ptrOnly && !v.Type.FieldType(i).HasPointers() { continue } regs[nreg] = loc1.(*ssa.Register) @@ -568,13 +568,13 @@ func onebitwalktype1(t *types.Type, off int64, bv bvec) { if t.Align > 0 && off&int64(t.Align-1) != 0 { Fatalf("onebitwalktype1: invalid initial alignment: type %v has alignment %d, but offset is %v", t, t.Align, off) } + if !t.HasPointers() { + // Note: this case ensures that pointers to go:notinheap types + // are not considered pointers by garbage collection and stack copying. + return + } switch t.Etype { - case TINT8, TUINT8, TINT16, TUINT16, - TINT32, TUINT32, TINT64, TUINT64, - TINT, TUINT, TUINTPTR, TBOOL, - TFLOAT32, TFLOAT64, TCOMPLEX64, TCOMPLEX128: - case TPTR, TUNSAFEPTR, TFUNC, TCHAN, TMAP: if off&int64(Widthptr-1) != 0 { Fatalf("onebitwalktype1: invalid alignment, %v", t) diff --git a/src/cmd/compile/internal/gc/range.go b/src/cmd/compile/internal/gc/range.go index d78a5f0d8d..5434b0167a 100644 --- a/src/cmd/compile/internal/gc/range.go +++ b/src/cmd/compile/internal/gc/range.go @@ -586,7 +586,7 @@ func arrayClear(n, v1, v2, a *Node) bool { n.Nbody.Append(nod(OAS, hn, tmp)) var fn *Node - if a.Type.Elem().HasHeapPointer() { + if a.Type.Elem().HasPointers() { // memclrHasPointers(hp, hn) Curfn.Func.setWBPos(stmt.Pos) fn = mkcall("memclrHasPointers", nil, nil, hp, hn) diff --git a/src/cmd/compile/internal/gc/select.go b/src/cmd/compile/internal/gc/select.go index 3812a0e1fa..97e0424ce0 100644 --- a/src/cmd/compile/internal/gc/select.go +++ b/src/cmd/compile/internal/gc/select.go @@ -251,10 +251,8 @@ func walkselectcases(cases *Nodes) []*Node { r = typecheck(r, ctxStmt) init = append(init, r) + // No initialization for order; runtime.selectgo is responsible for that. order := temp(types.NewArray(types.Types[TUINT16], 2*int64(ncas))) - r = nod(OAS, order, nil) - r = typecheck(r, ctxStmt) - init = append(init, r) var pc0, pcs *Node if flag_race { diff --git a/src/cmd/compile/internal/gc/ssa.go b/src/cmd/compile/internal/gc/ssa.go index c8fb013ad0..89644cd3f2 100644 --- a/src/cmd/compile/internal/gc/ssa.go +++ b/src/cmd/compile/internal/gc/ssa.go @@ -295,7 +295,10 @@ func (s *state) emitOpenDeferInfo() { // worker indicates which of the backend workers is doing the processing. func buildssa(fn *Node, worker int) *ssa.Func { name := fn.funcname() - printssa := name == ssaDump + printssa := false + if ssaDump != "" { // match either a simple name e.g. "(*Reader).Reset", or a package.name e.g. "compress/gzip.(*Reader).Reset" + printssa = name == ssaDump || myimportpath+"."+name == ssaDump + } var astBuf *bytes.Buffer if printssa { astBuf = &bytes.Buffer{} @@ -2110,7 +2113,7 @@ func (s *state) expr(n *Node) *ssa.Value { } // unsafe.Pointer <--> *T - if to.Etype == TUNSAFEPTR && from.IsPtrShaped() || from.Etype == TUNSAFEPTR && to.IsPtrShaped() { + if to.IsUnsafePtr() && from.IsPtrShaped() || from.IsUnsafePtr() && to.IsPtrShaped() { return v } @@ -6179,7 +6182,7 @@ func genssa(f *ssa.Func, pp *Progs) { // Resolve branches, and relax DefaultStmt into NotStmt for _, br := range s.Branches { - br.P.To.Val = s.bstart[br.B.ID] + br.P.To.SetTarget(s.bstart[br.B.ID]) if br.P.Pos.IsStmt() != src.PosIsStmt { br.P.Pos = br.P.Pos.WithNotStmt() } else if v0 := br.B.FirstPossibleStmtValue(); v0 != nil && v0.Pos.Line() == br.P.Pos.Line() && v0.Pos.IsStmt() == src.PosIsStmt { diff --git a/src/cmd/compile/internal/gc/subr.go b/src/cmd/compile/internal/gc/subr.go index 9362c74288..d3ba53ff0c 100644 --- a/src/cmd/compile/internal/gc/subr.go +++ b/src/cmd/compile/internal/gc/subr.go @@ -271,13 +271,6 @@ func autolabel(prefix string) *types.Sym { return lookupN(prefix, int(n)) } -func restrictlookup(name string, pkg *types.Pkg) *types.Sym { - if !types.IsExported(name) && pkg != localpkg { - yyerror("cannot refer to unexported name %s.%s", pkg.Name, name) - } - return pkg.Lookup(name) -} - // find all the exported symbols in package opkg // and make them available in the current package func importdot(opkg *types.Pkg, pack *Node) { @@ -788,12 +781,12 @@ func convertop(srcConstant bool, src, dst *types.Type, why *string) Op { } // 8. src is a pointer or uintptr and dst is unsafe.Pointer. - if (src.IsPtr() || src.Etype == TUINTPTR) && dst.Etype == TUNSAFEPTR { + if (src.IsPtr() || src.IsUintptr()) && dst.IsUnsafePtr() { return OCONVNOP } // 9. src is unsafe.Pointer and dst is a pointer or uintptr. - if src.Etype == TUNSAFEPTR && (dst.IsPtr() || dst.Etype == TUINTPTR) { + if src.IsUnsafePtr() && (dst.IsPtr() || dst.IsUintptr()) { return OCONVNOP } @@ -1550,7 +1543,6 @@ func genwrapper(rcvr *types.Type, method *types.Field, newnam *types.Sym) { tfn.List.Set(structargs(method.Type.Params(), true)) tfn.Rlist.Set(structargs(method.Type.Results(), false)) - disableExport(newnam) fn := dclfunc(newnam, tfn) fn.Func.SetDupok(true) @@ -1638,8 +1630,7 @@ func hashmem(t *types.Type) *Node { sym := Runtimepkg.Lookup("memhash") n := newname(sym) - n.SetClass(PFUNC) - n.Sym.SetFunc(true) + setNodeNameFunc(n) n.Type = functype(nil, []*Node{ anonfield(types.NewPtr(t)), anonfield(types.Types[TUINTPTR]), diff --git a/src/cmd/compile/internal/gc/syntax.go b/src/cmd/compile/internal/gc/syntax.go index 47e5e59156..5580f789c5 100644 --- a/src/cmd/compile/internal/gc/syntax.go +++ b/src/cmd/compile/internal/gc/syntax.go @@ -141,19 +141,20 @@ const ( nodeInitorder, _ // tracks state during init1; two bits _, _ // second nodeInitorder bit _, nodeHasBreak - _, nodeNoInline // used internally by inliner to indicate that a function call should not be inlined; set for OCALLFUNC and OCALLMETH only - _, nodeImplicit // implicit OADDR or ODEREF; ++/-- statement represented as OASOP; or ANDNOT lowered to OAND - _, nodeIsDDD // is the argument variadic - _, nodeDiag // already printed error about this - _, nodeColas // OAS resulting from := - _, nodeNonNil // guaranteed to be non-nil - _, nodeTransient // storage can be reused immediately after this statement - _, nodeBounded // bounds check unnecessary - _, nodeHasCall // expression contains a function call - _, nodeLikely // if statement condition likely - _, nodeHasVal // node.E contains a Val - _, nodeHasOpt // node.E contains an Opt - _, nodeEmbedded // ODCLFIELD embedded type + _, nodeNoInline // used internally by inliner to indicate that a function call should not be inlined; set for OCALLFUNC and OCALLMETH only + _, nodeImplicit // implicit OADDR or ODEREF; ++/-- statement represented as OASOP; or ANDNOT lowered to OAND + _, nodeIsDDD // is the argument variadic + _, nodeDiag // already printed error about this + _, nodeColas // OAS resulting from := + _, nodeNonNil // guaranteed to be non-nil + _, nodeTransient // storage can be reused immediately after this statement + _, nodeBounded // bounds check unnecessary + _, nodeHasCall // expression contains a function call + _, nodeLikely // if statement condition likely + _, nodeHasVal // node.E contains a Val + _, nodeHasOpt // node.E contains an Opt + _, nodeEmbedded // ODCLFIELD embedded type + _, nodeNeedsWrapper // OCALLxxx node that needs to be wrapped ) func (n *Node) Class() Class { return Class(n.flags.get3(nodeClass)) } @@ -286,6 +287,20 @@ func (n *Node) SetIota(x int64) { n.Xoffset = x } +func (n *Node) NeedsWrapper() bool { + return n.flags&nodeNeedsWrapper != 0 +} + +// SetNeedsWrapper indicates that OCALLxxx node needs to be wrapped by a closure. +func (n *Node) SetNeedsWrapper(b bool) { + switch n.Op { + case OCALLFUNC, OCALLMETH, OCALLINTER: + default: + Fatalf("Node.SetNeedsWrapper %v", n.Op) + } + n.flags.set(nodeNeedsWrapper, b) +} + // mayBeShared reports whether n may occur in multiple places in the AST. // Extra care must be taken when mutating such a node. func (n *Node) mayBeShared() bool { diff --git a/src/cmd/compile/internal/gc/walk.go b/src/cmd/compile/internal/gc/walk.go index 77f88d8996..361de7e0f3 100644 --- a/src/cmd/compile/internal/gc/walk.go +++ b/src/cmd/compile/internal/gc/walk.go @@ -232,7 +232,11 @@ func walkstmt(n *Node) *Node { n.Left = copyany(n.Left, &n.Ninit, true) default: - n.Left = walkexpr(n.Left, &n.Ninit) + if n.Left.NeedsWrapper() { + n.Left = wrapCall(n.Left, &n.Ninit) + } else { + n.Left = walkexpr(n.Left, &n.Ninit) + } } case OFOR, OFORUNTIL: @@ -954,11 +958,11 @@ opswitch: case OCONV, OCONVNOP: n.Left = walkexpr(n.Left, init) if n.Op == OCONVNOP && checkPtr(Curfn, 1) { - if n.Type.IsPtr() && n.Left.Type.Etype == TUNSAFEPTR { // unsafe.Pointer to *T + if n.Type.IsPtr() && n.Left.Type.IsUnsafePtr() { // unsafe.Pointer to *T n = walkCheckPtrAlignment(n, init, nil) break } - if n.Type.Etype == TUNSAFEPTR && n.Left.Type.Etype == TUINTPTR { // uintptr to unsafe.Pointer + if n.Type.IsUnsafePtr() && n.Left.Type.IsUintptr() { // uintptr to unsafe.Pointer n = walkCheckPtrArithmetic(n, init) break } @@ -1123,7 +1127,7 @@ opswitch: n.List.SetSecond(walkexpr(n.List.Second(), init)) case OSLICE, OSLICEARR, OSLICESTR, OSLICE3, OSLICE3ARR: - checkSlice := checkPtr(Curfn, 1) && n.Op == OSLICE3ARR && n.Left.Op == OCONVNOP && n.Left.Left.Type.Etype == TUNSAFEPTR + checkSlice := checkPtr(Curfn, 1) && n.Op == OSLICE3ARR && n.Left.Op == OCONVNOP && n.Left.Left.Type.IsUnsafePtr() if checkSlice { n.Left.Left = walkexpr(n.Left.Left, init) } else { @@ -1156,6 +1160,9 @@ opswitch: } case ONEW: + if n.Type.Elem().NotInHeap() { + yyerror("%v is go:notinheap; heap allocation disallowed", n.Type.Elem()) + } if n.Esc == EscNone { if n.Type.Elem().Width >= maxImplicitStackVarSize { Fatalf("large ONEW with EscNone: %v", n) @@ -1324,6 +1331,9 @@ opswitch: l = r } t := n.Type + if t.Elem().NotInHeap() { + yyerror("%v is go:notinheap; heap allocation disallowed", t.Elem()) + } if n.Esc == EscNone { if !isSmallMakeSlice(n) { Fatalf("non-small OMAKESLICE with EscNone: %v", n) @@ -1365,10 +1375,6 @@ opswitch: // When len and cap can fit into int, use makeslice instead of // makeslice64, which is faster and shorter on 32 bit platforms. - if t.Elem().NotInHeap() { - yyerror("%v is go:notinheap; heap allocation disallowed", t.Elem()) - } - len, cap := l, r fnname := "makeslice64" @@ -1403,7 +1409,7 @@ opswitch: t := n.Type if t.Elem().NotInHeap() { - Fatalf("%v is go:notinheap; heap allocation disallowed", t.Elem()) + yyerror("%v is go:notinheap; heap allocation disallowed", t.Elem()) } length := conv(n.Left, types.Types[TINT]) @@ -2012,9 +2018,6 @@ func walkprint(nn *Node, init *Nodes) *Node { } func callnew(t *types.Type) *Node { - if t.NotInHeap() { - yyerror("%v is go:notinheap; heap allocation disallowed", t) - } dowidth(t) n := nod(ONEWOBJ, typename(t), nil) n.Type = types.NewPtr(t) @@ -2589,7 +2592,7 @@ func mapfast(t *types.Type) int { } switch algtype(t.Key()) { case AMEM32: - if !t.Key().HasHeapPointer() { + if !t.Key().HasPointers() { return mapfast32 } if Widthptr == 4 { @@ -2597,7 +2600,7 @@ func mapfast(t *types.Type) int { } Fatalf("small pointer %v", t.Key()) case AMEM64: - if !t.Key().HasHeapPointer() { + if !t.Key().HasPointers() { return mapfast64 } if Widthptr == 8 { @@ -2744,7 +2747,7 @@ func appendslice(n *Node, init *Nodes) *Node { nodes.Append(nod(OAS, s, nt)) var ncopy *Node - if elemtype.HasHeapPointer() { + if elemtype.HasPointers() { // copy(s[len(l1):], l2) nptr1 := nod(OSLICE, s, nil) nptr1.Type = s.Type @@ -3082,7 +3085,7 @@ func walkappend(n *Node, init *Nodes, dst *Node) *Node { // Also works if b is a string. // func copyany(n *Node, init *Nodes, runtimecall bool) *Node { - if n.Left.Type.Elem().HasHeapPointer() { + if n.Left.Type.Elem().HasPointers() { Curfn.Func.setWBPos(n.Pos) fn := writebarrierfn("typedslicecopy", n.Left.Type.Elem(), n.Right.Type.Elem()) n.Left = cheapexpr(n.Left, init) @@ -3167,8 +3170,7 @@ func eqfor(t *types.Type) (n *Node, needsize bool) { case ASPECIAL: sym := typesymprefix(".eq", t) n := newname(sym) - n.SetClass(PFUNC) - n.Sym.SetFunc(true) + setNodeNameFunc(n) n.Type = functype(nil, []*Node{ anonfield(types.NewPtr(t)), anonfield(types.NewPtr(t)), @@ -3859,6 +3861,14 @@ func candiscard(n *Node) bool { // builtin(a1, a2, a3) // }(x, y, z) // for print, println, and delete. +// +// Rewrite +// go f(x, y, uintptr(unsafe.Pointer(z))) +// into +// go func(a1, a2, a3) { +// builtin(a1, a2, uintptr(a3)) +// }(x, y, unsafe.Pointer(z)) +// for function contains unsafe-uintptr arguments. var wrapCall_prgen int @@ -3870,9 +3880,17 @@ func wrapCall(n *Node, init *Nodes) *Node { init.AppendNodes(&n.Ninit) } + isBuiltinCall := n.Op != OCALLFUNC && n.Op != OCALLMETH && n.Op != OCALLINTER + // origArgs keeps track of what argument is uintptr-unsafe/unsafe-uintptr conversion. + origArgs := make([]*Node, n.List.Len()) t := nod(OTFUNC, nil, nil) for i, arg := range n.List.Slice() { s := lookupN("a", i) + if !isBuiltinCall && arg.Op == OCONVNOP && arg.Type.IsUintptr() && arg.Left.Type.IsUnsafePtr() { + origArgs[i] = arg + arg = arg.Left + n.List.SetIndex(i, arg) + } t.List.Append(symfield(s, arg.Type)) } @@ -3880,10 +3898,22 @@ func wrapCall(n *Node, init *Nodes) *Node { sym := lookupN("wrap·", wrapCall_prgen) fn := dclfunc(sym, t) - a := nod(n.Op, nil, nil) - a.List.Set(paramNnames(t.Type)) - a = typecheck(a, ctxStmt) - fn.Nbody.Set1(a) + args := paramNnames(t.Type) + for i, origArg := range origArgs { + if origArg == nil { + continue + } + arg := nod(origArg.Op, args[i], nil) + arg.Type = origArg.Type + args[i] = arg + } + call := nod(n.Op, nil, nil) + if !isBuiltinCall { + call.Op = OCALL + call.Left = n.Left + } + call.List.Set(args) + fn.Nbody.Set1(call) funcbody() @@ -3891,12 +3921,12 @@ func wrapCall(n *Node, init *Nodes) *Node { typecheckslice(fn.Nbody.Slice(), ctxStmt) xtop = append(xtop, fn) - a = nod(OCALL, nil, nil) - a.Left = fn.Func.Nname - a.List.Set(n.List.Slice()) - a = typecheck(a, ctxStmt) - a = walkexpr(a, init) - return a + call = nod(OCALL, nil, nil) + call.Left = fn.Func.Nname + call.List.Set(n.List.Slice()) + call = typecheck(call, ctxStmt) + call = walkexpr(call, init) + return call } // substArgTypes substitutes the given list of types for @@ -4011,7 +4041,7 @@ func walkCheckPtrArithmetic(n *Node, init *Nodes) *Node { walk(n.Left) } case OCONVNOP: - if n.Left.Type.Etype == TUNSAFEPTR { + if n.Left.Type.IsUnsafePtr() { n.Left = cheapexpr(n.Left, init) originals = append(originals, convnop(n.Left, types.Types[TUNSAFEPTR])) } diff --git a/src/cmd/compile/internal/ppc64/ssa.go b/src/cmd/compile/internal/ppc64/ssa.go index 4d2ad48135..f8d9ac2379 100644 --- a/src/cmd/compile/internal/ppc64/ssa.go +++ b/src/cmd/compile/internal/ppc64/ssa.go @@ -629,23 +629,6 @@ func ssaGenValue(s *gc.SSAGenState, v *ssa.Value) { p.To.Type = obj.TYPE_REG p.To.Reg = r - case ssa.OpPPC64MaskIfNotCarry: - r := v.Reg() - p := s.Prog(v.Op.Asm()) - p.From.Type = obj.TYPE_REG - p.From.Reg = ppc64.REGZERO - p.To.Type = obj.TYPE_REG - p.To.Reg = r - - case ssa.OpPPC64ADDconstForCarry: - r1 := v.Args[0].Reg() - p := s.Prog(v.Op.Asm()) - p.Reg = r1 - p.From.Type = obj.TYPE_CONST - p.From.Offset = v.AuxInt - p.To.Type = obj.TYPE_REG - p.To.Reg = ppc64.REGTMP // Ignored; this is for the carry effect. - case ssa.OpPPC64NEG, ssa.OpPPC64FNEG, ssa.OpPPC64FSQRT, ssa.OpPPC64FSQRTS, ssa.OpPPC64FFLOOR, ssa.OpPPC64FTRUNC, ssa.OpPPC64FCEIL, ssa.OpPPC64FCTIDZ, ssa.OpPPC64FCTIWZ, ssa.OpPPC64FCFID, ssa.OpPPC64FCFIDS, ssa.OpPPC64FRSP, ssa.OpPPC64CNTLZD, ssa.OpPPC64CNTLZW, ssa.OpPPC64POPCNTD, ssa.OpPPC64POPCNTW, ssa.OpPPC64POPCNTB, ssa.OpPPC64MFVSRD, ssa.OpPPC64MTVSRD, ssa.OpPPC64FABS, ssa.OpPPC64FNABS, @@ -666,6 +649,14 @@ func ssaGenValue(s *gc.SSAGenState, v *ssa.Value) { p.To.Type = obj.TYPE_REG p.To.Reg = v.Reg() + case ssa.OpPPC64SUBFCconst: + p := s.Prog(v.Op.Asm()) + p.SetFrom3(obj.Addr{Type: obj.TYPE_CONST, Offset: v.AuxInt}) + p.From.Type = obj.TYPE_REG + p.From.Reg = v.Args[0].Reg() + p.To.Type = obj.TYPE_REG + p.To.Reg = v.Reg() + case ssa.OpPPC64ANDCCconst: p := s.Prog(v.Op.Asm()) p.Reg = v.Args[0].Reg() @@ -1802,7 +1793,7 @@ func ssaGenValue(s *gc.SSAGenState, v *ssa.Value) { v.Fatalf("Pseudo-op should not make it to codegen: %s ###\n", v.LongString()) case ssa.OpPPC64InvertFlags: v.Fatalf("InvertFlags should never make it to codegen %v", v.LongString()) - case ssa.OpPPC64FlagEQ, ssa.OpPPC64FlagLT, ssa.OpPPC64FlagGT, ssa.OpPPC64FlagCarrySet, ssa.OpPPC64FlagCarryClear: + case ssa.OpPPC64FlagEQ, ssa.OpPPC64FlagLT, ssa.OpPPC64FlagGT: v.Fatalf("Flag* ops should never make it to codegen %v", v.LongString()) case ssa.OpClobber: // TODO: implement for clobberdead experiment. Nop is ok for now. diff --git a/src/cmd/compile/internal/s390x/ssa.go b/src/cmd/compile/internal/s390x/ssa.go index 4cf4b70a32..00d253c95a 100644 --- a/src/cmd/compile/internal/s390x/ssa.go +++ b/src/cmd/compile/internal/s390x/ssa.go @@ -338,8 +338,8 @@ func ssaGenValue(s *gc.SSAGenState, v *ssa.Value) { n.To.Reg = dividend } - j.To.Val = n - j2.To.Val = s.Pc() + j.To.SetTarget(n) + j2.To.SetTarget(s.Pc()) } case ssa.OpS390XADDconst, ssa.OpS390XADDWconst: opregregimm(s, v.Op.Asm(), v.Reg(), v.Args[0].Reg(), v.AuxInt) diff --git a/src/cmd/compile/internal/ssa/addressingmodes.go b/src/cmd/compile/internal/ssa/addressingmodes.go index 97a5ab4f03..aae0def27f 100644 --- a/src/cmd/compile/internal/ssa/addressingmodes.go +++ b/src/cmd/compile/internal/ssa/addressingmodes.go @@ -7,12 +7,14 @@ package ssa // addressingModes combines address calculations into memory operations // that can perform complicated addressing modes. func addressingModes(f *Func) { + isInImmediateRange := is32Bit switch f.Config.arch { default: // Most architectures can't do this. return case "amd64", "386": - // TODO: s390x? + case "s390x": + isInImmediateRange = is20Bit } var tmp []*Value @@ -40,7 +42,7 @@ func addressingModes(f *Func) { switch [2]auxType{opcodeTable[v.Op].auxType, opcodeTable[p.Op].auxType} { case [2]auxType{auxSymOff, auxInt32}: // TODO: introduce auxSymOff32 - if !is32Bit(v.AuxInt + p.AuxInt) { + if !isInImmediateRange(v.AuxInt + p.AuxInt) { continue } v.AuxInt += p.AuxInt @@ -48,7 +50,7 @@ func addressingModes(f *Func) { if v.Aux != nil && p.Aux != nil { continue } - if !is32Bit(v.AuxInt + p.AuxInt) { + if !isInImmediateRange(v.AuxInt + p.AuxInt) { continue } if p.Aux != nil { @@ -398,4 +400,61 @@ var combine = map[[2]Op]Op{ [2]Op{Op386ANDLconstmodify, Op386LEAL4}: Op386ANDLconstmodifyidx4, [2]Op{Op386ORLconstmodify, Op386LEAL4}: Op386ORLconstmodifyidx4, [2]Op{Op386XORLconstmodify, Op386LEAL4}: Op386XORLconstmodifyidx4, + + // s390x + [2]Op{OpS390XMOVDload, OpS390XADD}: OpS390XMOVDloadidx, + [2]Op{OpS390XMOVWload, OpS390XADD}: OpS390XMOVWloadidx, + [2]Op{OpS390XMOVHload, OpS390XADD}: OpS390XMOVHloadidx, + [2]Op{OpS390XMOVBload, OpS390XADD}: OpS390XMOVBloadidx, + + [2]Op{OpS390XMOVWZload, OpS390XADD}: OpS390XMOVWZloadidx, + [2]Op{OpS390XMOVHZload, OpS390XADD}: OpS390XMOVHZloadidx, + [2]Op{OpS390XMOVBZload, OpS390XADD}: OpS390XMOVBZloadidx, + + [2]Op{OpS390XMOVDBRload, OpS390XADD}: OpS390XMOVDBRloadidx, + [2]Op{OpS390XMOVWBRload, OpS390XADD}: OpS390XMOVWBRloadidx, + [2]Op{OpS390XMOVHBRload, OpS390XADD}: OpS390XMOVHBRloadidx, + + [2]Op{OpS390XFMOVDload, OpS390XADD}: OpS390XFMOVDloadidx, + [2]Op{OpS390XFMOVSload, OpS390XADD}: OpS390XFMOVSloadidx, + + [2]Op{OpS390XMOVDstore, OpS390XADD}: OpS390XMOVDstoreidx, + [2]Op{OpS390XMOVWstore, OpS390XADD}: OpS390XMOVWstoreidx, + [2]Op{OpS390XMOVHstore, OpS390XADD}: OpS390XMOVHstoreidx, + [2]Op{OpS390XMOVBstore, OpS390XADD}: OpS390XMOVBstoreidx, + + [2]Op{OpS390XMOVDBRstore, OpS390XADD}: OpS390XMOVDBRstoreidx, + [2]Op{OpS390XMOVWBRstore, OpS390XADD}: OpS390XMOVWBRstoreidx, + [2]Op{OpS390XMOVHBRstore, OpS390XADD}: OpS390XMOVHBRstoreidx, + + [2]Op{OpS390XFMOVDstore, OpS390XADD}: OpS390XFMOVDstoreidx, + [2]Op{OpS390XFMOVSstore, OpS390XADD}: OpS390XFMOVSstoreidx, + + [2]Op{OpS390XMOVDload, OpS390XMOVDaddridx}: OpS390XMOVDloadidx, + [2]Op{OpS390XMOVWload, OpS390XMOVDaddridx}: OpS390XMOVWloadidx, + [2]Op{OpS390XMOVHload, OpS390XMOVDaddridx}: OpS390XMOVHloadidx, + [2]Op{OpS390XMOVBload, OpS390XMOVDaddridx}: OpS390XMOVBloadidx, + + [2]Op{OpS390XMOVWZload, OpS390XMOVDaddridx}: OpS390XMOVWZloadidx, + [2]Op{OpS390XMOVHZload, OpS390XMOVDaddridx}: OpS390XMOVHZloadidx, + [2]Op{OpS390XMOVBZload, OpS390XMOVDaddridx}: OpS390XMOVBZloadidx, + + [2]Op{OpS390XMOVDBRload, OpS390XMOVDaddridx}: OpS390XMOVDBRloadidx, + [2]Op{OpS390XMOVWBRload, OpS390XMOVDaddridx}: OpS390XMOVWBRloadidx, + [2]Op{OpS390XMOVHBRload, OpS390XMOVDaddridx}: OpS390XMOVHBRloadidx, + + [2]Op{OpS390XFMOVDload, OpS390XMOVDaddridx}: OpS390XFMOVDloadidx, + [2]Op{OpS390XFMOVSload, OpS390XMOVDaddridx}: OpS390XFMOVSloadidx, + + [2]Op{OpS390XMOVDstore, OpS390XMOVDaddridx}: OpS390XMOVDstoreidx, + [2]Op{OpS390XMOVWstore, OpS390XMOVDaddridx}: OpS390XMOVWstoreidx, + [2]Op{OpS390XMOVHstore, OpS390XMOVDaddridx}: OpS390XMOVHstoreidx, + [2]Op{OpS390XMOVBstore, OpS390XMOVDaddridx}: OpS390XMOVBstoreidx, + + [2]Op{OpS390XMOVDBRstore, OpS390XMOVDaddridx}: OpS390XMOVDBRstoreidx, + [2]Op{OpS390XMOVWBRstore, OpS390XMOVDaddridx}: OpS390XMOVWBRstoreidx, + [2]Op{OpS390XMOVHBRstore, OpS390XMOVDaddridx}: OpS390XMOVHBRstoreidx, + + [2]Op{OpS390XFMOVDstore, OpS390XMOVDaddridx}: OpS390XFMOVDstoreidx, + [2]Op{OpS390XFMOVSstore, OpS390XMOVDaddridx}: OpS390XFMOVSstoreidx, } diff --git a/src/cmd/compile/internal/ssa/check.go b/src/cmd/compile/internal/ssa/check.go index 98e1b79334..828f645b39 100644 --- a/src/cmd/compile/internal/ssa/check.go +++ b/src/cmd/compile/internal/ssa/check.go @@ -171,10 +171,10 @@ func checkFunc(f *Func) { canHaveAuxInt = true canHaveAux = true case auxCCop: - if _, ok := v.Aux.(Op); !ok { - f.Fatalf("bad type %T for CCop in %v", v.Aux, v) + if opcodeTable[Op(v.AuxInt)].name == "OpInvalid" { + f.Fatalf("value %v has an AuxInt value that is a valid opcode", v) } - canHaveAux = true + canHaveAuxInt = true case auxS390XCCMask: if _, ok := v.Aux.(s390x.CCMask); !ok { f.Fatalf("bad type %T for S390XCCMask in %v", v.Aux, v) diff --git a/src/cmd/compile/internal/ssa/decompose.go b/src/cmd/compile/internal/ssa/decompose.go index c59ec4c77d..ab27ba85ae 100644 --- a/src/cmd/compile/internal/ssa/decompose.go +++ b/src/cmd/compile/internal/ssa/decompose.go @@ -23,9 +23,11 @@ func decomposeBuiltIn(f *Func) { } // Decompose other values - applyRewrite(f, rewriteBlockdec, rewriteValuedec) + // Note: deadcode is false because we need to keep the original + // values around so the name component resolution below can still work. + applyRewrite(f, rewriteBlockdec, rewriteValuedec, leaveDeadValues) if f.Config.RegSize == 4 { - applyRewrite(f, rewriteBlockdec64, rewriteValuedec64) + applyRewrite(f, rewriteBlockdec64, rewriteValuedec64, leaveDeadValues) } // Split up named values into their components. @@ -139,7 +141,7 @@ func decomposeStringPhi(v *Value) { func decomposeSlicePhi(v *Value) { types := &v.Block.Func.Config.Types - ptrType := types.BytePtr + ptrType := v.Type.Elem().PtrTo() lenType := types.Int ptr := v.Block.NewValue0(v.Pos, OpPhi, ptrType) @@ -215,7 +217,7 @@ func decomposeInterfacePhi(v *Value) { } func decomposeArgs(f *Func) { - applyRewrite(f, rewriteBlockdecArgs, rewriteValuedecArgs) + applyRewrite(f, rewriteBlockdecArgs, rewriteValuedecArgs, removeDeadValues) } func decomposeUser(f *Func) { diff --git a/src/cmd/compile/internal/ssa/func.go b/src/cmd/compile/internal/ssa/func.go index 6718b778e1..32df0c06f3 100644 --- a/src/cmd/compile/internal/ssa/func.go +++ b/src/cmd/compile/internal/ssa/func.go @@ -257,6 +257,49 @@ func (f *Func) LogStat(key string, args ...interface{}) { f.Warnl(f.Entry.Pos, "\t%s\t%s%s\t%s", n, key, value, f.Name) } +// unCacheLine removes v from f's constant cache "line" for aux, +// resets v.InCache when it is found (and removed), +// and returns whether v was found in that line. +func (f *Func) unCacheLine(v *Value, aux int64) bool { + vv := f.constants[aux] + for i, cv := range vv { + if v == cv { + vv[i] = vv[len(vv)-1] + vv[len(vv)-1] = nil + f.constants[aux] = vv[0 : len(vv)-1] + v.InCache = false + return true + } + } + return false +} + +// unCache removes v from f's constant cache. +func (f *Func) unCache(v *Value) { + if v.InCache { + aux := v.AuxInt + if f.unCacheLine(v, aux) { + return + } + if aux == 0 { + switch v.Op { + case OpConstNil: + aux = constNilMagic + case OpConstSlice: + aux = constSliceMagic + case OpConstString: + aux = constEmptyStringMagic + case OpConstInterface: + aux = constInterfaceMagic + } + if aux != 0 && f.unCacheLine(v, aux) { + return + } + } + f.Fatalf("unCached value %s not found in cache, auxInt=0x%x, adjusted aux=0x%x", v.LongString(), v.AuxInt, aux) + } +} + // freeValue frees a value. It must no longer be referenced or have any args. func (f *Func) freeValue(v *Value) { if v.Block == nil { @@ -270,19 +313,8 @@ func (f *Func) freeValue(v *Value) { } // Clear everything but ID (which we reuse). id := v.ID - - // Values with zero arguments and OpOffPtr values might be cached, so remove them there. - nArgs := opcodeTable[v.Op].argLen - if nArgs == 0 || v.Op == OpOffPtr { - vv := f.constants[v.AuxInt] - for i, cv := range vv { - if v == cv { - vv[i] = vv[len(vv)-1] - vv[len(vv)-1] = nil - f.constants[v.AuxInt] = vv[0 : len(vv)-1] - break - } - } + if v.InCache { + f.unCache(v) } *v = Value{} v.ID = id @@ -548,6 +580,7 @@ func (f *Func) constVal(op Op, t *types.Type, c int64, setAuxInt bool) *Value { v = f.Entry.NewValue0(src.NoXPos, op, t) } f.constants[c] = append(vv, v) + v.InCache = true return v } diff --git a/src/cmd/compile/internal/ssa/gen/AMD64.rules b/src/cmd/compile/internal/ssa/gen/AMD64.rules index 5111ef79d3..8898fe55eb 100644 --- a/src/cmd/compile/internal/ssa/gen/AMD64.rules +++ b/src/cmd/compile/internal/ssa/gen/AMD64.rules @@ -436,69 +436,69 @@ // Absorb InvertFlags (CMOVQ(EQ|NE|LT|GT|LE|GE|HI|CS|CC|LS) x y (InvertFlags cond)) - -> (CMOVQ(EQ|NE|GT|LT|GE|LE|CS|HI|LS|CC) x y cond) + => (CMOVQ(EQ|NE|GT|LT|GE|LE|CS|HI|LS|CC) x y cond) (CMOVL(EQ|NE|LT|GT|LE|GE|HI|CS|CC|LS) x y (InvertFlags cond)) - -> (CMOVL(EQ|NE|GT|LT|GE|LE|CS|HI|LS|CC) x y cond) + => (CMOVL(EQ|NE|GT|LT|GE|LE|CS|HI|LS|CC) x y cond) (CMOVW(EQ|NE|LT|GT|LE|GE|HI|CS|CC|LS) x y (InvertFlags cond)) - -> (CMOVW(EQ|NE|GT|LT|GE|LE|CS|HI|LS|CC) x y cond) + => (CMOVW(EQ|NE|GT|LT|GE|LE|CS|HI|LS|CC) x y cond) // Absorb constants generated during lower -(CMOV(QEQ|QLE|QGE|QCC|QLS|LEQ|LLE|LGE|LCC|LLS|WEQ|WLE|WGE|WCC|WLS) _ x (FlagEQ)) -> x -(CMOV(QNE|QLT|QGT|QCS|QHI|LNE|LLT|LGT|LCS|LHI|WNE|WLT|WGT|WCS|WHI) y _ (FlagEQ)) -> y -(CMOV(QNE|QGT|QGE|QHI|QCC|LNE|LGT|LGE|LHI|LCC|WNE|WGT|WGE|WHI|WCC) _ x (FlagGT_UGT)) -> x -(CMOV(QEQ|QLE|QLT|QLS|QCS|LEQ|LLE|LLT|LLS|LCS|WEQ|WLE|WLT|WLS|WCS) y _ (FlagGT_UGT)) -> y -(CMOV(QNE|QGT|QGE|QLS|QCS|LNE|LGT|LGE|LLS|LCS|WNE|WGT|WGE|WLS|WCS) _ x (FlagGT_ULT)) -> x -(CMOV(QEQ|QLE|QLT|QHI|QCC|LEQ|LLE|LLT|LHI|LCC|WEQ|WLE|WLT|WHI|WCC) y _ (FlagGT_ULT)) -> y -(CMOV(QNE|QLT|QLE|QCS|QLS|LNE|LLT|LLE|LCS|LLS|WNE|WLT|WLE|WCS|WLS) _ x (FlagLT_ULT)) -> x -(CMOV(QEQ|QGT|QGE|QHI|QCC|LEQ|LGT|LGE|LHI|LCC|WEQ|WGT|WGE|WHI|WCC) y _ (FlagLT_ULT)) -> y -(CMOV(QNE|QLT|QLE|QHI|QCC|LNE|LLT|LLE|LHI|LCC|WNE|WLT|WLE|WHI|WCC) _ x (FlagLT_UGT)) -> x -(CMOV(QEQ|QGT|QGE|QCS|QLS|LEQ|LGT|LGE|LCS|LLS|WEQ|WGT|WGE|WCS|WLS) y _ (FlagLT_UGT)) -> y +(CMOV(QEQ|QLE|QGE|QCC|QLS|LEQ|LLE|LGE|LCC|LLS|WEQ|WLE|WGE|WCC|WLS) _ x (FlagEQ)) => x +(CMOV(QNE|QLT|QGT|QCS|QHI|LNE|LLT|LGT|LCS|LHI|WNE|WLT|WGT|WCS|WHI) y _ (FlagEQ)) => y +(CMOV(QNE|QGT|QGE|QHI|QCC|LNE|LGT|LGE|LHI|LCC|WNE|WGT|WGE|WHI|WCC) _ x (FlagGT_UGT)) => x +(CMOV(QEQ|QLE|QLT|QLS|QCS|LEQ|LLE|LLT|LLS|LCS|WEQ|WLE|WLT|WLS|WCS) y _ (FlagGT_UGT)) => y +(CMOV(QNE|QGT|QGE|QLS|QCS|LNE|LGT|LGE|LLS|LCS|WNE|WGT|WGE|WLS|WCS) _ x (FlagGT_ULT)) => x +(CMOV(QEQ|QLE|QLT|QHI|QCC|LEQ|LLE|LLT|LHI|LCC|WEQ|WLE|WLT|WHI|WCC) y _ (FlagGT_ULT)) => y +(CMOV(QNE|QLT|QLE|QCS|QLS|LNE|LLT|LLE|LCS|LLS|WNE|WLT|WLE|WCS|WLS) _ x (FlagLT_ULT)) => x +(CMOV(QEQ|QGT|QGE|QHI|QCC|LEQ|LGT|LGE|LHI|LCC|WEQ|WGT|WGE|WHI|WCC) y _ (FlagLT_ULT)) => y +(CMOV(QNE|QLT|QLE|QHI|QCC|LNE|LLT|LLE|LHI|LCC|WNE|WLT|WLE|WHI|WCC) _ x (FlagLT_UGT)) => x +(CMOV(QEQ|QGT|QGE|QCS|QLS|LEQ|LGT|LGE|LCS|LLS|WEQ|WGT|WGE|WCS|WLS) y _ (FlagLT_UGT)) => y // Miscellaneous -(IsNonNil p) -> (SETNE (TESTQ p p)) -(IsInBounds idx len) -> (SETB (CMPQ idx len)) -(IsSliceInBounds idx len) -> (SETBE (CMPQ idx len)) -(NilCheck ...) -> (LoweredNilCheck ...) -(GetG ...) -> (LoweredGetG ...) -(GetClosurePtr ...) -> (LoweredGetClosurePtr ...) -(GetCallerPC ...) -> (LoweredGetCallerPC ...) -(GetCallerSP ...) -> (LoweredGetCallerSP ...) - -(HasCPUFeature {s}) -> (SETNE (CMPQconst [0] (LoweredHasCPUFeature {s}))) +(IsNonNil p) => (SETNE (TESTQ p p)) +(IsInBounds idx len) => (SETB (CMPQ idx len)) +(IsSliceInBounds idx len) => (SETBE (CMPQ idx len)) +(NilCheck ...) => (LoweredNilCheck ...) +(GetG ...) => (LoweredGetG ...) +(GetClosurePtr ...) => (LoweredGetClosurePtr ...) +(GetCallerPC ...) => (LoweredGetCallerPC ...) +(GetCallerSP ...) => (LoweredGetCallerSP ...) + +(HasCPUFeature {s}) => (SETNE (CMPQconst [0] (LoweredHasCPUFeature {s}))) (Addr ...) -> (LEAQ ...) -(LocalAddr {sym} base _) -> (LEAQ {sym} base) - -(MOVBstore [off] {sym} ptr y:(SETL x) mem) && y.Uses == 1 -> (SETLstore [off] {sym} ptr x mem) -(MOVBstore [off] {sym} ptr y:(SETLE x) mem) && y.Uses == 1 -> (SETLEstore [off] {sym} ptr x mem) -(MOVBstore [off] {sym} ptr y:(SETG x) mem) && y.Uses == 1 -> (SETGstore [off] {sym} ptr x mem) -(MOVBstore [off] {sym} ptr y:(SETGE x) mem) && y.Uses == 1 -> (SETGEstore [off] {sym} ptr x mem) -(MOVBstore [off] {sym} ptr y:(SETEQ x) mem) && y.Uses == 1 -> (SETEQstore [off] {sym} ptr x mem) -(MOVBstore [off] {sym} ptr y:(SETNE x) mem) && y.Uses == 1 -> (SETNEstore [off] {sym} ptr x mem) -(MOVBstore [off] {sym} ptr y:(SETB x) mem) && y.Uses == 1 -> (SETBstore [off] {sym} ptr x mem) -(MOVBstore [off] {sym} ptr y:(SETBE x) mem) && y.Uses == 1 -> (SETBEstore [off] {sym} ptr x mem) -(MOVBstore [off] {sym} ptr y:(SETA x) mem) && y.Uses == 1 -> (SETAstore [off] {sym} ptr x mem) -(MOVBstore [off] {sym} ptr y:(SETAE x) mem) && y.Uses == 1 -> (SETAEstore [off] {sym} ptr x mem) +(LocalAddr {sym} base _) => (LEAQ {sym} base) + +(MOVBstore [off] {sym} ptr y:(SETL x) mem) && y.Uses == 1 => (SETLstore [off] {sym} ptr x mem) +(MOVBstore [off] {sym} ptr y:(SETLE x) mem) && y.Uses == 1 => (SETLEstore [off] {sym} ptr x mem) +(MOVBstore [off] {sym} ptr y:(SETG x) mem) && y.Uses == 1 => (SETGstore [off] {sym} ptr x mem) +(MOVBstore [off] {sym} ptr y:(SETGE x) mem) && y.Uses == 1 => (SETGEstore [off] {sym} ptr x mem) +(MOVBstore [off] {sym} ptr y:(SETEQ x) mem) && y.Uses == 1 => (SETEQstore [off] {sym} ptr x mem) +(MOVBstore [off] {sym} ptr y:(SETNE x) mem) && y.Uses == 1 => (SETNEstore [off] {sym} ptr x mem) +(MOVBstore [off] {sym} ptr y:(SETB x) mem) && y.Uses == 1 => (SETBstore [off] {sym} ptr x mem) +(MOVBstore [off] {sym} ptr y:(SETBE x) mem) && y.Uses == 1 => (SETBEstore [off] {sym} ptr x mem) +(MOVBstore [off] {sym} ptr y:(SETA x) mem) && y.Uses == 1 => (SETAstore [off] {sym} ptr x mem) +(MOVBstore [off] {sym} ptr y:(SETAE x) mem) && y.Uses == 1 => (SETAEstore [off] {sym} ptr x mem) // block rewrites -(If (SETL cmp) yes no) -> (LT cmp yes no) -(If (SETLE cmp) yes no) -> (LE cmp yes no) -(If (SETG cmp) yes no) -> (GT cmp yes no) -(If (SETGE cmp) yes no) -> (GE cmp yes no) -(If (SETEQ cmp) yes no) -> (EQ cmp yes no) -(If (SETNE cmp) yes no) -> (NE cmp yes no) -(If (SETB cmp) yes no) -> (ULT cmp yes no) -(If (SETBE cmp) yes no) -> (ULE cmp yes no) -(If (SETA cmp) yes no) -> (UGT cmp yes no) -(If (SETAE cmp) yes no) -> (UGE cmp yes no) -(If (SETO cmp) yes no) -> (OS cmp yes no) +(If (SETL cmp) yes no) => (LT cmp yes no) +(If (SETLE cmp) yes no) => (LE cmp yes no) +(If (SETG cmp) yes no) => (GT cmp yes no) +(If (SETGE cmp) yes no) => (GE cmp yes no) +(If (SETEQ cmp) yes no) => (EQ cmp yes no) +(If (SETNE cmp) yes no) => (NE cmp yes no) +(If (SETB cmp) yes no) => (ULT cmp yes no) +(If (SETBE cmp) yes no) => (ULE cmp yes no) +(If (SETA cmp) yes no) => (UGT cmp yes no) +(If (SETAE cmp) yes no) => (UGE cmp yes no) +(If (SETO cmp) yes no) => (OS cmp yes no) // Special case for floating point - LF/LEF not generated -(If (SETGF cmp) yes no) -> (UGT cmp yes no) -(If (SETGEF cmp) yes no) -> (UGE cmp yes no) -(If (SETEQF cmp) yes no) -> (EQF cmp yes no) -(If (SETNEF cmp) yes no) -> (NEF cmp yes no) +(If (SETGF cmp) yes no) => (UGT cmp yes no) +(If (SETGEF cmp) yes no) => (UGE cmp yes no) +(If (SETEQF cmp) yes no) => (EQF cmp yes no) +(If (SETNEF cmp) yes no) => (NEF cmp yes no) -(If cond yes no) -> (NE (TESTB cond cond) yes no) +(If cond yes no) => (NE (TESTB cond cond) yes no) // Atomic loads. Other than preserving their ordering with respect to other loads, nothing special here. (AtomicLoad8 ...) -> (MOVBatomicload ...) @@ -508,22 +508,22 @@ // Atomic stores. We use XCHG to prevent the hardware reordering a subsequent load. // TODO: most runtime uses of atomic stores don't need that property. Use normal stores for those? -(AtomicStore8 ptr val mem) -> (Select1 (XCHGB <types.NewTuple(typ.UInt8,types.TypeMem)> val ptr mem)) -(AtomicStore32 ptr val mem) -> (Select1 (XCHGL <types.NewTuple(typ.UInt32,types.TypeMem)> val ptr mem)) -(AtomicStore64 ptr val mem) -> (Select1 (XCHGQ <types.NewTuple(typ.UInt64,types.TypeMem)> val ptr mem)) -(AtomicStorePtrNoWB ptr val mem) -> (Select1 (XCHGQ <types.NewTuple(typ.BytePtr,types.TypeMem)> val ptr mem)) +(AtomicStore8 ptr val mem) => (Select1 (XCHGB <types.NewTuple(typ.UInt8,types.TypeMem)> val ptr mem)) +(AtomicStore32 ptr val mem) => (Select1 (XCHGL <types.NewTuple(typ.UInt32,types.TypeMem)> val ptr mem)) +(AtomicStore64 ptr val mem) => (Select1 (XCHGQ <types.NewTuple(typ.UInt64,types.TypeMem)> val ptr mem)) +(AtomicStorePtrNoWB ptr val mem) => (Select1 (XCHGQ <types.NewTuple(typ.BytePtr,types.TypeMem)> val ptr mem)) // Atomic exchanges. -(AtomicExchange32 ptr val mem) -> (XCHGL val ptr mem) -(AtomicExchange64 ptr val mem) -> (XCHGQ val ptr mem) +(AtomicExchange32 ptr val mem) => (XCHGL val ptr mem) +(AtomicExchange64 ptr val mem) => (XCHGQ val ptr mem) // Atomic adds. -(AtomicAdd32 ptr val mem) -> (AddTupleFirst32 val (XADDLlock val ptr mem)) -(AtomicAdd64 ptr val mem) -> (AddTupleFirst64 val (XADDQlock val ptr mem)) -(Select0 <t> (AddTupleFirst32 val tuple)) -> (ADDL val (Select0 <t> tuple)) -(Select1 (AddTupleFirst32 _ tuple)) -> (Select1 tuple) -(Select0 <t> (AddTupleFirst64 val tuple)) -> (ADDQ val (Select0 <t> tuple)) -(Select1 (AddTupleFirst64 _ tuple)) -> (Select1 tuple) +(AtomicAdd32 ptr val mem) => (AddTupleFirst32 val (XADDLlock val ptr mem)) +(AtomicAdd64 ptr val mem) => (AddTupleFirst64 val (XADDQlock val ptr mem)) +(Select0 <t> (AddTupleFirst32 val tuple)) => (ADDL val (Select0 <t> tuple)) +(Select1 (AddTupleFirst32 _ tuple)) => (Select1 tuple) +(Select0 <t> (AddTupleFirst64 val tuple)) => (ADDQ val (Select0 <t> tuple)) +(Select1 (AddTupleFirst64 _ tuple)) => (Select1 tuple) // Atomic compare and swap. (AtomicCompareAndSwap32 ...) -> (CMPXCHGLlock ...) @@ -536,9 +536,9 @@ // Write barrier. (WB ...) -> (LoweredWB ...) -(PanicBounds [kind] x y mem) && boundsABI(kind) == 0 -> (LoweredPanicBoundsA [kind] x y mem) -(PanicBounds [kind] x y mem) && boundsABI(kind) == 1 -> (LoweredPanicBoundsB [kind] x y mem) -(PanicBounds [kind] x y mem) && boundsABI(kind) == 2 -> (LoweredPanicBoundsC [kind] x y mem) +(PanicBounds [kind] x y mem) && boundsABI(kind) == 0 => (LoweredPanicBoundsA [kind] x y mem) +(PanicBounds [kind] x y mem) && boundsABI(kind) == 1 => (LoweredPanicBoundsB [kind] x y mem) +(PanicBounds [kind] x y mem) && boundsABI(kind) == 2 => (LoweredPanicBoundsC [kind] x y mem) // *************************** // Above: lowering rules @@ -547,23 +547,23 @@ // TODO: Should the optimizations be a separate pass? // Fold boolean tests into blocks -(NE (TESTB (SETL cmp) (SETL cmp)) yes no) -> (LT cmp yes no) -(NE (TESTB (SETLE cmp) (SETLE cmp)) yes no) -> (LE cmp yes no) -(NE (TESTB (SETG cmp) (SETG cmp)) yes no) -> (GT cmp yes no) -(NE (TESTB (SETGE cmp) (SETGE cmp)) yes no) -> (GE cmp yes no) -(NE (TESTB (SETEQ cmp) (SETEQ cmp)) yes no) -> (EQ cmp yes no) -(NE (TESTB (SETNE cmp) (SETNE cmp)) yes no) -> (NE cmp yes no) -(NE (TESTB (SETB cmp) (SETB cmp)) yes no) -> (ULT cmp yes no) -(NE (TESTB (SETBE cmp) (SETBE cmp)) yes no) -> (ULE cmp yes no) -(NE (TESTB (SETA cmp) (SETA cmp)) yes no) -> (UGT cmp yes no) -(NE (TESTB (SETAE cmp) (SETAE cmp)) yes no) -> (UGE cmp yes no) -(NE (TESTB (SETO cmp) (SETO cmp)) yes no) -> (OS cmp yes no) +(NE (TESTB (SETL cmp) (SETL cmp)) yes no) => (LT cmp yes no) +(NE (TESTB (SETLE cmp) (SETLE cmp)) yes no) => (LE cmp yes no) +(NE (TESTB (SETG cmp) (SETG cmp)) yes no) => (GT cmp yes no) +(NE (TESTB (SETGE cmp) (SETGE cmp)) yes no) => (GE cmp yes no) +(NE (TESTB (SETEQ cmp) (SETEQ cmp)) yes no) => (EQ cmp yes no) +(NE (TESTB (SETNE cmp) (SETNE cmp)) yes no) => (NE cmp yes no) +(NE (TESTB (SETB cmp) (SETB cmp)) yes no) => (ULT cmp yes no) +(NE (TESTB (SETBE cmp) (SETBE cmp)) yes no) => (ULE cmp yes no) +(NE (TESTB (SETA cmp) (SETA cmp)) yes no) => (UGT cmp yes no) +(NE (TESTB (SETAE cmp) (SETAE cmp)) yes no) => (UGE cmp yes no) +(NE (TESTB (SETO cmp) (SETO cmp)) yes no) => (OS cmp yes no) // Unsigned comparisons to 0/1 -(ULT (TEST(Q|L|W|B) x x) yes no) -> (First no yes) -(UGE (TEST(Q|L|W|B) x x) yes no) -> (First yes no) -(SETB (TEST(Q|L|W|B) x x)) -> (ConstBool [0]) -(SETAE (TEST(Q|L|W|B) x x)) -> (ConstBool [1]) +(ULT (TEST(Q|L|W|B) x x) yes no) => (First no yes) +(UGE (TEST(Q|L|W|B) x x) yes no) => (First yes no) +(SETB (TEST(Q|L|W|B) x x)) => (ConstBool [false]) +(SETAE (TEST(Q|L|W|B) x x)) => (ConstBool [true]) // x & 1 != 0 -> x & 1 (SETNE (TEST(B|W)const [1] x)) => (AND(L|L)const [1] x) @@ -574,75 +574,75 @@ // into tests for carry flags. // ULT and SETB check the carry flag; they are identical to CS and SETCS. Same, mutatis // mutandis, for UGE and SETAE, and CC and SETCC. -((NE|EQ) (TESTL (SHLL (MOVLconst [1]) x) y)) -> ((ULT|UGE) (BTL x y)) -((NE|EQ) (TESTQ (SHLQ (MOVQconst [1]) x) y)) -> ((ULT|UGE) (BTQ x y)) -((NE|EQ) (TESTLconst [c] x)) && isUint32PowerOfTwo(c) - -> ((ULT|UGE) (BTLconst [log2uint32(c)] x)) -((NE|EQ) (TESTQconst [c] x)) && isUint64PowerOfTwo(c) - -> ((ULT|UGE) (BTQconst [log2(c)] x)) +((NE|EQ) (TESTL (SHLL (MOVLconst [1]) x) y)) => ((ULT|UGE) (BTL x y)) +((NE|EQ) (TESTQ (SHLQ (MOVQconst [1]) x) y)) => ((ULT|UGE) (BTQ x y)) +((NE|EQ) (TESTLconst [c] x)) && isUint32PowerOfTwo(int64(c)) + => ((ULT|UGE) (BTLconst [int8(log32(c))] x)) +((NE|EQ) (TESTQconst [c] x)) && isUint64PowerOfTwo(int64(c)) + => ((ULT|UGE) (BTQconst [int8(log32(c))] x)) ((NE|EQ) (TESTQ (MOVQconst [c]) x)) && isUint64PowerOfTwo(c) - -> ((ULT|UGE) (BTQconst [log2(c)] x)) -(SET(NE|EQ) (TESTL (SHLL (MOVLconst [1]) x) y)) -> (SET(B|AE) (BTL x y)) -(SET(NE|EQ) (TESTQ (SHLQ (MOVQconst [1]) x) y)) -> (SET(B|AE) (BTQ x y)) -(SET(NE|EQ) (TESTLconst [c] x)) && isUint32PowerOfTwo(c) - -> (SET(B|AE) (BTLconst [log2uint32(c)] x)) -(SET(NE|EQ) (TESTQconst [c] x)) && isUint64PowerOfTwo(c) - -> (SET(B|AE) (BTQconst [log2(c)] x)) + => ((ULT|UGE) (BTQconst [int8(log2(c))] x)) +(SET(NE|EQ) (TESTL (SHLL (MOVLconst [1]) x) y)) => (SET(B|AE) (BTL x y)) +(SET(NE|EQ) (TESTQ (SHLQ (MOVQconst [1]) x) y)) => (SET(B|AE) (BTQ x y)) +(SET(NE|EQ) (TESTLconst [c] x)) && isUint32PowerOfTwo(int64(c)) + => (SET(B|AE) (BTLconst [int8(log32(c))] x)) +(SET(NE|EQ) (TESTQconst [c] x)) && isUint64PowerOfTwo(int64(c)) + => (SET(B|AE) (BTQconst [int8(log32(c))] x)) (SET(NE|EQ) (TESTQ (MOVQconst [c]) x)) && isUint64PowerOfTwo(c) - -> (SET(B|AE) (BTQconst [log2(c)] x)) + => (SET(B|AE) (BTQconst [int8(log2(c))] x)) // SET..store variant (SET(NE|EQ)store [off] {sym} ptr (TESTL (SHLL (MOVLconst [1]) x) y) mem) - -> (SET(B|AE)store [off] {sym} ptr (BTL x y) mem) + => (SET(B|AE)store [off] {sym} ptr (BTL x y) mem) (SET(NE|EQ)store [off] {sym} ptr (TESTQ (SHLQ (MOVQconst [1]) x) y) mem) - -> (SET(B|AE)store [off] {sym} ptr (BTQ x y) mem) -(SET(NE|EQ)store [off] {sym} ptr (TESTLconst [c] x) mem) && isUint32PowerOfTwo(c) - -> (SET(B|AE)store [off] {sym} ptr (BTLconst [log2uint32(c)] x) mem) -(SET(NE|EQ)store [off] {sym} ptr (TESTQconst [c] x) mem) && isUint64PowerOfTwo(c) - -> (SET(B|AE)store [off] {sym} ptr (BTQconst [log2(c)] x) mem) + => (SET(B|AE)store [off] {sym} ptr (BTQ x y) mem) +(SET(NE|EQ)store [off] {sym} ptr (TESTLconst [c] x) mem) && isUint32PowerOfTwo(int64(c)) + => (SET(B|AE)store [off] {sym} ptr (BTLconst [int8(log32(c))] x) mem) +(SET(NE|EQ)store [off] {sym} ptr (TESTQconst [c] x) mem) && isUint64PowerOfTwo(int64(c)) + => (SET(B|AE)store [off] {sym} ptr (BTQconst [int8(log32(c))] x) mem) (SET(NE|EQ)store [off] {sym} ptr (TESTQ (MOVQconst [c]) x) mem) && isUint64PowerOfTwo(c) - -> (SET(B|AE)store [off] {sym} ptr (BTQconst [log2(c)] x) mem) + => (SET(B|AE)store [off] {sym} ptr (BTQconst [int8(log2(c))] x) mem) // Handle bit-testing in the form (a>>b)&1 != 0 by building the above rules // and further combining shifts. -(BT(Q|L)const [c] (SHRQconst [d] x)) && (c+d)<64 -> (BTQconst [c+d] x) -(BT(Q|L)const [c] (SHLQconst [d] x)) && c>d -> (BT(Q|L)const [c-d] x) -(BT(Q|L)const [0] s:(SHRQ x y)) -> (BTQ y x) -(BTLconst [c] (SHRLconst [d] x)) && (c+d)<32 -> (BTLconst [c+d] x) -(BTLconst [c] (SHLLconst [d] x)) && c>d -> (BTLconst [c-d] x) -(BTLconst [0] s:(SHRL x y)) -> (BTL y x) +(BT(Q|L)const [c] (SHRQconst [d] x)) && (c+d)<64 => (BTQconst [c+d] x) +(BT(Q|L)const [c] (SHLQconst [d] x)) && c>d => (BT(Q|L)const [c-d] x) +(BT(Q|L)const [0] s:(SHRQ x y)) => (BTQ y x) +(BTLconst [c] (SHRLconst [d] x)) && (c+d)<32 => (BTLconst [c+d] x) +(BTLconst [c] (SHLLconst [d] x)) && c>d => (BTLconst [c-d] x) +(BTLconst [0] s:(SHRL x y)) => (BTL y x) // Rewrite a & 1 != 1 into a & 1 == 0. // Among other things, this lets us turn (a>>b)&1 != 1 into a bit test. -(SET(NE|EQ) (CMPLconst [1] s:(ANDLconst [1] _))) -> (SET(EQ|NE) (CMPLconst [0] s)) -(SET(NE|EQ)store [off] {sym} ptr (CMPLconst [1] s:(ANDLconst [1] _)) mem) -> (SET(EQ|NE)store [off] {sym} ptr (CMPLconst [0] s) mem) -(SET(NE|EQ) (CMPQconst [1] s:(ANDQconst [1] _))) -> (SET(EQ|NE) (CMPQconst [0] s)) -(SET(NE|EQ)store [off] {sym} ptr (CMPQconst [1] s:(ANDQconst [1] _)) mem) -> (SET(EQ|NE)store [off] {sym} ptr (CMPQconst [0] s) mem) +(SET(NE|EQ) (CMPLconst [1] s:(ANDLconst [1] _))) => (SET(EQ|NE) (CMPLconst [0] s)) +(SET(NE|EQ)store [off] {sym} ptr (CMPLconst [1] s:(ANDLconst [1] _)) mem) => (SET(EQ|NE)store [off] {sym} ptr (CMPLconst [0] s) mem) +(SET(NE|EQ) (CMPQconst [1] s:(ANDQconst [1] _))) => (SET(EQ|NE) (CMPQconst [0] s)) +(SET(NE|EQ)store [off] {sym} ptr (CMPQconst [1] s:(ANDQconst [1] _)) mem) => (SET(EQ|NE)store [off] {sym} ptr (CMPQconst [0] s) mem) // Recognize bit setting (a |= 1<<b) and toggling (a ^= 1<<b) -(OR(Q|L) (SHL(Q|L) (MOV(Q|L)const [1]) y) x) -> (BTS(Q|L) x y) -(XOR(Q|L) (SHL(Q|L) (MOV(Q|L)const [1]) y) x) -> (BTC(Q|L) x y) +(OR(Q|L) (SHL(Q|L) (MOV(Q|L)const [1]) y) x) => (BTS(Q|L) x y) +(XOR(Q|L) (SHL(Q|L) (MOV(Q|L)const [1]) y) x) => (BTC(Q|L) x y) // Convert ORconst into BTS, if the code gets smaller, with boundary being // (ORL $40,AX is 3 bytes, ORL $80,AX is 6 bytes). -((ORQ|XORQ)const [c] x) && isUint64PowerOfTwo(c) && uint64(c) >= 128 - -> (BT(S|C)Qconst [log2(c)] x) -((ORL|XORL)const [c] x) && isUint32PowerOfTwo(c) && uint64(c) >= 128 - -> (BT(S|C)Lconst [log2uint32(c)] x) +((ORQ|XORQ)const [c] x) && isUint64PowerOfTwo(int64(c)) && uint64(c) >= 128 + => (BT(S|C)Qconst [int8(log32(c))] x) +((ORL|XORL)const [c] x) && isUint32PowerOfTwo(int64(c)) && uint64(c) >= 128 + => (BT(S|C)Lconst [int8(log32(c))] x) ((ORQ|XORQ) (MOVQconst [c]) x) && isUint64PowerOfTwo(c) && uint64(c) >= 128 - -> (BT(S|C)Qconst [log2(c)] x) -((ORL|XORL) (MOVLconst [c]) x) && isUint32PowerOfTwo(c) && uint64(c) >= 128 - -> (BT(S|C)Lconst [log2uint32(c)] x) + => (BT(S|C)Qconst [int8(log2(c))] x) +((ORL|XORL) (MOVLconst [c]) x) && isUint32PowerOfTwo(int64(c)) && uint64(c) >= 128 + => (BT(S|C)Lconst [int8(log32(c))] x) // Recognize bit clearing: a &^= 1<<b -(AND(Q|L) (NOT(Q|L) (SHL(Q|L) (MOV(Q|L)const [1]) y)) x) -> (BTR(Q|L) x y) -(ANDQconst [c] x) && isUint64PowerOfTwo(^c) && uint64(^c) >= 128 - -> (BTRQconst [log2(^c)] x) -(ANDLconst [c] x) && isUint32PowerOfTwo(^c) && uint64(^c) >= 128 - -> (BTRLconst [log2uint32(^c)] x) +(AND(Q|L) (NOT(Q|L) (SHL(Q|L) (MOV(Q|L)const [1]) y)) x) => (BTR(Q|L) x y) +(ANDQconst [c] x) && isUint64PowerOfTwo(int64(^c)) && uint64(^c) >= 128 + => (BTRQconst [int8(log32(^c))] x) +(ANDLconst [c] x) && isUint32PowerOfTwo(int64(^c)) && uint64(^c) >= 128 + => (BTRLconst [int8(log32(^c))] x) (ANDQ (MOVQconst [c]) x) && isUint64PowerOfTwo(^c) && uint64(^c) >= 128 - -> (BTRQconst [log2(^c)] x) -(ANDL (MOVLconst [c]) x) && isUint32PowerOfTwo(^c) && uint64(^c) >= 128 - -> (BTRLconst [log2uint32(^c)] x) + => (BTRQconst [int8(log2(^c))] x) +(ANDL (MOVLconst [c]) x) && isUint32PowerOfTwo(int64(^c)) && uint64(^c) >= 128 + => (BTRLconst [int8(log32(^c))] x) // Special-case bit patterns on first/last bit. // generic.rules changes ANDs of high-part/low-part masks into a couple of shifts, @@ -656,84 +656,84 @@ // Special case resetting first/last bit (SHL(L|Q)const [1] (SHR(L|Q)const [1] x)) - -> (BTR(L|Q)const [0] x) + => (BTR(L|Q)const [0] x) (SHRLconst [1] (SHLLconst [1] x)) - -> (BTRLconst [31] x) + => (BTRLconst [31] x) (SHRQconst [1] (SHLQconst [1] x)) - -> (BTRQconst [63] x) + => (BTRQconst [63] x) // Special case testing first/last bit (with double-shift generated by generic.rules) ((SETNE|SETEQ|NE|EQ) (TESTQ z1:(SHLQconst [63] (SHRQconst [63] x)) z2)) && z1==z2 - -> ((SETB|SETAE|ULT|UGE) (BTQconst [63] x)) + => ((SETB|SETAE|ULT|UGE) (BTQconst [63] x)) ((SETNE|SETEQ|NE|EQ) (TESTL z1:(SHLLconst [31] (SHRQconst [31] x)) z2)) && z1==z2 - -> ((SETB|SETAE|ULT|UGE) (BTQconst [31] x)) + => ((SETB|SETAE|ULT|UGE) (BTQconst [31] x)) (SET(NE|EQ)store [off] {sym} ptr (TESTQ z1:(SHLQconst [63] (SHRQconst [63] x)) z2) mem) && z1==z2 - -> (SET(B|AE)store [off] {sym} ptr (BTQconst [63] x) mem) + => (SET(B|AE)store [off] {sym} ptr (BTQconst [63] x) mem) (SET(NE|EQ)store [off] {sym} ptr (TESTL z1:(SHLLconst [31] (SHRLconst [31] x)) z2) mem) && z1==z2 - -> (SET(B|AE)store [off] {sym} ptr (BTLconst [31] x) mem) + => (SET(B|AE)store [off] {sym} ptr (BTLconst [31] x) mem) ((SETNE|SETEQ|NE|EQ) (TESTQ z1:(SHRQconst [63] (SHLQconst [63] x)) z2)) && z1==z2 - -> ((SETB|SETAE|ULT|UGE) (BTQconst [0] x)) + => ((SETB|SETAE|ULT|UGE) (BTQconst [0] x)) ((SETNE|SETEQ|NE|EQ) (TESTL z1:(SHRLconst [31] (SHLLconst [31] x)) z2)) && z1==z2 - -> ((SETB|SETAE|ULT|UGE) (BTLconst [0] x)) + => ((SETB|SETAE|ULT|UGE) (BTLconst [0] x)) (SET(NE|EQ)store [off] {sym} ptr (TESTQ z1:(SHRQconst [63] (SHLQconst [63] x)) z2) mem) && z1==z2 - -> (SET(B|AE)store [off] {sym} ptr (BTQconst [0] x) mem) + => (SET(B|AE)store [off] {sym} ptr (BTQconst [0] x) mem) (SET(NE|EQ)store [off] {sym} ptr (TESTL z1:(SHRLconst [31] (SHLLconst [31] x)) z2) mem) && z1==z2 - -> (SET(B|AE)store [off] {sym} ptr (BTLconst [0] x) mem) + => (SET(B|AE)store [off] {sym} ptr (BTLconst [0] x) mem) // Special-case manually testing last bit with "a>>63 != 0" (without "&1") ((SETNE|SETEQ|NE|EQ) (TESTQ z1:(SHRQconst [63] x) z2)) && z1==z2 - -> ((SETB|SETAE|ULT|UGE) (BTQconst [63] x)) + => ((SETB|SETAE|ULT|UGE) (BTQconst [63] x)) ((SETNE|SETEQ|NE|EQ) (TESTL z1:(SHRLconst [31] x) z2)) && z1==z2 - -> ((SETB|SETAE|ULT|UGE) (BTLconst [31] x)) + => ((SETB|SETAE|ULT|UGE) (BTLconst [31] x)) (SET(NE|EQ)store [off] {sym} ptr (TESTQ z1:(SHRQconst [63] x) z2) mem) && z1==z2 - -> (SET(B|AE)store [off] {sym} ptr (BTQconst [63] x) mem) + => (SET(B|AE)store [off] {sym} ptr (BTQconst [63] x) mem) (SET(NE|EQ)store [off] {sym} ptr (TESTL z1:(SHRLconst [31] x) z2) mem) && z1==z2 - -> (SET(B|AE)store [off] {sym} ptr (BTLconst [31] x) mem) + => (SET(B|AE)store [off] {sym} ptr (BTLconst [31] x) mem) // Fold combinations of bit ops on same bit. An example is math.Copysign(c,-1) -(BTS(Q|L)const [c] (BTR(Q|L)const [c] x)) -> (BTS(Q|L)const [c] x) -(BTS(Q|L)const [c] (BTC(Q|L)const [c] x)) -> (BTS(Q|L)const [c] x) -(BTR(Q|L)const [c] (BTS(Q|L)const [c] x)) -> (BTR(Q|L)const [c] x) -(BTR(Q|L)const [c] (BTC(Q|L)const [c] x)) -> (BTR(Q|L)const [c] x) +(BTS(Q|L)const [c] (BTR(Q|L)const [c] x)) => (BTS(Q|L)const [c] x) +(BTS(Q|L)const [c] (BTC(Q|L)const [c] x)) => (BTS(Q|L)const [c] x) +(BTR(Q|L)const [c] (BTS(Q|L)const [c] x)) => (BTR(Q|L)const [c] x) +(BTR(Q|L)const [c] (BTC(Q|L)const [c] x)) => (BTR(Q|L)const [c] x) // Fold boolean negation into SETcc. -(XORLconst [1] (SETNE x)) -> (SETEQ x) -(XORLconst [1] (SETEQ x)) -> (SETNE x) -(XORLconst [1] (SETL x)) -> (SETGE x) -(XORLconst [1] (SETGE x)) -> (SETL x) -(XORLconst [1] (SETLE x)) -> (SETG x) -(XORLconst [1] (SETG x)) -> (SETLE x) -(XORLconst [1] (SETB x)) -> (SETAE x) -(XORLconst [1] (SETAE x)) -> (SETB x) -(XORLconst [1] (SETBE x)) -> (SETA x) -(XORLconst [1] (SETA x)) -> (SETBE x) +(XORLconst [1] (SETNE x)) => (SETEQ x) +(XORLconst [1] (SETEQ x)) => (SETNE x) +(XORLconst [1] (SETL x)) => (SETGE x) +(XORLconst [1] (SETGE x)) => (SETL x) +(XORLconst [1] (SETLE x)) => (SETG x) +(XORLconst [1] (SETG x)) => (SETLE x) +(XORLconst [1] (SETB x)) => (SETAE x) +(XORLconst [1] (SETAE x)) => (SETB x) +(XORLconst [1] (SETBE x)) => (SETA x) +(XORLconst [1] (SETA x)) => (SETBE x) // Special case for floating point - LF/LEF not generated -(NE (TESTB (SETGF cmp) (SETGF cmp)) yes no) -> (UGT cmp yes no) -(NE (TESTB (SETGEF cmp) (SETGEF cmp)) yes no) -> (UGE cmp yes no) -(NE (TESTB (SETEQF cmp) (SETEQF cmp)) yes no) -> (EQF cmp yes no) -(NE (TESTB (SETNEF cmp) (SETNEF cmp)) yes no) -> (NEF cmp yes no) +(NE (TESTB (SETGF cmp) (SETGF cmp)) yes no) => (UGT cmp yes no) +(NE (TESTB (SETGEF cmp) (SETGEF cmp)) yes no) => (UGE cmp yes no) +(NE (TESTB (SETEQF cmp) (SETEQF cmp)) yes no) => (EQF cmp yes no) +(NE (TESTB (SETNEF cmp) (SETNEF cmp)) yes no) => (NEF cmp yes no) // Disabled because it interferes with the pattern match above and makes worse code. -// (SETNEF x) -> (ORQ (SETNE <typ.Int8> x) (SETNAN <typ.Int8> x)) -// (SETEQF x) -> (ANDQ (SETEQ <typ.Int8> x) (SETORD <typ.Int8> x)) +// (SETNEF x) => (ORQ (SETNE <typ.Int8> x) (SETNAN <typ.Int8> x)) +// (SETEQF x) => (ANDQ (SETEQ <typ.Int8> x) (SETORD <typ.Int8> x)) // fold constants into instructions -(ADDQ x (MOVQconst [c])) && is32Bit(c) -> (ADDQconst [c] x) -(ADDQ x (MOVLconst [c])) && is32Bit(c) -> (ADDQconst [int64(int32(c))] x) -(ADDL x (MOVLconst [c])) -> (ADDLconst [c] x) +(ADDQ x (MOVQconst [c])) && is32Bit(c) => (ADDQconst [int32(c)] x) +(ADDQ x (MOVLconst [c])) => (ADDQconst [c] x) +(ADDL x (MOVLconst [c])) => (ADDLconst [c] x) -(SUBQ x (MOVQconst [c])) && is32Bit(c) -> (SUBQconst x [c]) -(SUBQ (MOVQconst [c]) x) && is32Bit(c) -> (NEGQ (SUBQconst <v.Type> x [c])) -(SUBL x (MOVLconst [c])) -> (SUBLconst x [c]) -(SUBL (MOVLconst [c]) x) -> (NEGL (SUBLconst <v.Type> x [c])) +(SUBQ x (MOVQconst [c])) && is32Bit(c) => (SUBQconst x [int32(c)]) +(SUBQ (MOVQconst [c]) x) && is32Bit(c) => (NEGQ (SUBQconst <v.Type> x [int32(c)])) +(SUBL x (MOVLconst [c])) => (SUBLconst x [c]) +(SUBL (MOVLconst [c]) x) => (NEGL (SUBLconst <v.Type> x [c])) -(MULQ x (MOVQconst [c])) && is32Bit(c) -> (MULQconst [c] x) -(MULL x (MOVLconst [c])) -> (MULLconst [c] x) +(MULQ x (MOVQconst [c])) && is32Bit(c) => (MULQconst [int32(c)] x) +(MULL x (MOVLconst [c])) => (MULLconst [c] x) -(ANDQ x (MOVQconst [c])) && is32Bit(c) -> (ANDQconst [c] x) -(ANDL x (MOVLconst [c])) -> (ANDLconst [c] x) +(ANDQ x (MOVQconst [c])) && is32Bit(c) => (ANDQconst [int32(c)] x) +(ANDL x (MOVLconst [c])) => (ANDLconst [c] x) (AND(L|Q)const [c] (AND(L|Q)const [d] x)) => (AND(L|Q)const [c & d] x) (XOR(L|Q)const [c] (XOR(L|Q)const [d] x)) => (XOR(L|Q)const [c ^ d] x) @@ -763,68 +763,70 @@ (ORQconst [c] (BTSQconst [d] x)) && is32Bit(int64(c) | 1<<uint32(d)) => (ORQconst [c | 1<<uint32(d)] x) (BTSQconst [c] (BTSQconst [d] x)) && is32Bit(1<<uint32(c) | 1<<uint32(d)) => (ORQconst [1<<uint32(c) | 1<<uint32(d)] x) -(MULLconst [c] (MULLconst [d] x)) -> (MULLconst [int64(int32(c * d))] x) -(MULQconst [c] (MULQconst [d] x)) && is32Bit(c*d) -> (MULQconst [c * d] x) -(ORQ x (MOVQconst [c])) && is32Bit(c) -> (ORQconst [c] x) -(ORQ x (MOVLconst [c])) -> (ORQconst [c] x) -(ORL x (MOVLconst [c])) -> (ORLconst [c] x) +(MULLconst [c] (MULLconst [d] x)) => (MULLconst [c * d] x) +(MULQconst [c] (MULQconst [d] x)) && is32Bit(int64(c)*int64(d)) => (MULQconst [c * d] x) -(XORQ x (MOVQconst [c])) && is32Bit(c) -> (XORQconst [c] x) -(XORL x (MOVLconst [c])) -> (XORLconst [c] x) +(ORQ x (MOVQconst [c])) && is32Bit(c) => (ORQconst [int32(c)] x) +(ORQ x (MOVLconst [c])) => (ORQconst [c] x) +(ORL x (MOVLconst [c])) => (ORLconst [c] x) -(SHLQ x (MOV(Q|L)const [c])) -> (SHLQconst [c&63] x) -(SHLL x (MOV(Q|L)const [c])) -> (SHLLconst [c&31] x) +(XORQ x (MOVQconst [c])) && is32Bit(c) => (XORQconst [int32(c)] x) +(XORL x (MOVLconst [c])) => (XORLconst [c] x) -(SHRQ x (MOV(Q|L)const [c])) -> (SHRQconst [c&63] x) -(SHRL x (MOV(Q|L)const [c])) -> (SHRLconst [c&31] x) -(SHRW x (MOV(Q|L)const [c])) && c&31 < 16 -> (SHRWconst [c&31] x) -(SHRW _ (MOV(Q|L)const [c])) && c&31 >= 16 -> (MOVLconst [0]) -(SHRB x (MOV(Q|L)const [c])) && c&31 < 8 -> (SHRBconst [c&31] x) -(SHRB _ (MOV(Q|L)const [c])) && c&31 >= 8 -> (MOVLconst [0]) +(SHLQ x (MOV(Q|L)const [c])) => (SHLQconst [int8(c&63)] x) +(SHLL x (MOV(Q|L)const [c])) => (SHLLconst [int8(c&31)] x) + +(SHRQ x (MOV(Q|L)const [c])) => (SHRQconst [int8(c&63)] x) +(SHRL x (MOV(Q|L)const [c])) => (SHRLconst [int8(c&31)] x) +(SHRW x (MOV(Q|L)const [c])) && c&31 < 16 => (SHRWconst [int8(c&31)] x) +(SHRW _ (MOV(Q|L)const [c])) && c&31 >= 16 => (MOVLconst [0]) +(SHRB x (MOV(Q|L)const [c])) && c&31 < 8 => (SHRBconst [int8(c&31)] x) +(SHRB _ (MOV(Q|L)const [c])) && c&31 >= 8 => (MOVLconst [0]) + +(SARQ x (MOV(Q|L)const [c])) => (SARQconst [int8(c&63)] x) +(SARL x (MOV(Q|L)const [c])) => (SARLconst [int8(c&31)] x) +(SARW x (MOV(Q|L)const [c])) => (SARWconst [int8(min(int64(c)&31,15))] x) +(SARB x (MOV(Q|L)const [c])) => (SARBconst [int8(min(int64(c)&31,7))] x) -(SARQ x (MOV(Q|L)const [c])) -> (SARQconst [c&63] x) -(SARL x (MOV(Q|L)const [c])) -> (SARLconst [c&31] x) -(SARW x (MOV(Q|L)const [c])) -> (SARWconst [min(c&31,15)] x) -(SARB x (MOV(Q|L)const [c])) -> (SARBconst [min(c&31,7)] x) // Operations which don't affect the low 6/5 bits of the shift amount are NOPs. -((SHLQ|SHRQ|SARQ) x (ADDQconst [c] y)) && c & 63 == 0 -> ((SHLQ|SHRQ|SARQ) x y) -((SHLQ|SHRQ|SARQ) x (NEGQ <t> (ADDQconst [c] y))) && c & 63 == 0 -> ((SHLQ|SHRQ|SARQ) x (NEGQ <t> y)) -((SHLQ|SHRQ|SARQ) x (ANDQconst [c] y)) && c & 63 == 63 -> ((SHLQ|SHRQ|SARQ) x y) -((SHLQ|SHRQ|SARQ) x (NEGQ <t> (ANDQconst [c] y))) && c & 63 == 63 -> ((SHLQ|SHRQ|SARQ) x (NEGQ <t> y)) - -((SHLL|SHRL|SARL) x (ADDQconst [c] y)) && c & 31 == 0 -> ((SHLL|SHRL|SARL) x y) -((SHLL|SHRL|SARL) x (NEGQ <t> (ADDQconst [c] y))) && c & 31 == 0 -> ((SHLL|SHRL|SARL) x (NEGQ <t> y)) -((SHLL|SHRL|SARL) x (ANDQconst [c] y)) && c & 31 == 31 -> ((SHLL|SHRL|SARL) x y) -((SHLL|SHRL|SARL) x (NEGQ <t> (ANDQconst [c] y))) && c & 31 == 31 -> ((SHLL|SHRL|SARL) x (NEGQ <t> y)) - -((SHLQ|SHRQ|SARQ) x (ADDLconst [c] y)) && c & 63 == 0 -> ((SHLQ|SHRQ|SARQ) x y) -((SHLQ|SHRQ|SARQ) x (NEGL <t> (ADDLconst [c] y))) && c & 63 == 0 -> ((SHLQ|SHRQ|SARQ) x (NEGL <t> y)) -((SHLQ|SHRQ|SARQ) x (ANDLconst [c] y)) && c & 63 == 63 -> ((SHLQ|SHRQ|SARQ) x y) -((SHLQ|SHRQ|SARQ) x (NEGL <t> (ANDLconst [c] y))) && c & 63 == 63 -> ((SHLQ|SHRQ|SARQ) x (NEGL <t> y)) - -((SHLL|SHRL|SARL) x (ADDLconst [c] y)) && c & 31 == 0 -> ((SHLL|SHRL|SARL) x y) -((SHLL|SHRL|SARL) x (NEGL <t> (ADDLconst [c] y))) && c & 31 == 0 -> ((SHLL|SHRL|SARL) x (NEGL <t> y)) -((SHLL|SHRL|SARL) x (ANDLconst [c] y)) && c & 31 == 31 -> ((SHLL|SHRL|SARL) x y) -((SHLL|SHRL|SARL) x (NEGL <t> (ANDLconst [c] y))) && c & 31 == 31 -> ((SHLL|SHRL|SARL) x (NEGL <t> y)) +((SHLQ|SHRQ|SARQ) x (ADDQconst [c] y)) && c & 63 == 0 => ((SHLQ|SHRQ|SARQ) x y) +((SHLQ|SHRQ|SARQ) x (NEGQ <t> (ADDQconst [c] y))) && c & 63 == 0 => ((SHLQ|SHRQ|SARQ) x (NEGQ <t> y)) +((SHLQ|SHRQ|SARQ) x (ANDQconst [c] y)) && c & 63 == 63 => ((SHLQ|SHRQ|SARQ) x y) +((SHLQ|SHRQ|SARQ) x (NEGQ <t> (ANDQconst [c] y))) && c & 63 == 63 => ((SHLQ|SHRQ|SARQ) x (NEGQ <t> y)) + +((SHLL|SHRL|SARL) x (ADDQconst [c] y)) && c & 31 == 0 => ((SHLL|SHRL|SARL) x y) +((SHLL|SHRL|SARL) x (NEGQ <t> (ADDQconst [c] y))) && c & 31 == 0 => ((SHLL|SHRL|SARL) x (NEGQ <t> y)) +((SHLL|SHRL|SARL) x (ANDQconst [c] y)) && c & 31 == 31 => ((SHLL|SHRL|SARL) x y) +((SHLL|SHRL|SARL) x (NEGQ <t> (ANDQconst [c] y))) && c & 31 == 31 => ((SHLL|SHRL|SARL) x (NEGQ <t> y)) + +((SHLQ|SHRQ|SARQ) x (ADDLconst [c] y)) && c & 63 == 0 => ((SHLQ|SHRQ|SARQ) x y) +((SHLQ|SHRQ|SARQ) x (NEGL <t> (ADDLconst [c] y))) && c & 63 == 0 => ((SHLQ|SHRQ|SARQ) x (NEGL <t> y)) +((SHLQ|SHRQ|SARQ) x (ANDLconst [c] y)) && c & 63 == 63 => ((SHLQ|SHRQ|SARQ) x y) +((SHLQ|SHRQ|SARQ) x (NEGL <t> (ANDLconst [c] y))) && c & 63 == 63 => ((SHLQ|SHRQ|SARQ) x (NEGL <t> y)) + +((SHLL|SHRL|SARL) x (ADDLconst [c] y)) && c & 31 == 0 => ((SHLL|SHRL|SARL) x y) +((SHLL|SHRL|SARL) x (NEGL <t> (ADDLconst [c] y))) && c & 31 == 0 => ((SHLL|SHRL|SARL) x (NEGL <t> y)) +((SHLL|SHRL|SARL) x (ANDLconst [c] y)) && c & 31 == 31 => ((SHLL|SHRL|SARL) x y) +((SHLL|SHRL|SARL) x (NEGL <t> (ANDLconst [c] y))) && c & 31 == 31 => ((SHLL|SHRL|SARL) x (NEGL <t> y)) // Constant rotate instructions -((ADDQ|ORQ|XORQ) (SHLQconst x [c]) (SHRQconst x [d])) && d==64-c -> (ROLQconst x [c]) -((ADDL|ORL|XORL) (SHLLconst x [c]) (SHRLconst x [d])) && d==32-c -> (ROLLconst x [c]) +((ADDQ|ORQ|XORQ) (SHLQconst x [c]) (SHRQconst x [d])) && d==64-c => (ROLQconst x [c]) +((ADDL|ORL|XORL) (SHLLconst x [c]) (SHRLconst x [d])) && d==32-c => (ROLLconst x [c]) -((ADDL|ORL|XORL) <t> (SHLLconst x [c]) (SHRWconst x [d])) && d==16-c && c < 16 && t.Size() == 2 -> (ROLWconst x [c]) -((ADDL|ORL|XORL) <t> (SHLLconst x [c]) (SHRBconst x [d])) && d==8-c && c < 8 && t.Size() == 1 -> (ROLBconst x [c]) +((ADDL|ORL|XORL) <t> (SHLLconst x [c]) (SHRWconst x [d])) && d==16-c && c < 16 && t.Size() == 2 => (ROLWconst x [c]) +((ADDL|ORL|XORL) <t> (SHLLconst x [c]) (SHRBconst x [d])) && d==8-c && c < 8 && t.Size() == 1 => (ROLBconst x [c]) -(ROLQconst [c] (ROLQconst [d] x)) -> (ROLQconst [(c+d)&63] x) -(ROLLconst [c] (ROLLconst [d] x)) -> (ROLLconst [(c+d)&31] x) -(ROLWconst [c] (ROLWconst [d] x)) -> (ROLWconst [(c+d)&15] x) -(ROLBconst [c] (ROLBconst [d] x)) -> (ROLBconst [(c+d)& 7] x) +(ROLQconst [c] (ROLQconst [d] x)) => (ROLQconst [(c+d)&63] x) +(ROLLconst [c] (ROLLconst [d] x)) => (ROLLconst [(c+d)&31] x) +(ROLWconst [c] (ROLWconst [d] x)) => (ROLWconst [(c+d)&15] x) +(ROLBconst [c] (ROLBconst [d] x)) => (ROLBconst [(c+d)& 7] x) -(RotateLeft8 ...) -> (ROLB ...) -(RotateLeft16 ...) -> (ROLW ...) -(RotateLeft32 ...) -> (ROLL ...) -(RotateLeft64 ...) -> (ROLQ ...) +(RotateLeft8 ...) => (ROLB ...) +(RotateLeft16 ...) => (ROLW ...) +(RotateLeft32 ...) => (ROLL ...) +(RotateLeft64 ...) => (ROLQ ...) // Non-constant rotates. // We want to issue a rotate when the Go source contains code like @@ -837,15 +839,15 @@ // But x >> 64 is 0, not x. So there's an additional mask that is ANDed in // to force the second term to 0. We don't need that mask, but we must match // it in order to strip it out. -(ORQ (SHLQ x y) (ANDQ (SHRQ x (NEG(Q|L) y)) (SBBQcarrymask (CMP(Q|L)const (NEG(Q|L) (ADD(Q|L)const (AND(Q|L)const y [63]) [-64])) [64])))) -> (ROLQ x y) -(ORQ (SHRQ x y) (ANDQ (SHLQ x (NEG(Q|L) y)) (SBBQcarrymask (CMP(Q|L)const (NEG(Q|L) (ADD(Q|L)const (AND(Q|L)const y [63]) [-64])) [64])))) -> (RORQ x y) +(ORQ (SHLQ x y) (ANDQ (SHRQ x (NEG(Q|L) y)) (SBBQcarrymask (CMP(Q|L)const (NEG(Q|L) (ADD(Q|L)const (AND(Q|L)const y [63]) [-64])) [64])))) => (ROLQ x y) +(ORQ (SHRQ x y) (ANDQ (SHLQ x (NEG(Q|L) y)) (SBBQcarrymask (CMP(Q|L)const (NEG(Q|L) (ADD(Q|L)const (AND(Q|L)const y [63]) [-64])) [64])))) => (RORQ x y) -(ORL (SHLL x y) (ANDL (SHRL x (NEG(Q|L) y)) (SBBLcarrymask (CMP(Q|L)const (NEG(Q|L) (ADD(Q|L)const (AND(Q|L)const y [31]) [-32])) [32])))) -> (ROLL x y) -(ORL (SHRL x y) (ANDL (SHLL x (NEG(Q|L) y)) (SBBLcarrymask (CMP(Q|L)const (NEG(Q|L) (ADD(Q|L)const (AND(Q|L)const y [31]) [-32])) [32])))) -> (RORL x y) +(ORL (SHLL x y) (ANDL (SHRL x (NEG(Q|L) y)) (SBBLcarrymask (CMP(Q|L)const (NEG(Q|L) (ADD(Q|L)const (AND(Q|L)const y [31]) [-32])) [32])))) => (ROLL x y) +(ORL (SHRL x y) (ANDL (SHLL x (NEG(Q|L) y)) (SBBLcarrymask (CMP(Q|L)const (NEG(Q|L) (ADD(Q|L)const (AND(Q|L)const y [31]) [-32])) [32])))) => (RORL x y) // Help with rotate detection -(CMPQconst (NEGQ (ADDQconst [-16] (ANDQconst [15] _))) [32]) -> (FlagLT_ULT) -(CMPQconst (NEGQ (ADDQconst [ -8] (ANDQconst [7] _))) [32]) -> (FlagLT_ULT) +(CMPQconst (NEGQ (ADDQconst [-16] (ANDQconst [15] _))) [32]) => (FlagLT_ULT) +(CMPQconst (NEGQ (ADDQconst [ -8] (ANDQconst [7] _))) [32]) => (FlagLT_ULT) (ORL (SHLL x (AND(Q|L)const y [15])) (ANDL (SHRW x (NEG(Q|L) (ADD(Q|L)const (AND(Q|L)const y [15]) [-16]))) @@ -855,69 +857,74 @@ (ORL (SHRW x (AND(Q|L)const y [15])) (SHLL x (NEG(Q|L) (ADD(Q|L)const (AND(Q|L)const y [15]) [-16])))) && v.Type.Size() == 2 - -> (RORW x y) + => (RORW x y) (ORL (SHLL x (AND(Q|L)const y [ 7])) (ANDL (SHRB x (NEG(Q|L) (ADD(Q|L)const (AND(Q|L)const y [ 7]) [ -8]))) (SBBLcarrymask (CMP(Q|L)const (NEG(Q|L) (ADD(Q|L)const (AND(Q|L)const y [ 7]) [ -8])) [ 8])))) && v.Type.Size() == 1 - -> (ROLB x y) + => (ROLB x y) (ORL (SHRB x (AND(Q|L)const y [ 7])) (SHLL x (NEG(Q|L) (ADD(Q|L)const (AND(Q|L)const y [ 7]) [ -8])))) && v.Type.Size() == 1 - -> (RORB x y) + => (RORB x y) // rotate left negative = rotate right -(ROLQ x (NEG(Q|L) y)) -> (RORQ x y) -(ROLL x (NEG(Q|L) y)) -> (RORL x y) -(ROLW x (NEG(Q|L) y)) -> (RORW x y) -(ROLB x (NEG(Q|L) y)) -> (RORB x y) +(ROLQ x (NEG(Q|L) y)) => (RORQ x y) +(ROLL x (NEG(Q|L) y)) => (RORL x y) +(ROLW x (NEG(Q|L) y)) => (RORW x y) +(ROLB x (NEG(Q|L) y)) => (RORB x y) // rotate right negative = rotate left -(RORQ x (NEG(Q|L) y)) -> (ROLQ x y) -(RORL x (NEG(Q|L) y)) -> (ROLL x y) -(RORW x (NEG(Q|L) y)) -> (ROLW x y) -(RORB x (NEG(Q|L) y)) -> (ROLB x y) +(RORQ x (NEG(Q|L) y)) => (ROLQ x y) +(RORL x (NEG(Q|L) y)) => (ROLL x y) +(RORW x (NEG(Q|L) y)) => (ROLW x y) +(RORB x (NEG(Q|L) y)) => (ROLB x y) // rotate by constants -(ROLQ x (MOV(Q|L)const [c])) -> (ROLQconst [c&63] x) -(ROLL x (MOV(Q|L)const [c])) -> (ROLLconst [c&31] x) -(ROLW x (MOV(Q|L)const [c])) -> (ROLWconst [c&15] x) -(ROLB x (MOV(Q|L)const [c])) -> (ROLBconst [c&7 ] x) +(ROLQ x (MOV(Q|L)const [c])) => (ROLQconst [int8(c&63)] x) +(ROLL x (MOV(Q|L)const [c])) => (ROLLconst [int8(c&31)] x) +(ROLW x (MOV(Q|L)const [c])) => (ROLWconst [int8(c&15)] x) +(ROLB x (MOV(Q|L)const [c])) => (ROLBconst [int8(c&7) ] x) -(RORQ x (MOV(Q|L)const [c])) -> (ROLQconst [(-c)&63] x) -(RORL x (MOV(Q|L)const [c])) -> (ROLLconst [(-c)&31] x) -(RORW x (MOV(Q|L)const [c])) -> (ROLWconst [(-c)&15] x) -(RORB x (MOV(Q|L)const [c])) -> (ROLBconst [(-c)&7 ] x) +(RORQ x (MOV(Q|L)const [c])) => (ROLQconst [int8((-c)&63)] x) +(RORL x (MOV(Q|L)const [c])) => (ROLLconst [int8((-c)&31)] x) +(RORW x (MOV(Q|L)const [c])) => (ROLWconst [int8((-c)&15)] x) +(RORB x (MOV(Q|L)const [c])) => (ROLBconst [int8((-c)&7) ] x) // Constant shift simplifications -((SHLQ|SHRQ|SARQ)const x [0]) -> x -((SHLL|SHRL|SARL)const x [0]) -> x -((SHRW|SARW)const x [0]) -> x -((SHRB|SARB)const x [0]) -> x -((ROLQ|ROLL|ROLW|ROLB)const x [0]) -> x +((SHLQ|SHRQ|SARQ)const x [0]) => x +((SHLL|SHRL|SARL)const x [0]) => x +((SHRW|SARW)const x [0]) => x +((SHRB|SARB)const x [0]) => x +((ROLQ|ROLL|ROLW|ROLB)const x [0]) => x // Note: the word and byte shifts keep the low 5 bits (not the low 4 or 3 bits) // because the x86 instructions are defined to use all 5 bits of the shift even // for the small shifts. I don't think we'll ever generate a weird shift (e.g. // (SHRW x (MOVLconst [24])), but just in case. -(CMPQ x (MOVQconst [c])) && is32Bit(c) -> (CMPQconst x [c]) -(CMPQ (MOVQconst [c]) x) && is32Bit(c) -> (InvertFlags (CMPQconst x [c])) -(CMPL x (MOVLconst [c])) -> (CMPLconst x [c]) -(CMPL (MOVLconst [c]) x) -> (InvertFlags (CMPLconst x [c])) -(CMPW x (MOVLconst [c])) -> (CMPWconst x [int64(int16(c))]) -(CMPW (MOVLconst [c]) x) -> (InvertFlags (CMPWconst x [int64(int16(c))])) -(CMPB x (MOVLconst [c])) -> (CMPBconst x [int64(int8(c))]) -(CMPB (MOVLconst [c]) x) -> (InvertFlags (CMPBconst x [int64(int8(c))])) +(CMPQ x (MOVQconst [c])) && is32Bit(c) => (CMPQconst x [int32(c)]) +(CMPQ (MOVQconst [c]) x) && is32Bit(c) => (InvertFlags (CMPQconst x [int32(c)])) +(CMPL x (MOVLconst [c])) => (CMPLconst x [c]) +(CMPL (MOVLconst [c]) x) => (InvertFlags (CMPLconst x [c])) +(CMPW x (MOVLconst [c])) => (CMPWconst x [int16(c)]) +(CMPW (MOVLconst [c]) x) => (InvertFlags (CMPWconst x [int16(c)])) +(CMPB x (MOVLconst [c])) => (CMPBconst x [int8(c)]) +(CMPB (MOVLconst [c]) x) => (InvertFlags (CMPBconst x [int8(c)])) // Canonicalize the order of arguments to comparisons - helps with CSE. -(CMP(Q|L|W|B) x y) && x.ID > y.ID -> (InvertFlags (CMP(Q|L|W|B) y x)) +(CMP(Q|L|W|B) x y) && x.ID > y.ID => (InvertFlags (CMP(Q|L|W|B) y x)) // Using MOVZX instead of AND is cheaper. -(AND(Q|L)const [ 0xFF] x) -> (MOVBQZX x) -(AND(Q|L)const [0xFFFF] x) -> (MOVWQZX x) -(ANDQconst [0xFFFFFFFF] x) -> (MOVLQZX x) +(AND(Q|L)const [ 0xFF] x) => (MOVBQZX x) +(AND(Q|L)const [0xFFFF] x) => (MOVWQZX x) +// This rule is currently invalid because 0xFFFFFFFF is not representable by a signed int32. +// Commenting out for now, because it also can't trigger because of the is32bit guard on the +// ANDQconst lowering-rule, above, prevents 0xFFFFFFFF from matching (for the same reason) +// Using an alternate form of this rule segfaults some binaries because of +// adverse interactions with other passes. +// (ANDQconst [0xFFFFFFFF] x) => (MOVLQZX x) // strength reduction // Assumes that the following costs from https://gmplib.org/~tege/x86-timing.pdf: @@ -928,98 +935,98 @@ // which can require a register-register move // to preserve the original value, // so it must be used with care. -(MUL(Q|L)const [-9] x) -> (NEG(Q|L) (LEA(Q|L)8 <v.Type> x x)) -(MUL(Q|L)const [-5] x) -> (NEG(Q|L) (LEA(Q|L)4 <v.Type> x x)) -(MUL(Q|L)const [-3] x) -> (NEG(Q|L) (LEA(Q|L)2 <v.Type> x x)) -(MUL(Q|L)const [-1] x) -> (NEG(Q|L) x) -(MUL(Q|L)const [ 0] _) -> (MOV(Q|L)const [0]) -(MUL(Q|L)const [ 1] x) -> x -(MUL(Q|L)const [ 3] x) -> (LEA(Q|L)2 x x) -(MUL(Q|L)const [ 5] x) -> (LEA(Q|L)4 x x) -(MUL(Q|L)const [ 7] x) -> (LEA(Q|L)2 x (LEA(Q|L)2 <v.Type> x x)) -(MUL(Q|L)const [ 9] x) -> (LEA(Q|L)8 x x) -(MUL(Q|L)const [11] x) -> (LEA(Q|L)2 x (LEA(Q|L)4 <v.Type> x x)) -(MUL(Q|L)const [13] x) -> (LEA(Q|L)4 x (LEA(Q|L)2 <v.Type> x x)) -(MUL(Q|L)const [19] x) -> (LEA(Q|L)2 x (LEA(Q|L)8 <v.Type> x x)) -(MUL(Q|L)const [21] x) -> (LEA(Q|L)4 x (LEA(Q|L)4 <v.Type> x x)) -(MUL(Q|L)const [25] x) -> (LEA(Q|L)8 x (LEA(Q|L)2 <v.Type> x x)) -(MUL(Q|L)const [27] x) -> (LEA(Q|L)8 (LEA(Q|L)2 <v.Type> x x) (LEA(Q|L)2 <v.Type> x x)) -(MUL(Q|L)const [37] x) -> (LEA(Q|L)4 x (LEA(Q|L)8 <v.Type> x x)) -(MUL(Q|L)const [41] x) -> (LEA(Q|L)8 x (LEA(Q|L)4 <v.Type> x x)) -(MUL(Q|L)const [45] x) -> (LEA(Q|L)8 (LEA(Q|L)4 <v.Type> x x) (LEA(Q|L)4 <v.Type> x x)) -(MUL(Q|L)const [73] x) -> (LEA(Q|L)8 x (LEA(Q|L)8 <v.Type> x x)) -(MUL(Q|L)const [81] x) -> (LEA(Q|L)8 (LEA(Q|L)8 <v.Type> x x) (LEA(Q|L)8 <v.Type> x x)) - -(MUL(Q|L)const [c] x) && isPowerOfTwo(c+1) && c >= 15 -> (SUB(Q|L) (SHL(Q|L)const <v.Type> [log2(c+1)] x) x) -(MUL(Q|L)const [c] x) && isPowerOfTwo(c-1) && c >= 17 -> (LEA(Q|L)1 (SHL(Q|L)const <v.Type> [log2(c-1)] x) x) -(MUL(Q|L)const [c] x) && isPowerOfTwo(c-2) && c >= 34 -> (LEA(Q|L)2 (SHL(Q|L)const <v.Type> [log2(c-2)] x) x) -(MUL(Q|L)const [c] x) && isPowerOfTwo(c-4) && c >= 68 -> (LEA(Q|L)4 (SHL(Q|L)const <v.Type> [log2(c-4)] x) x) -(MUL(Q|L)const [c] x) && isPowerOfTwo(c-8) && c >= 136 -> (LEA(Q|L)8 (SHL(Q|L)const <v.Type> [log2(c-8)] x) x) -(MUL(Q|L)const [c] x) && c%3 == 0 && isPowerOfTwo(c/3) -> (SHL(Q|L)const [log2(c/3)] (LEA(Q|L)2 <v.Type> x x)) -(MUL(Q|L)const [c] x) && c%5 == 0 && isPowerOfTwo(c/5) -> (SHL(Q|L)const [log2(c/5)] (LEA(Q|L)4 <v.Type> x x)) -(MUL(Q|L)const [c] x) && c%9 == 0 && isPowerOfTwo(c/9) -> (SHL(Q|L)const [log2(c/9)] (LEA(Q|L)8 <v.Type> x x)) +(MUL(Q|L)const [-9] x) => (NEG(Q|L) (LEA(Q|L)8 <v.Type> x x)) +(MUL(Q|L)const [-5] x) => (NEG(Q|L) (LEA(Q|L)4 <v.Type> x x)) +(MUL(Q|L)const [-3] x) => (NEG(Q|L) (LEA(Q|L)2 <v.Type> x x)) +(MUL(Q|L)const [-1] x) => (NEG(Q|L) x) +(MUL(Q|L)const [ 0] _) => (MOV(Q|L)const [0]) +(MUL(Q|L)const [ 1] x) => x +(MUL(Q|L)const [ 3] x) => (LEA(Q|L)2 x x) +(MUL(Q|L)const [ 5] x) => (LEA(Q|L)4 x x) +(MUL(Q|L)const [ 7] x) => (LEA(Q|L)2 x (LEA(Q|L)2 <v.Type> x x)) +(MUL(Q|L)const [ 9] x) => (LEA(Q|L)8 x x) +(MUL(Q|L)const [11] x) => (LEA(Q|L)2 x (LEA(Q|L)4 <v.Type> x x)) +(MUL(Q|L)const [13] x) => (LEA(Q|L)4 x (LEA(Q|L)2 <v.Type> x x)) +(MUL(Q|L)const [19] x) => (LEA(Q|L)2 x (LEA(Q|L)8 <v.Type> x x)) +(MUL(Q|L)const [21] x) => (LEA(Q|L)4 x (LEA(Q|L)4 <v.Type> x x)) +(MUL(Q|L)const [25] x) => (LEA(Q|L)8 x (LEA(Q|L)2 <v.Type> x x)) +(MUL(Q|L)const [27] x) => (LEA(Q|L)8 (LEA(Q|L)2 <v.Type> x x) (LEA(Q|L)2 <v.Type> x x)) +(MUL(Q|L)const [37] x) => (LEA(Q|L)4 x (LEA(Q|L)8 <v.Type> x x)) +(MUL(Q|L)const [41] x) => (LEA(Q|L)8 x (LEA(Q|L)4 <v.Type> x x)) +(MUL(Q|L)const [45] x) => (LEA(Q|L)8 (LEA(Q|L)4 <v.Type> x x) (LEA(Q|L)4 <v.Type> x x)) +(MUL(Q|L)const [73] x) => (LEA(Q|L)8 x (LEA(Q|L)8 <v.Type> x x)) +(MUL(Q|L)const [81] x) => (LEA(Q|L)8 (LEA(Q|L)8 <v.Type> x x) (LEA(Q|L)8 <v.Type> x x)) + +(MUL(Q|L)const [c] x) && isPowerOfTwo(int64(c)+1) && c >= 15 => (SUB(Q|L) (SHL(Q|L)const <v.Type> [int8(log2(int64(c)+1))] x) x) +(MUL(Q|L)const [c] x) && isPowerOfTwo32(c-1) && c >= 17 => (LEA(Q|L)1 (SHL(Q|L)const <v.Type> [int8(log32(c-1))] x) x) +(MUL(Q|L)const [c] x) && isPowerOfTwo32(c-2) && c >= 34 => (LEA(Q|L)2 (SHL(Q|L)const <v.Type> [int8(log32(c-2))] x) x) +(MUL(Q|L)const [c] x) && isPowerOfTwo32(c-4) && c >= 68 => (LEA(Q|L)4 (SHL(Q|L)const <v.Type> [int8(log32(c-4))] x) x) +(MUL(Q|L)const [c] x) && isPowerOfTwo32(c-8) && c >= 136 => (LEA(Q|L)8 (SHL(Q|L)const <v.Type> [int8(log32(c-8))] x) x) +(MUL(Q|L)const [c] x) && c%3 == 0 && isPowerOfTwo32(c/3) => (SHL(Q|L)const [int8(log32(c/3))] (LEA(Q|L)2 <v.Type> x x)) +(MUL(Q|L)const [c] x) && c%5 == 0 && isPowerOfTwo32(c/5) => (SHL(Q|L)const [int8(log32(c/5))] (LEA(Q|L)4 <v.Type> x x)) +(MUL(Q|L)const [c] x) && c%9 == 0 && isPowerOfTwo32(c/9) => (SHL(Q|L)const [int8(log32(c/9))] (LEA(Q|L)8 <v.Type> x x)) // combine add/shift into LEAQ/LEAL -(ADD(L|Q) x (SHL(L|Q)const [3] y)) -> (LEA(L|Q)8 x y) -(ADD(L|Q) x (SHL(L|Q)const [2] y)) -> (LEA(L|Q)4 x y) -(ADD(L|Q) x (SHL(L|Q)const [1] y)) -> (LEA(L|Q)2 x y) -(ADD(L|Q) x (ADD(L|Q) y y)) -> (LEA(L|Q)2 x y) -(ADD(L|Q) x (ADD(L|Q) x y)) -> (LEA(L|Q)2 y x) +(ADD(L|Q) x (SHL(L|Q)const [3] y)) => (LEA(L|Q)8 x y) +(ADD(L|Q) x (SHL(L|Q)const [2] y)) => (LEA(L|Q)4 x y) +(ADD(L|Q) x (SHL(L|Q)const [1] y)) => (LEA(L|Q)2 x y) +(ADD(L|Q) x (ADD(L|Q) y y)) => (LEA(L|Q)2 x y) +(ADD(L|Q) x (ADD(L|Q) x y)) => (LEA(L|Q)2 y x) // combine ADDQ/ADDQconst into LEAQ1/LEAL1 -(ADD(Q|L)const [c] (ADD(Q|L) x y)) -> (LEA(Q|L)1 [c] x y) -(ADD(Q|L) (ADD(Q|L)const [c] x) y) -> (LEA(Q|L)1 [c] x y) -(ADD(Q|L)const [c] (SHL(Q|L)const [1] x)) -> (LEA(Q|L)1 [c] x x) +(ADD(Q|L)const [c] (ADD(Q|L) x y)) => (LEA(Q|L)1 [c] x y) +(ADD(Q|L) (ADD(Q|L)const [c] x) y) => (LEA(Q|L)1 [c] x y) +(ADD(Q|L)const [c] (SHL(Q|L)const [1] x)) => (LEA(Q|L)1 [c] x x) // fold ADDQ/ADDL into LEAQ/LEAL -(ADD(Q|L)const [c] (LEA(Q|L) [d] {s} x)) && is32Bit(c+d) -> (LEA(Q|L) [c+d] {s} x) -(LEA(Q|L) [c] {s} (ADD(Q|L)const [d] x)) && is32Bit(c+d) -> (LEA(Q|L) [c+d] {s} x) -(LEA(Q|L) [c] {s} (ADD(Q|L) x y)) && x.Op != OpSB && y.Op != OpSB -> (LEA(Q|L)1 [c] {s} x y) -(ADD(Q|L) x (LEA(Q|L) [c] {s} y)) && x.Op != OpSB && y.Op != OpSB -> (LEA(Q|L)1 [c] {s} x y) +(ADD(Q|L)const [c] (LEA(Q|L) [d] {s} x)) && is32Bit(int64(c)+int64(d)) => (LEA(Q|L) [c+d] {s} x) +(LEA(Q|L) [c] {s} (ADD(Q|L)const [d] x)) && is32Bit(int64(c)+int64(d)) => (LEA(Q|L) [c+d] {s} x) +(LEA(Q|L) [c] {s} (ADD(Q|L) x y)) && x.Op != OpSB && y.Op != OpSB => (LEA(Q|L)1 [c] {s} x y) +(ADD(Q|L) x (LEA(Q|L) [c] {s} y)) && x.Op != OpSB && y.Op != OpSB => (LEA(Q|L)1 [c] {s} x y) // fold ADDQconst/ADDLconst into LEAQx/LEALx -(ADD(Q|L)const [c] (LEA(Q|L)1 [d] {s} x y)) && is32Bit(c+d) -> (LEA(Q|L)1 [c+d] {s} x y) -(ADD(Q|L)const [c] (LEA(Q|L)2 [d] {s} x y)) && is32Bit(c+d) -> (LEA(Q|L)2 [c+d] {s} x y) -(ADD(Q|L)const [c] (LEA(Q|L)4 [d] {s} x y)) && is32Bit(c+d) -> (LEA(Q|L)4 [c+d] {s} x y) -(ADD(Q|L)const [c] (LEA(Q|L)8 [d] {s} x y)) && is32Bit(c+d) -> (LEA(Q|L)8 [c+d] {s} x y) -(LEA(Q|L)1 [c] {s} (ADD(Q|L)const [d] x) y) && is32Bit(c+d) && x.Op != OpSB -> (LEA(Q|L)1 [c+d] {s} x y) -(LEA(Q|L)2 [c] {s} (ADD(Q|L)const [d] x) y) && is32Bit(c+d) && x.Op != OpSB -> (LEA(Q|L)2 [c+d] {s} x y) -(LEA(Q|L)2 [c] {s} x (ADD(Q|L)const [d] y)) && is32Bit(c+2*d) && y.Op != OpSB -> (LEA(Q|L)2 [c+2*d] {s} x y) -(LEA(Q|L)4 [c] {s} (ADD(Q|L)const [d] x) y) && is32Bit(c+d) && x.Op != OpSB -> (LEA(Q|L)4 [c+d] {s} x y) -(LEA(Q|L)4 [c] {s} x (ADD(Q|L)const [d] y)) && is32Bit(c+4*d) && y.Op != OpSB -> (LEA(Q|L)4 [c+4*d] {s} x y) -(LEA(Q|L)8 [c] {s} (ADD(Q|L)const [d] x) y) && is32Bit(c+d) && x.Op != OpSB -> (LEA(Q|L)8 [c+d] {s} x y) -(LEA(Q|L)8 [c] {s} x (ADD(Q|L)const [d] y)) && is32Bit(c+8*d) && y.Op != OpSB -> (LEA(Q|L)8 [c+8*d] {s} x y) +(ADD(Q|L)const [c] (LEA(Q|L)1 [d] {s} x y)) && is32Bit(int64(c)+int64(d)) => (LEA(Q|L)1 [c+d] {s} x y) +(ADD(Q|L)const [c] (LEA(Q|L)2 [d] {s} x y)) && is32Bit(int64(c)+int64(d)) => (LEA(Q|L)2 [c+d] {s} x y) +(ADD(Q|L)const [c] (LEA(Q|L)4 [d] {s} x y)) && is32Bit(int64(c)+int64(d)) => (LEA(Q|L)4 [c+d] {s} x y) +(ADD(Q|L)const [c] (LEA(Q|L)8 [d] {s} x y)) && is32Bit(int64(c)+int64(d)) => (LEA(Q|L)8 [c+d] {s} x y) +(LEA(Q|L)1 [c] {s} (ADD(Q|L)const [d] x) y) && is32Bit(int64(c)+int64(d)) && x.Op != OpSB => (LEA(Q|L)1 [c+d] {s} x y) +(LEA(Q|L)2 [c] {s} (ADD(Q|L)const [d] x) y) && is32Bit(int64(c)+int64(d)) && x.Op != OpSB => (LEA(Q|L)2 [c+d] {s} x y) +(LEA(Q|L)2 [c] {s} x (ADD(Q|L)const [d] y)) && is32Bit(int64(c)+2*int64(d)) && y.Op != OpSB => (LEA(Q|L)2 [c+2*d] {s} x y) +(LEA(Q|L)4 [c] {s} (ADD(Q|L)const [d] x) y) && is32Bit(int64(c)+int64(d)) && x.Op != OpSB => (LEA(Q|L)4 [c+d] {s} x y) +(LEA(Q|L)4 [c] {s} x (ADD(Q|L)const [d] y)) && is32Bit(int64(c)+4*int64(d)) && y.Op != OpSB => (LEA(Q|L)4 [c+4*d] {s} x y) +(LEA(Q|L)8 [c] {s} (ADD(Q|L)const [d] x) y) && is32Bit(int64(c)+int64(d)) && x.Op != OpSB => (LEA(Q|L)8 [c+d] {s} x y) +(LEA(Q|L)8 [c] {s} x (ADD(Q|L)const [d] y)) && is32Bit(int64(c)+8*int64(d)) && y.Op != OpSB => (LEA(Q|L)8 [c+8*d] {s} x y) // fold shifts into LEAQx/LEALx -(LEA(Q|L)1 [c] {s} x (SHL(Q|L)const [1] y)) -> (LEA(Q|L)2 [c] {s} x y) -(LEA(Q|L)1 [c] {s} x (SHL(Q|L)const [2] y)) -> (LEA(Q|L)4 [c] {s} x y) -(LEA(Q|L)1 [c] {s} x (SHL(Q|L)const [3] y)) -> (LEA(Q|L)8 [c] {s} x y) -(LEA(Q|L)2 [c] {s} x (SHL(Q|L)const [1] y)) -> (LEA(Q|L)4 [c] {s} x y) -(LEA(Q|L)2 [c] {s} x (SHL(Q|L)const [2] y)) -> (LEA(Q|L)8 [c] {s} x y) -(LEA(Q|L)4 [c] {s} x (SHL(Q|L)const [1] y)) -> (LEA(Q|L)8 [c] {s} x y) +(LEA(Q|L)1 [c] {s} x (SHL(Q|L)const [1] y)) => (LEA(Q|L)2 [c] {s} x y) +(LEA(Q|L)1 [c] {s} x (SHL(Q|L)const [2] y)) => (LEA(Q|L)4 [c] {s} x y) +(LEA(Q|L)1 [c] {s} x (SHL(Q|L)const [3] y)) => (LEA(Q|L)8 [c] {s} x y) +(LEA(Q|L)2 [c] {s} x (SHL(Q|L)const [1] y)) => (LEA(Q|L)4 [c] {s} x y) +(LEA(Q|L)2 [c] {s} x (SHL(Q|L)const [2] y)) => (LEA(Q|L)8 [c] {s} x y) +(LEA(Q|L)4 [c] {s} x (SHL(Q|L)const [1] y)) => (LEA(Q|L)8 [c] {s} x y) // reverse ordering of compare instruction -(SETL (InvertFlags x)) -> (SETG x) -(SETG (InvertFlags x)) -> (SETL x) -(SETB (InvertFlags x)) -> (SETA x) -(SETA (InvertFlags x)) -> (SETB x) -(SETLE (InvertFlags x)) -> (SETGE x) -(SETGE (InvertFlags x)) -> (SETLE x) -(SETBE (InvertFlags x)) -> (SETAE x) -(SETAE (InvertFlags x)) -> (SETBE x) -(SETEQ (InvertFlags x)) -> (SETEQ x) -(SETNE (InvertFlags x)) -> (SETNE x) - -(SETLstore [off] {sym} ptr (InvertFlags x) mem) -> (SETGstore [off] {sym} ptr x mem) -(SETGstore [off] {sym} ptr (InvertFlags x) mem) -> (SETLstore [off] {sym} ptr x mem) -(SETBstore [off] {sym} ptr (InvertFlags x) mem) -> (SETAstore [off] {sym} ptr x mem) -(SETAstore [off] {sym} ptr (InvertFlags x) mem) -> (SETBstore [off] {sym} ptr x mem) -(SETLEstore [off] {sym} ptr (InvertFlags x) mem) -> (SETGEstore [off] {sym} ptr x mem) -(SETGEstore [off] {sym} ptr (InvertFlags x) mem) -> (SETLEstore [off] {sym} ptr x mem) -(SETBEstore [off] {sym} ptr (InvertFlags x) mem) -> (SETAEstore [off] {sym} ptr x mem) -(SETAEstore [off] {sym} ptr (InvertFlags x) mem) -> (SETBEstore [off] {sym} ptr x mem) -(SETEQstore [off] {sym} ptr (InvertFlags x) mem) -> (SETEQstore [off] {sym} ptr x mem) -(SETNEstore [off] {sym} ptr (InvertFlags x) mem) -> (SETNEstore [off] {sym} ptr x mem) +(SETL (InvertFlags x)) => (SETG x) +(SETG (InvertFlags x)) => (SETL x) +(SETB (InvertFlags x)) => (SETA x) +(SETA (InvertFlags x)) => (SETB x) +(SETLE (InvertFlags x)) => (SETGE x) +(SETGE (InvertFlags x)) => (SETLE x) +(SETBE (InvertFlags x)) => (SETAE x) +(SETAE (InvertFlags x)) => (SETBE x) +(SETEQ (InvertFlags x)) => (SETEQ x) +(SETNE (InvertFlags x)) => (SETNE x) + +(SETLstore [off] {sym} ptr (InvertFlags x) mem) => (SETGstore [off] {sym} ptr x mem) +(SETGstore [off] {sym} ptr (InvertFlags x) mem) => (SETLstore [off] {sym} ptr x mem) +(SETBstore [off] {sym} ptr (InvertFlags x) mem) => (SETAstore [off] {sym} ptr x mem) +(SETAstore [off] {sym} ptr (InvertFlags x) mem) => (SETBstore [off] {sym} ptr x mem) +(SETLEstore [off] {sym} ptr (InvertFlags x) mem) => (SETGEstore [off] {sym} ptr x mem) +(SETGEstore [off] {sym} ptr (InvertFlags x) mem) => (SETLEstore [off] {sym} ptr x mem) +(SETBEstore [off] {sym} ptr (InvertFlags x) mem) => (SETAEstore [off] {sym} ptr x mem) +(SETAEstore [off] {sym} ptr (InvertFlags x) mem) => (SETBEstore [off] {sym} ptr x mem) +(SETEQstore [off] {sym} ptr (InvertFlags x) mem) => (SETEQstore [off] {sym} ptr x mem) +(SETNEstore [off] {sym} ptr (InvertFlags x) mem) => (SETNEstore [off] {sym} ptr x mem) // sign extended loads // Note: The combined instruction must end up in the same block @@ -1029,100 +1036,100 @@ // Make sure we don't combine these ops if the load has another use. // This prevents a single load from being split into multiple loads // which then might return different values. See test/atomicload.go. -(MOVBQSX x:(MOVBload [off] {sym} ptr mem)) && x.Uses == 1 && clobber(x) -> @x.Block (MOVBQSXload <v.Type> [off] {sym} ptr mem) -(MOVBQSX x:(MOVWload [off] {sym} ptr mem)) && x.Uses == 1 && clobber(x) -> @x.Block (MOVBQSXload <v.Type> [off] {sym} ptr mem) -(MOVBQSX x:(MOVLload [off] {sym} ptr mem)) && x.Uses == 1 && clobber(x) -> @x.Block (MOVBQSXload <v.Type> [off] {sym} ptr mem) -(MOVBQSX x:(MOVQload [off] {sym} ptr mem)) && x.Uses == 1 && clobber(x) -> @x.Block (MOVBQSXload <v.Type> [off] {sym} ptr mem) -(MOVBQZX x:(MOVBload [off] {sym} ptr mem)) && x.Uses == 1 && clobber(x) -> @x.Block (MOVBload <v.Type> [off] {sym} ptr mem) -(MOVBQZX x:(MOVWload [off] {sym} ptr mem)) && x.Uses == 1 && clobber(x) -> @x.Block (MOVBload <v.Type> [off] {sym} ptr mem) -(MOVBQZX x:(MOVLload [off] {sym} ptr mem)) && x.Uses == 1 && clobber(x) -> @x.Block (MOVBload <v.Type> [off] {sym} ptr mem) -(MOVBQZX x:(MOVQload [off] {sym} ptr mem)) && x.Uses == 1 && clobber(x) -> @x.Block (MOVBload <v.Type> [off] {sym} ptr mem) -(MOVWQSX x:(MOVWload [off] {sym} ptr mem)) && x.Uses == 1 && clobber(x) -> @x.Block (MOVWQSXload <v.Type> [off] {sym} ptr mem) -(MOVWQSX x:(MOVLload [off] {sym} ptr mem)) && x.Uses == 1 && clobber(x) -> @x.Block (MOVWQSXload <v.Type> [off] {sym} ptr mem) -(MOVWQSX x:(MOVQload [off] {sym} ptr mem)) && x.Uses == 1 && clobber(x) -> @x.Block (MOVWQSXload <v.Type> [off] {sym} ptr mem) -(MOVWQZX x:(MOVWload [off] {sym} ptr mem)) && x.Uses == 1 && clobber(x) -> @x.Block (MOVWload <v.Type> [off] {sym} ptr mem) -(MOVWQZX x:(MOVLload [off] {sym} ptr mem)) && x.Uses == 1 && clobber(x) -> @x.Block (MOVWload <v.Type> [off] {sym} ptr mem) -(MOVWQZX x:(MOVQload [off] {sym} ptr mem)) && x.Uses == 1 && clobber(x) -> @x.Block (MOVWload <v.Type> [off] {sym} ptr mem) -(MOVLQSX x:(MOVLload [off] {sym} ptr mem)) && x.Uses == 1 && clobber(x) -> @x.Block (MOVLQSXload <v.Type> [off] {sym} ptr mem) -(MOVLQSX x:(MOVQload [off] {sym} ptr mem)) && x.Uses == 1 && clobber(x) -> @x.Block (MOVLQSXload <v.Type> [off] {sym} ptr mem) -(MOVLQZX x:(MOVLload [off] {sym} ptr mem)) && x.Uses == 1 && clobber(x) -> @x.Block (MOVLload <v.Type> [off] {sym} ptr mem) -(MOVLQZX x:(MOVQload [off] {sym} ptr mem)) && x.Uses == 1 && clobber(x) -> @x.Block (MOVLload <v.Type> [off] {sym} ptr mem) - -(MOVLQZX x) && zeroUpper32Bits(x,3) -> x -(MOVWQZX x) && zeroUpper48Bits(x,3) -> x -(MOVBQZX x) && zeroUpper56Bits(x,3) -> x +(MOVBQSX x:(MOVBload [off] {sym} ptr mem)) && x.Uses == 1 && clobber(x) => @x.Block (MOVBQSXload <v.Type> [off] {sym} ptr mem) +(MOVBQSX x:(MOVWload [off] {sym} ptr mem)) && x.Uses == 1 && clobber(x) => @x.Block (MOVBQSXload <v.Type> [off] {sym} ptr mem) +(MOVBQSX x:(MOVLload [off] {sym} ptr mem)) && x.Uses == 1 && clobber(x) => @x.Block (MOVBQSXload <v.Type> [off] {sym} ptr mem) +(MOVBQSX x:(MOVQload [off] {sym} ptr mem)) && x.Uses == 1 && clobber(x) => @x.Block (MOVBQSXload <v.Type> [off] {sym} ptr mem) +(MOVBQZX x:(MOVBload [off] {sym} ptr mem)) && x.Uses == 1 && clobber(x) => @x.Block (MOVBload <v.Type> [off] {sym} ptr mem) +(MOVBQZX x:(MOVWload [off] {sym} ptr mem)) && x.Uses == 1 && clobber(x) => @x.Block (MOVBload <v.Type> [off] {sym} ptr mem) +(MOVBQZX x:(MOVLload [off] {sym} ptr mem)) && x.Uses == 1 && clobber(x) => @x.Block (MOVBload <v.Type> [off] {sym} ptr mem) +(MOVBQZX x:(MOVQload [off] {sym} ptr mem)) && x.Uses == 1 && clobber(x) => @x.Block (MOVBload <v.Type> [off] {sym} ptr mem) +(MOVWQSX x:(MOVWload [off] {sym} ptr mem)) && x.Uses == 1 && clobber(x) => @x.Block (MOVWQSXload <v.Type> [off] {sym} ptr mem) +(MOVWQSX x:(MOVLload [off] {sym} ptr mem)) && x.Uses == 1 && clobber(x) => @x.Block (MOVWQSXload <v.Type> [off] {sym} ptr mem) +(MOVWQSX x:(MOVQload [off] {sym} ptr mem)) && x.Uses == 1 && clobber(x) => @x.Block (MOVWQSXload <v.Type> [off] {sym} ptr mem) +(MOVWQZX x:(MOVWload [off] {sym} ptr mem)) && x.Uses == 1 && clobber(x) => @x.Block (MOVWload <v.Type> [off] {sym} ptr mem) +(MOVWQZX x:(MOVLload [off] {sym} ptr mem)) && x.Uses == 1 && clobber(x) => @x.Block (MOVWload <v.Type> [off] {sym} ptr mem) +(MOVWQZX x:(MOVQload [off] {sym} ptr mem)) && x.Uses == 1 && clobber(x) => @x.Block (MOVWload <v.Type> [off] {sym} ptr mem) +(MOVLQSX x:(MOVLload [off] {sym} ptr mem)) && x.Uses == 1 && clobber(x) => @x.Block (MOVLQSXload <v.Type> [off] {sym} ptr mem) +(MOVLQSX x:(MOVQload [off] {sym} ptr mem)) && x.Uses == 1 && clobber(x) => @x.Block (MOVLQSXload <v.Type> [off] {sym} ptr mem) +(MOVLQZX x:(MOVLload [off] {sym} ptr mem)) && x.Uses == 1 && clobber(x) => @x.Block (MOVLload <v.Type> [off] {sym} ptr mem) +(MOVLQZX x:(MOVQload [off] {sym} ptr mem)) && x.Uses == 1 && clobber(x) => @x.Block (MOVLload <v.Type> [off] {sym} ptr mem) + +(MOVLQZX x) && zeroUpper32Bits(x,3) => x +(MOVWQZX x) && zeroUpper48Bits(x,3) => x +(MOVBQZX x) && zeroUpper56Bits(x,3) => x // replace load from same location as preceding store with zero/sign extension (or copy in case of full width) -(MOVBload [off] {sym} ptr (MOVBstore [off2] {sym2} ptr2 x _)) && sym == sym2 && off == off2 && isSamePtr(ptr, ptr2) -> (MOVBQZX x) -(MOVWload [off] {sym} ptr (MOVWstore [off2] {sym2} ptr2 x _)) && sym == sym2 && off == off2 && isSamePtr(ptr, ptr2) -> (MOVWQZX x) -(MOVLload [off] {sym} ptr (MOVLstore [off2] {sym2} ptr2 x _)) && sym == sym2 && off == off2 && isSamePtr(ptr, ptr2) -> (MOVLQZX x) -(MOVQload [off] {sym} ptr (MOVQstore [off2] {sym2} ptr2 x _)) && sym == sym2 && off == off2 && isSamePtr(ptr, ptr2) -> x -(MOVBQSXload [off] {sym} ptr (MOVBstore [off2] {sym2} ptr2 x _)) && sym == sym2 && off == off2 && isSamePtr(ptr, ptr2) -> (MOVBQSX x) -(MOVWQSXload [off] {sym} ptr (MOVWstore [off2] {sym2} ptr2 x _)) && sym == sym2 && off == off2 && isSamePtr(ptr, ptr2) -> (MOVWQSX x) -(MOVLQSXload [off] {sym} ptr (MOVLstore [off2] {sym2} ptr2 x _)) && sym == sym2 && off == off2 && isSamePtr(ptr, ptr2) -> (MOVLQSX x) +(MOVBload [off] {sym} ptr (MOVBstore [off2] {sym2} ptr2 x _)) && sym == sym2 && off == off2 && isSamePtr(ptr, ptr2) => (MOVBQZX x) +(MOVWload [off] {sym} ptr (MOVWstore [off2] {sym2} ptr2 x _)) && sym == sym2 && off == off2 && isSamePtr(ptr, ptr2) => (MOVWQZX x) +(MOVLload [off] {sym} ptr (MOVLstore [off2] {sym2} ptr2 x _)) && sym == sym2 && off == off2 && isSamePtr(ptr, ptr2) => (MOVLQZX x) +(MOVQload [off] {sym} ptr (MOVQstore [off2] {sym2} ptr2 x _)) && sym == sym2 && off == off2 && isSamePtr(ptr, ptr2) => x +(MOVBQSXload [off] {sym} ptr (MOVBstore [off2] {sym2} ptr2 x _)) && sym == sym2 && off == off2 && isSamePtr(ptr, ptr2) => (MOVBQSX x) +(MOVWQSXload [off] {sym} ptr (MOVWstore [off2] {sym2} ptr2 x _)) && sym == sym2 && off == off2 && isSamePtr(ptr, ptr2) => (MOVWQSX x) +(MOVLQSXload [off] {sym} ptr (MOVLstore [off2] {sym2} ptr2 x _)) && sym == sym2 && off == off2 && isSamePtr(ptr, ptr2) => (MOVLQSX x) // Fold extensions and ANDs together. -(MOVBQZX (ANDLconst [c] x)) -> (ANDLconst [c & 0xff] x) -(MOVWQZX (ANDLconst [c] x)) -> (ANDLconst [c & 0xffff] x) -(MOVLQZX (ANDLconst [c] x)) -> (ANDLconst [c] x) -(MOVBQSX (ANDLconst [c] x)) && c & 0x80 == 0 -> (ANDLconst [c & 0x7f] x) -(MOVWQSX (ANDLconst [c] x)) && c & 0x8000 == 0 -> (ANDLconst [c & 0x7fff] x) -(MOVLQSX (ANDLconst [c] x)) && c & 0x80000000 == 0 -> (ANDLconst [c & 0x7fffffff] x) +(MOVBQZX (ANDLconst [c] x)) => (ANDLconst [c & 0xff] x) +(MOVWQZX (ANDLconst [c] x)) => (ANDLconst [c & 0xffff] x) +(MOVLQZX (ANDLconst [c] x)) => (ANDLconst [c] x) +(MOVBQSX (ANDLconst [c] x)) && c & 0x80 == 0 => (ANDLconst [c & 0x7f] x) +(MOVWQSX (ANDLconst [c] x)) && c & 0x8000 == 0 => (ANDLconst [c & 0x7fff] x) +(MOVLQSX (ANDLconst [c] x)) && uint32(c) & 0x80000000 == 0 => (ANDLconst [c & 0x7fffffff] x) // Don't extend before storing -(MOVLstore [off] {sym} ptr (MOVLQSX x) mem) -> (MOVLstore [off] {sym} ptr x mem) -(MOVWstore [off] {sym} ptr (MOVWQSX x) mem) -> (MOVWstore [off] {sym} ptr x mem) -(MOVBstore [off] {sym} ptr (MOVBQSX x) mem) -> (MOVBstore [off] {sym} ptr x mem) -(MOVLstore [off] {sym} ptr (MOVLQZX x) mem) -> (MOVLstore [off] {sym} ptr x mem) -(MOVWstore [off] {sym} ptr (MOVWQZX x) mem) -> (MOVWstore [off] {sym} ptr x mem) -(MOVBstore [off] {sym} ptr (MOVBQZX x) mem) -> (MOVBstore [off] {sym} ptr x mem) +(MOVLstore [off] {sym} ptr (MOVLQSX x) mem) => (MOVLstore [off] {sym} ptr x mem) +(MOVWstore [off] {sym} ptr (MOVWQSX x) mem) => (MOVWstore [off] {sym} ptr x mem) +(MOVBstore [off] {sym} ptr (MOVBQSX x) mem) => (MOVBstore [off] {sym} ptr x mem) +(MOVLstore [off] {sym} ptr (MOVLQZX x) mem) => (MOVLstore [off] {sym} ptr x mem) +(MOVWstore [off] {sym} ptr (MOVWQZX x) mem) => (MOVWstore [off] {sym} ptr x mem) +(MOVBstore [off] {sym} ptr (MOVBQZX x) mem) => (MOVBstore [off] {sym} ptr x mem) // fold constants into memory operations // Note that this is not always a good idea because if not all the uses of // the ADDQconst get eliminated, we still have to compute the ADDQconst and we now // have potentially two live values (ptr and (ADDQconst [off] ptr)) instead of one. // Nevertheless, let's do it! -(MOV(Q|L|W|B|SS|SD|O)load [off1] {sym} (ADDQconst [off2] ptr) mem) && is32Bit(off1+off2) -> +(MOV(Q|L|W|B|SS|SD|O)load [off1] {sym} (ADDQconst [off2] ptr) mem) && is32Bit(int64(off1)+int64(off2)) => (MOV(Q|L|W|B|SS|SD|O)load [off1+off2] {sym} ptr mem) -(MOV(Q|L|W|B|SS|SD|O)store [off1] {sym} (ADDQconst [off2] ptr) val mem) && is32Bit(off1+off2) -> +(MOV(Q|L|W|B|SS|SD|O)store [off1] {sym} (ADDQconst [off2] ptr) val mem) && is32Bit(int64(off1)+int64(off2)) => (MOV(Q|L|W|B|SS|SD|O)store [off1+off2] {sym} ptr val mem) -(SET(L|G|B|A|LE|GE|BE|AE|EQ|NE)store [off1] {sym} (ADDQconst [off2] base) val mem) && is32Bit(off1+off2) -> +(SET(L|G|B|A|LE|GE|BE|AE|EQ|NE)store [off1] {sym} (ADDQconst [off2] base) val mem) && is32Bit(int64(off1)+int64(off2)) => (SET(L|G|B|A|LE|GE|BE|AE|EQ|NE)store [off1+off2] {sym} base val mem) -((ADD|SUB|AND|OR|XOR)Qload [off1] {sym} val (ADDQconst [off2] base) mem) && is32Bit(off1+off2) -> +((ADD|SUB|AND|OR|XOR)Qload [off1] {sym} val (ADDQconst [off2] base) mem) && is32Bit(int64(off1)+int64(off2)) => ((ADD|SUB|AND|OR|XOR)Qload [off1+off2] {sym} val base mem) -((ADD|SUB|AND|OR|XOR)Lload [off1] {sym} val (ADDQconst [off2] base) mem) && is32Bit(off1+off2) -> +((ADD|SUB|AND|OR|XOR)Lload [off1] {sym} val (ADDQconst [off2] base) mem) && is32Bit(int64(off1)+int64(off2)) => ((ADD|SUB|AND|OR|XOR)Lload [off1+off2] {sym} val base mem) -(CMP(Q|L|W|B)load [off1] {sym} (ADDQconst [off2] base) val mem) && is32Bit(off1+off2) -> +(CMP(Q|L|W|B)load [off1] {sym} (ADDQconst [off2] base) val mem) && is32Bit(int64(off1)+int64(off2)) => (CMP(Q|L|W|B)load [off1+off2] {sym} base val mem) -(CMP(Q|L|W|B)constload [valoff1] {sym} (ADDQconst [off2] base) mem) && ValAndOff(valoff1).canAdd(off2) -> - (CMP(Q|L|W|B)constload [ValAndOff(valoff1).add(off2)] {sym} base mem) +(CMP(Q|L|W|B)constload [valoff1] {sym} (ADDQconst [off2] base) mem) && ValAndOff(valoff1).canAdd32(off2) => + (CMP(Q|L|W|B)constload [ValAndOff(valoff1).addOffset32(off2)] {sym} base mem) -((ADD|SUB|MUL|DIV)SSload [off1] {sym} val (ADDQconst [off2] base) mem) && is32Bit(off1+off2) -> +((ADD|SUB|MUL|DIV)SSload [off1] {sym} val (ADDQconst [off2] base) mem) && is32Bit(int64(off1)+int64(off2)) => ((ADD|SUB|MUL|DIV)SSload [off1+off2] {sym} val base mem) -((ADD|SUB|MUL|DIV)SDload [off1] {sym} val (ADDQconst [off2] base) mem) && is32Bit(off1+off2) -> +((ADD|SUB|MUL|DIV)SDload [off1] {sym} val (ADDQconst [off2] base) mem) && is32Bit(int64(off1)+int64(off2)) => ((ADD|SUB|MUL|DIV)SDload [off1+off2] {sym} val base mem) -((ADD|AND|OR|XOR|BTC|BTR|BTS)Qconstmodify [valoff1] {sym} (ADDQconst [off2] base) mem) && ValAndOff(valoff1).canAdd(off2) -> - ((ADD|AND|OR|XOR|BTC|BTR|BTS)Qconstmodify [ValAndOff(valoff1).add(off2)] {sym} base mem) -((ADD|AND|OR|XOR|BTC|BTR|BTS)Lconstmodify [valoff1] {sym} (ADDQconst [off2] base) mem) && ValAndOff(valoff1).canAdd(off2) -> - ((ADD|AND|OR|XOR|BTC|BTR|BTS)Lconstmodify [ValAndOff(valoff1).add(off2)] {sym} base mem) -((ADD|SUB|AND|OR|XOR|BTC|BTR|BTS)Qmodify [off1] {sym} (ADDQconst [off2] base) val mem) && is32Bit(off1+off2) -> +((ADD|AND|OR|XOR|BTC|BTR|BTS)Qconstmodify [valoff1] {sym} (ADDQconst [off2] base) mem) && ValAndOff(valoff1).canAdd32(off2) => + ((ADD|AND|OR|XOR|BTC|BTR|BTS)Qconstmodify [ValAndOff(valoff1).addOffset32(off2)] {sym} base mem) +((ADD|AND|OR|XOR|BTC|BTR|BTS)Lconstmodify [valoff1] {sym} (ADDQconst [off2] base) mem) && ValAndOff(valoff1).canAdd32(off2) => + ((ADD|AND|OR|XOR|BTC|BTR|BTS)Lconstmodify [ValAndOff(valoff1).addOffset32(off2)] {sym} base mem) +((ADD|SUB|AND|OR|XOR|BTC|BTR|BTS)Qmodify [off1] {sym} (ADDQconst [off2] base) val mem) && is32Bit(int64(off1)+int64(off2)) => ((ADD|SUB|AND|OR|XOR|BTC|BTR|BTS)Qmodify [off1+off2] {sym} base val mem) -((ADD|SUB|AND|OR|XOR|BTC|BTR|BTS)Lmodify [off1] {sym} (ADDQconst [off2] base) val mem) && is32Bit(off1+off2) -> +((ADD|SUB|AND|OR|XOR|BTC|BTR|BTS)Lmodify [off1] {sym} (ADDQconst [off2] base) val mem) && is32Bit(int64(off1)+int64(off2)) => ((ADD|SUB|AND|OR|XOR|BTC|BTR|BTS)Lmodify [off1+off2] {sym} base val mem) // Fold constants into stores. -(MOVQstore [off] {sym} ptr (MOVQconst [c]) mem) && validValAndOff(c,off) -> - (MOVQstoreconst [makeValAndOff(c,off)] {sym} ptr mem) -(MOVLstore [off] {sym} ptr (MOV(L|Q)const [c]) mem) && validOff(off) -> - (MOVLstoreconst [makeValAndOff(int64(int32(c)),off)] {sym} ptr mem) -(MOVWstore [off] {sym} ptr (MOV(L|Q)const [c]) mem) && validOff(off) -> - (MOVWstoreconst [makeValAndOff(int64(int16(c)),off)] {sym} ptr mem) -(MOVBstore [off] {sym} ptr (MOV(L|Q)const [c]) mem) && validOff(off) -> - (MOVBstoreconst [makeValAndOff(int64(int8(c)),off)] {sym} ptr mem) +(MOVQstore [off] {sym} ptr (MOVQconst [c]) mem) && validVal(c) => + (MOVQstoreconst [makeValAndOff32(int32(c),off)] {sym} ptr mem) +(MOVLstore [off] {sym} ptr (MOV(L|Q)const [c]) mem) => + (MOVLstoreconst [makeValAndOff32(int32(c),off)] {sym} ptr mem) +(MOVWstore [off] {sym} ptr (MOV(L|Q)const [c]) mem) => + (MOVWstoreconst [makeValAndOff32(int32(int16(c)),off)] {sym} ptr mem) +(MOVBstore [off] {sym} ptr (MOV(L|Q)const [c]) mem) => + (MOVBstoreconst [makeValAndOff32(int32(int8(c)),off)] {sym} ptr mem) // Fold address offsets into constant stores. -(MOV(Q|L|W|B)storeconst [sc] {s} (ADDQconst [off] ptr) mem) && ValAndOff(sc).canAdd(off) -> - (MOV(Q|L|W|B)storeconst [ValAndOff(sc).add(off)] {s} ptr mem) +(MOV(Q|L|W|B)storeconst [sc] {s} (ADDQconst [off] ptr) mem) && ValAndOff(sc).canAdd32(off) => + (MOV(Q|L|W|B)storeconst [ValAndOff(sc).addOffset32(off)] {s} ptr mem) // We need to fold LEAQ into the MOVx ops so that the live variable analysis knows // what variables are being read/written by the ops. diff --git a/src/cmd/compile/internal/ssa/gen/ARM64.rules b/src/cmd/compile/internal/ssa/gen/ARM64.rules index c29e7f7edf..311067e87a 100644 --- a/src/cmd/compile/internal/ssa/gen/ARM64.rules +++ b/src/cmd/compile/internal/ssa/gen/ARM64.rules @@ -132,65 +132,65 @@ // we compare to 64 to ensure Go semantics for large shifts // Rules about rotates with non-const shift are based on the following rules, // if the following rules change, please also modify the rules based on them. -(Lsh64x64 <t> x y) => (CSEL {OpARM64LessThanU} (SLL <t> x y) (Const64 <t> [0]) (CMPconst [64] y)) -(Lsh64x32 <t> x y) => (CSEL {OpARM64LessThanU} (SLL <t> x (ZeroExt32to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt32to64 y))) -(Lsh64x16 <t> x y) => (CSEL {OpARM64LessThanU} (SLL <t> x (ZeroExt16to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt16to64 y))) -(Lsh64x8 <t> x y) => (CSEL {OpARM64LessThanU} (SLL <t> x (ZeroExt8to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt8to64 y))) - -(Lsh32x64 <t> x y) => (CSEL {OpARM64LessThanU} (SLL <t> x y) (Const64 <t> [0]) (CMPconst [64] y)) -(Lsh32x32 <t> x y) => (CSEL {OpARM64LessThanU} (SLL <t> x (ZeroExt32to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt32to64 y))) -(Lsh32x16 <t> x y) => (CSEL {OpARM64LessThanU} (SLL <t> x (ZeroExt16to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt16to64 y))) -(Lsh32x8 <t> x y) => (CSEL {OpARM64LessThanU} (SLL <t> x (ZeroExt8to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt8to64 y))) - -(Lsh16x64 <t> x y) => (CSEL {OpARM64LessThanU} (SLL <t> x y) (Const64 <t> [0]) (CMPconst [64] y)) -(Lsh16x32 <t> x y) => (CSEL {OpARM64LessThanU} (SLL <t> x (ZeroExt32to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt32to64 y))) -(Lsh16x16 <t> x y) => (CSEL {OpARM64LessThanU} (SLL <t> x (ZeroExt16to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt16to64 y))) -(Lsh16x8 <t> x y) => (CSEL {OpARM64LessThanU} (SLL <t> x (ZeroExt8to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt8to64 y))) - -(Lsh8x64 <t> x y) => (CSEL {OpARM64LessThanU} (SLL <t> x y) (Const64 <t> [0]) (CMPconst [64] y)) -(Lsh8x32 <t> x y) => (CSEL {OpARM64LessThanU} (SLL <t> x (ZeroExt32to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt32to64 y))) -(Lsh8x16 <t> x y) => (CSEL {OpARM64LessThanU} (SLL <t> x (ZeroExt16to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt16to64 y))) -(Lsh8x8 <t> x y) => (CSEL {OpARM64LessThanU} (SLL <t> x (ZeroExt8to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt8to64 y))) - -(Rsh64Ux64 <t> x y) => (CSEL {OpARM64LessThanU} (SRL <t> x y) (Const64 <t> [0]) (CMPconst [64] y)) -(Rsh64Ux32 <t> x y) => (CSEL {OpARM64LessThanU} (SRL <t> x (ZeroExt32to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt32to64 y))) -(Rsh64Ux16 <t> x y) => (CSEL {OpARM64LessThanU} (SRL <t> x (ZeroExt16to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt16to64 y))) -(Rsh64Ux8 <t> x y) => (CSEL {OpARM64LessThanU} (SRL <t> x (ZeroExt8to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt8to64 y))) - -(Rsh32Ux64 <t> x y) => (CSEL {OpARM64LessThanU} (SRL <t> (ZeroExt32to64 x) y) (Const64 <t> [0]) (CMPconst [64] y)) -(Rsh32Ux32 <t> x y) => (CSEL {OpARM64LessThanU} (SRL <t> (ZeroExt32to64 x) (ZeroExt32to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt32to64 y))) -(Rsh32Ux16 <t> x y) => (CSEL {OpARM64LessThanU} (SRL <t> (ZeroExt32to64 x) (ZeroExt16to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt16to64 y))) -(Rsh32Ux8 <t> x y) => (CSEL {OpARM64LessThanU} (SRL <t> (ZeroExt32to64 x) (ZeroExt8to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt8to64 y))) - -(Rsh16Ux64 <t> x y) => (CSEL {OpARM64LessThanU} (SRL <t> (ZeroExt16to64 x) y) (Const64 <t> [0]) (CMPconst [64] y)) -(Rsh16Ux32 <t> x y) => (CSEL {OpARM64LessThanU} (SRL <t> (ZeroExt16to64 x) (ZeroExt32to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt32to64 y))) -(Rsh16Ux16 <t> x y) => (CSEL {OpARM64LessThanU} (SRL <t> (ZeroExt16to64 x) (ZeroExt16to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt16to64 y))) -(Rsh16Ux8 <t> x y) => (CSEL {OpARM64LessThanU} (SRL <t> (ZeroExt16to64 x) (ZeroExt8to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt8to64 y))) - -(Rsh8Ux64 <t> x y) => (CSEL {OpARM64LessThanU} (SRL <t> (ZeroExt8to64 x) y) (Const64 <t> [0]) (CMPconst [64] y)) -(Rsh8Ux32 <t> x y) => (CSEL {OpARM64LessThanU} (SRL <t> (ZeroExt8to64 x) (ZeroExt32to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt32to64 y))) -(Rsh8Ux16 <t> x y) => (CSEL {OpARM64LessThanU} (SRL <t> (ZeroExt8to64 x) (ZeroExt16to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt16to64 y))) -(Rsh8Ux8 <t> x y) => (CSEL {OpARM64LessThanU} (SRL <t> (ZeroExt8to64 x) (ZeroExt8to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt8to64 y))) - -(Rsh64x64 x y) => (SRA x (CSEL {OpARM64LessThanU} <y.Type> y (Const64 <y.Type> [63]) (CMPconst [64] y))) -(Rsh64x32 x y) => (SRA x (CSEL {OpARM64LessThanU} <y.Type> (ZeroExt32to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt32to64 y)))) -(Rsh64x16 x y) => (SRA x (CSEL {OpARM64LessThanU} <y.Type> (ZeroExt16to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt16to64 y)))) -(Rsh64x8 x y) => (SRA x (CSEL {OpARM64LessThanU} <y.Type> (ZeroExt8to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt8to64 y)))) - -(Rsh32x64 x y) => (SRA (SignExt32to64 x) (CSEL {OpARM64LessThanU} <y.Type> y (Const64 <y.Type> [63]) (CMPconst [64] y))) -(Rsh32x32 x y) => (SRA (SignExt32to64 x) (CSEL {OpARM64LessThanU} <y.Type> (ZeroExt32to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt32to64 y)))) -(Rsh32x16 x y) => (SRA (SignExt32to64 x) (CSEL {OpARM64LessThanU} <y.Type> (ZeroExt16to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt16to64 y)))) -(Rsh32x8 x y) => (SRA (SignExt32to64 x) (CSEL {OpARM64LessThanU} <y.Type> (ZeroExt8to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt8to64 y)))) - -(Rsh16x64 x y) => (SRA (SignExt16to64 x) (CSEL {OpARM64LessThanU} <y.Type> y (Const64 <y.Type> [63]) (CMPconst [64] y))) -(Rsh16x32 x y) => (SRA (SignExt16to64 x) (CSEL {OpARM64LessThanU} <y.Type> (ZeroExt32to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt32to64 y)))) -(Rsh16x16 x y) => (SRA (SignExt16to64 x) (CSEL {OpARM64LessThanU} <y.Type> (ZeroExt16to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt16to64 y)))) -(Rsh16x8 x y) => (SRA (SignExt16to64 x) (CSEL {OpARM64LessThanU} <y.Type> (ZeroExt8to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt8to64 y)))) - -(Rsh8x64 x y) => (SRA (SignExt8to64 x) (CSEL {OpARM64LessThanU} <y.Type> y (Const64 <y.Type> [63]) (CMPconst [64] y))) -(Rsh8x32 x y) => (SRA (SignExt8to64 x) (CSEL {OpARM64LessThanU} <y.Type> (ZeroExt32to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt32to64 y)))) -(Rsh8x16 x y) => (SRA (SignExt8to64 x) (CSEL {OpARM64LessThanU} <y.Type> (ZeroExt16to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt16to64 y)))) -(Rsh8x8 x y) => (SRA (SignExt8to64 x) (CSEL {OpARM64LessThanU} <y.Type> (ZeroExt8to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt8to64 y)))) +(Lsh64x64 <t> x y) => (CSEL [OpARM64LessThanU] (SLL <t> x y) (Const64 <t> [0]) (CMPconst [64] y)) +(Lsh64x32 <t> x y) => (CSEL [OpARM64LessThanU] (SLL <t> x (ZeroExt32to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt32to64 y))) +(Lsh64x16 <t> x y) => (CSEL [OpARM64LessThanU] (SLL <t> x (ZeroExt16to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt16to64 y))) +(Lsh64x8 <t> x y) => (CSEL [OpARM64LessThanU] (SLL <t> x (ZeroExt8to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt8to64 y))) + +(Lsh32x64 <t> x y) => (CSEL [OpARM64LessThanU] (SLL <t> x y) (Const64 <t> [0]) (CMPconst [64] y)) +(Lsh32x32 <t> x y) => (CSEL [OpARM64LessThanU] (SLL <t> x (ZeroExt32to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt32to64 y))) +(Lsh32x16 <t> x y) => (CSEL [OpARM64LessThanU] (SLL <t> x (ZeroExt16to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt16to64 y))) +(Lsh32x8 <t> x y) => (CSEL [OpARM64LessThanU] (SLL <t> x (ZeroExt8to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt8to64 y))) + +(Lsh16x64 <t> x y) => (CSEL [OpARM64LessThanU] (SLL <t> x y) (Const64 <t> [0]) (CMPconst [64] y)) +(Lsh16x32 <t> x y) => (CSEL [OpARM64LessThanU] (SLL <t> x (ZeroExt32to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt32to64 y))) +(Lsh16x16 <t> x y) => (CSEL [OpARM64LessThanU] (SLL <t> x (ZeroExt16to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt16to64 y))) +(Lsh16x8 <t> x y) => (CSEL [OpARM64LessThanU] (SLL <t> x (ZeroExt8to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt8to64 y))) + +(Lsh8x64 <t> x y) => (CSEL [OpARM64LessThanU] (SLL <t> x y) (Const64 <t> [0]) (CMPconst [64] y)) +(Lsh8x32 <t> x y) => (CSEL [OpARM64LessThanU] (SLL <t> x (ZeroExt32to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt32to64 y))) +(Lsh8x16 <t> x y) => (CSEL [OpARM64LessThanU] (SLL <t> x (ZeroExt16to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt16to64 y))) +(Lsh8x8 <t> x y) => (CSEL [OpARM64LessThanU] (SLL <t> x (ZeroExt8to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt8to64 y))) + +(Rsh64Ux64 <t> x y) => (CSEL [OpARM64LessThanU] (SRL <t> x y) (Const64 <t> [0]) (CMPconst [64] y)) +(Rsh64Ux32 <t> x y) => (CSEL [OpARM64LessThanU] (SRL <t> x (ZeroExt32to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt32to64 y))) +(Rsh64Ux16 <t> x y) => (CSEL [OpARM64LessThanU] (SRL <t> x (ZeroExt16to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt16to64 y))) +(Rsh64Ux8 <t> x y) => (CSEL [OpARM64LessThanU] (SRL <t> x (ZeroExt8to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt8to64 y))) + +(Rsh32Ux64 <t> x y) => (CSEL [OpARM64LessThanU] (SRL <t> (ZeroExt32to64 x) y) (Const64 <t> [0]) (CMPconst [64] y)) +(Rsh32Ux32 <t> x y) => (CSEL [OpARM64LessThanU] (SRL <t> (ZeroExt32to64 x) (ZeroExt32to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt32to64 y))) +(Rsh32Ux16 <t> x y) => (CSEL [OpARM64LessThanU] (SRL <t> (ZeroExt32to64 x) (ZeroExt16to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt16to64 y))) +(Rsh32Ux8 <t> x y) => (CSEL [OpARM64LessThanU] (SRL <t> (ZeroExt32to64 x) (ZeroExt8to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt8to64 y))) + +(Rsh16Ux64 <t> x y) => (CSEL [OpARM64LessThanU] (SRL <t> (ZeroExt16to64 x) y) (Const64 <t> [0]) (CMPconst [64] y)) +(Rsh16Ux32 <t> x y) => (CSEL [OpARM64LessThanU] (SRL <t> (ZeroExt16to64 x) (ZeroExt32to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt32to64 y))) +(Rsh16Ux16 <t> x y) => (CSEL [OpARM64LessThanU] (SRL <t> (ZeroExt16to64 x) (ZeroExt16to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt16to64 y))) +(Rsh16Ux8 <t> x y) => (CSEL [OpARM64LessThanU] (SRL <t> (ZeroExt16to64 x) (ZeroExt8to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt8to64 y))) + +(Rsh8Ux64 <t> x y) => (CSEL [OpARM64LessThanU] (SRL <t> (ZeroExt8to64 x) y) (Const64 <t> [0]) (CMPconst [64] y)) +(Rsh8Ux32 <t> x y) => (CSEL [OpARM64LessThanU] (SRL <t> (ZeroExt8to64 x) (ZeroExt32to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt32to64 y))) +(Rsh8Ux16 <t> x y) => (CSEL [OpARM64LessThanU] (SRL <t> (ZeroExt8to64 x) (ZeroExt16to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt16to64 y))) +(Rsh8Ux8 <t> x y) => (CSEL [OpARM64LessThanU] (SRL <t> (ZeroExt8to64 x) (ZeroExt8to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt8to64 y))) + +(Rsh64x64 x y) => (SRA x (CSEL [OpARM64LessThanU] <y.Type> y (Const64 <y.Type> [63]) (CMPconst [64] y))) +(Rsh64x32 x y) => (SRA x (CSEL [OpARM64LessThanU] <y.Type> (ZeroExt32to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt32to64 y)))) +(Rsh64x16 x y) => (SRA x (CSEL [OpARM64LessThanU] <y.Type> (ZeroExt16to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt16to64 y)))) +(Rsh64x8 x y) => (SRA x (CSEL [OpARM64LessThanU] <y.Type> (ZeroExt8to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt8to64 y)))) + +(Rsh32x64 x y) => (SRA (SignExt32to64 x) (CSEL [OpARM64LessThanU] <y.Type> y (Const64 <y.Type> [63]) (CMPconst [64] y))) +(Rsh32x32 x y) => (SRA (SignExt32to64 x) (CSEL [OpARM64LessThanU] <y.Type> (ZeroExt32to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt32to64 y)))) +(Rsh32x16 x y) => (SRA (SignExt32to64 x) (CSEL [OpARM64LessThanU] <y.Type> (ZeroExt16to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt16to64 y)))) +(Rsh32x8 x y) => (SRA (SignExt32to64 x) (CSEL [OpARM64LessThanU] <y.Type> (ZeroExt8to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt8to64 y)))) + +(Rsh16x64 x y) => (SRA (SignExt16to64 x) (CSEL [OpARM64LessThanU] <y.Type> y (Const64 <y.Type> [63]) (CMPconst [64] y))) +(Rsh16x32 x y) => (SRA (SignExt16to64 x) (CSEL [OpARM64LessThanU] <y.Type> (ZeroExt32to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt32to64 y)))) +(Rsh16x16 x y) => (SRA (SignExt16to64 x) (CSEL [OpARM64LessThanU] <y.Type> (ZeroExt16to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt16to64 y)))) +(Rsh16x8 x y) => (SRA (SignExt16to64 x) (CSEL [OpARM64LessThanU] <y.Type> (ZeroExt8to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt8to64 y)))) + +(Rsh8x64 x y) => (SRA (SignExt8to64 x) (CSEL [OpARM64LessThanU] <y.Type> y (Const64 <y.Type> [63]) (CMPconst [64] y))) +(Rsh8x32 x y) => (SRA (SignExt8to64 x) (CSEL [OpARM64LessThanU] <y.Type> (ZeroExt32to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt32to64 y)))) +(Rsh8x16 x y) => (SRA (SignExt8to64 x) (CSEL [OpARM64LessThanU] <y.Type> (ZeroExt16to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt16to64 y)))) +(Rsh8x8 x y) => (SRA (SignExt8to64 x) (CSEL [OpARM64LessThanU] <y.Type> (ZeroExt8to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt8to64 y)))) // constants (Const(64|32|16|8) [val]) => (MOVDconst [int64(val)]) @@ -315,8 +315,8 @@ (FCMPD (FMOVDconst [0]) x) => (InvertFlags (FCMPD0 x)) // CSEL needs a flag-generating argument. Synthesize a CMPW if necessary. -(CondSelect x y boolval) && flagArg(boolval) != nil => (CSEL {boolval.Op} x y flagArg(boolval)) -(CondSelect x y boolval) && flagArg(boolval) == nil => (CSEL {OpARM64NotEqual} x y (CMPWconst [0] boolval)) +(CondSelect x y boolval) && flagArg(boolval) != nil => (CSEL [boolval.Op] x y flagArg(boolval)) +(CondSelect x y boolval) && flagArg(boolval) == nil => (CSEL [OpARM64NotEqual] x y (CMPWconst [0] boolval)) (OffPtr [off] ptr:(SP)) && is32Bit(off) => (MOVDaddr [int32(off)] ptr) (OffPtr [off] ptr) => (ADDconst [off] ptr) @@ -1324,8 +1324,8 @@ (XOR x (MVN y)) -> (EON x y) (OR x (MVN y)) -> (ORN x y) (MVN (XOR x y)) -> (EON x y) -(CSEL {cc} x (MOVDconst [0]) flag) -> (CSEL0 {cc} x flag) -(CSEL {cc} (MOVDconst [0]) y flag) -> (CSEL0 {arm64Negate(cc.(Op))} y flag) +(CSEL [cc] x (MOVDconst [0]) flag) => (CSEL0 [cc] x flag) +(CSEL [cc] (MOVDconst [0]) y flag) => (CSEL0 [arm64Negate(cc)] y flag) (SUB x (SUB y z)) -> (SUB (ADD <v.Type> x z) y) (SUB (SUB x y) z) -> (SUB x (ADD <y.Type> y z)) @@ -1481,8 +1481,8 @@ (GTnoov (InvertFlags cmp) yes no) => (LTnoov cmp yes no) // absorb InvertFlags into CSEL(0) -(CSEL {cc} x y (InvertFlags cmp)) => (CSEL {arm64Invert(cc)} x y cmp) -(CSEL0 {cc} x (InvertFlags cmp)) => (CSEL0 {arm64Invert(cc)} x cmp) +(CSEL [cc] x y (InvertFlags cmp)) => (CSEL [arm64Invert(cc)] x y cmp) +(CSEL0 [cc] x (InvertFlags cmp)) => (CSEL0 [arm64Invert(cc)] x cmp) // absorb flag constants into boolean values (Equal (FlagConstant [fc])) => (MOVDconst [b2i(fc.eq())]) @@ -1517,20 +1517,20 @@ (MOVBUreg x) && x.Type.IsBoolean() => (MOVDreg x) // absorb flag constants into conditional instructions -(CSEL {cc} x _ flag) && ccARM64Eval(cc, flag) > 0 => x -(CSEL {cc} _ y flag) && ccARM64Eval(cc, flag) < 0 => y -(CSEL0 {cc} x flag) && ccARM64Eval(cc, flag) > 0 => x -(CSEL0 {cc} _ flag) && ccARM64Eval(cc, flag) < 0 => (MOVDconst [0]) +(CSEL [cc] x _ flag) && ccARM64Eval(cc, flag) > 0 => x +(CSEL [cc] _ y flag) && ccARM64Eval(cc, flag) < 0 => y +(CSEL0 [cc] x flag) && ccARM64Eval(cc, flag) > 0 => x +(CSEL0 [cc] _ flag) && ccARM64Eval(cc, flag) < 0 => (MOVDconst [0]) // absorb flags back into boolean CSEL -(CSEL {cc} x y (CMPWconst [0] boolval)) && cc == OpARM64NotEqual && flagArg(boolval) != nil => - (CSEL {boolval.Op} x y flagArg(boolval)) -(CSEL {cc} x y (CMPWconst [0] boolval)) && cc == OpARM64Equal && flagArg(boolval) != nil => - (CSEL {arm64Negate(boolval.Op)} x y flagArg(boolval)) -(CSEL0 {cc} x (CMPWconst [0] boolval)) && cc == OpARM64NotEqual && flagArg(boolval) != nil => - (CSEL0 {boolval.Op} x flagArg(boolval)) -(CSEL0 {cc} x (CMPWconst [0] boolval)) && cc == OpARM64Equal && flagArg(boolval) != nil => - (CSEL0 {arm64Negate(boolval.Op)} x flagArg(boolval)) +(CSEL [cc] x y (CMPWconst [0] boolval)) && cc == OpARM64NotEqual && flagArg(boolval) != nil => + (CSEL [boolval.Op] x y flagArg(boolval)) +(CSEL [cc] x y (CMPWconst [0] boolval)) && cc == OpARM64Equal && flagArg(boolval) != nil => + (CSEL [arm64Negate(boolval.Op)] x y flagArg(boolval)) +(CSEL0 [cc] x (CMPWconst [0] boolval)) && cc == OpARM64NotEqual && flagArg(boolval) != nil => + (CSEL0 [boolval.Op] x flagArg(boolval)) +(CSEL0 [cc] x (CMPWconst [0] boolval)) && cc == OpARM64Equal && flagArg(boolval) != nil => + (CSEL0 [arm64Negate(boolval.Op)] x flagArg(boolval)) // absorb shifts into ops (NEG x:(SLLconst [c] y)) && clobberIfDead(x) => (NEGshiftLL [c] y) @@ -1691,11 +1691,11 @@ // "|" can also be "^" or "+". // As arm64 does not have a ROL instruction, so ROL(x, y) is replaced by ROR(x, -y). ((ADD|OR|XOR) (SLL x (ANDconst <t> [63] y)) - (CSEL0 <typ.UInt64> {cc} (SRL <typ.UInt64> x (SUB <t> (MOVDconst [64]) (ANDconst <t> [63] y))) + (CSEL0 <typ.UInt64> [cc] (SRL <typ.UInt64> x (SUB <t> (MOVDconst [64]) (ANDconst <t> [63] y))) (CMPconst [64] (SUB <t> (MOVDconst [64]) (ANDconst <t> [63] y))))) && cc == OpARM64LessThanU => (ROR x (NEG <t> y)) ((ADD|OR|XOR) (SRL <typ.UInt64> x (ANDconst <t> [63] y)) - (CSEL0 <typ.UInt64> {cc} (SLL x (SUB <t> (MOVDconst [64]) (ANDconst <t> [63] y))) + (CSEL0 <typ.UInt64> [cc] (SLL x (SUB <t> (MOVDconst [64]) (ANDconst <t> [63] y))) (CMPconst [64] (SUB <t> (MOVDconst [64]) (ANDconst <t> [63] y))))) && cc == OpARM64LessThanU => (ROR x y) @@ -1705,11 +1705,11 @@ // "|" can also be "^" or "+". // As arm64 does not have a ROLW instruction, so ROLW(x, y) is replaced by RORW(x, -y). ((ADD|OR|XOR) (SLL x (ANDconst <t> [31] y)) - (CSEL0 <typ.UInt32> {cc} (SRL <typ.UInt32> (MOVWUreg x) (SUB <t> (MOVDconst [32]) (ANDconst <t> [31] y))) + (CSEL0 <typ.UInt32> [cc] (SRL <typ.UInt32> (MOVWUreg x) (SUB <t> (MOVDconst [32]) (ANDconst <t> [31] y))) (CMPconst [64] (SUB <t> (MOVDconst [32]) (ANDconst <t> [31] y))))) && cc == OpARM64LessThanU => (RORW x (NEG <t> y)) ((ADD|OR|XOR) (SRL <typ.UInt32> (MOVWUreg x) (ANDconst <t> [31] y)) - (CSEL0 <typ.UInt32> {cc} (SLL x (SUB <t> (MOVDconst [32]) (ANDconst <t> [31] y))) + (CSEL0 <typ.UInt32> [cc] (SLL x (SUB <t> (MOVDconst [32]) (ANDconst <t> [31] y))) (CMPconst [64] (SUB <t> (MOVDconst [32]) (ANDconst <t> [31] y))))) && cc == OpARM64LessThanU => (RORW x y) diff --git a/src/cmd/compile/internal/ssa/gen/ARM64Ops.go b/src/cmd/compile/internal/ssa/gen/ARM64Ops.go index 2424e67e20..e9af261a6a 100644 --- a/src/cmd/compile/internal/ssa/gen/ARM64Ops.go +++ b/src/cmd/compile/internal/ssa/gen/ARM64Ops.go @@ -467,8 +467,8 @@ func init() { // conditional instructions; auxint is // one of the arm64 comparison pseudo-ops (LessThan, LessThanU, etc.) - {name: "CSEL", argLength: 3, reg: gp2flags1, asm: "CSEL", aux: "CCop"}, // aux(flags) ? arg0 : arg1 - {name: "CSEL0", argLength: 2, reg: gp1flags1, asm: "CSEL", aux: "CCop"}, // aux(flags) ? arg0 : 0 + {name: "CSEL", argLength: 3, reg: gp2flags1, asm: "CSEL", aux: "CCop"}, // auxint(flags) ? arg0 : arg1 + {name: "CSEL0", argLength: 2, reg: gp1flags1, asm: "CSEL", aux: "CCop"}, // auxint(flags) ? arg0 : 0 // function calls {name: "CALLstatic", argLength: 1, reg: regInfo{clobbers: callerSave}, aux: "SymOff", clobberFlags: true, call: true, symEffect: "None"}, // call static function aux.(*obj.LSym). arg0=mem, auxint=argsize, returns mem diff --git a/src/cmd/compile/internal/ssa/gen/PPC64.rules b/src/cmd/compile/internal/ssa/gen/PPC64.rules index 14942d50f9..e5fb1e98c2 100644 --- a/src/cmd/compile/internal/ssa/gen/PPC64.rules +++ b/src/cmd/compile/internal/ssa/gen/PPC64.rules @@ -110,13 +110,21 @@ // Rotate generation with non-const shift // these match patterns from math/bits/RotateLeft[32|64], but there could be others (ADD (SLD x (ANDconst <typ.Int64> [63] y)) (SRD x (SUB <typ.UInt> (MOVDconst [64]) (ANDconst <typ.UInt> [63] y)))) => (ROTL x y) +(ADD (SLD x (ANDconst <typ.Int64> [63] y)) (SRD x (SUBFCconst <typ.UInt> [64] (ANDconst <typ.UInt> [63] y)))) => (ROTL x y) ( OR (SLD x (ANDconst <typ.Int64> [63] y)) (SRD x (SUB <typ.UInt> (MOVDconst [64]) (ANDconst <typ.UInt> [63] y)))) => (ROTL x y) +( OR (SLD x (ANDconst <typ.Int64> [63] y)) (SRD x (SUBFCconst <typ.UInt> [64] (ANDconst <typ.UInt> [63] y)))) => (ROTL x y) (XOR (SLD x (ANDconst <typ.Int64> [63] y)) (SRD x (SUB <typ.UInt> (MOVDconst [64]) (ANDconst <typ.UInt> [63] y)))) => (ROTL x y) +(XOR (SLD x (ANDconst <typ.Int64> [63] y)) (SRD x (SUBFCconst <typ.UInt> [64] (ANDconst <typ.UInt> [63] y)))) => (ROTL x y) + +(ADD (SLW x (ANDconst <typ.Int32> [31] y)) (SRW x (SUBFCconst <typ.UInt> [32] (ANDconst <typ.UInt> [31] y)))) => (ROTLW x y) (ADD (SLW x (ANDconst <typ.Int32> [31] y)) (SRW x (SUB <typ.UInt> (MOVDconst [32]) (ANDconst <typ.UInt> [31] y)))) => (ROTLW x y) +( OR (SLW x (ANDconst <typ.Int32> [31] y)) (SRW x (SUBFCconst <typ.UInt> [32] (ANDconst <typ.UInt> [31] y)))) => (ROTLW x y) ( OR (SLW x (ANDconst <typ.Int32> [31] y)) (SRW x (SUB <typ.UInt> (MOVDconst [32]) (ANDconst <typ.UInt> [31] y)))) => (ROTLW x y) +(XOR (SLW x (ANDconst <typ.Int32> [31] y)) (SRW x (SUBFCconst <typ.UInt> [32] (ANDconst <typ.UInt> [31] y)))) => (ROTLW x y) (XOR (SLW x (ANDconst <typ.Int32> [31] y)) (SRW x (SUB <typ.UInt> (MOVDconst [32]) (ANDconst <typ.UInt> [31] y)))) => (ROTLW x y) + // Lowering rotates (RotateLeft32 x y) => (ROTLW x y) (RotateLeft64 x y) => (ROTL x y) @@ -192,11 +200,15 @@ (Rsh64Ux64 x (AND y (MOVDconst [63]))) => (SRD x (ANDconst <typ.Int64> [63] y)) (Rsh64Ux64 x (ANDconst <typ.UInt> [63] y)) => (SRD x (ANDconst <typ.UInt> [63] y)) (Rsh64Ux64 x (SUB <typ.UInt> (MOVDconst [64]) (ANDconst <typ.UInt> [63] y))) => (SRD x (SUB <typ.UInt> (MOVDconst [64]) (ANDconst <typ.UInt> [63] y))) +(Rsh64Ux64 x (SUBFCconst <typ.UInt> [64] (ANDconst <typ.UInt> [63] y))) => (SRD x (SUBFCconst <typ.UInt> [64] (ANDconst <typ.UInt> [63] y))) (Rsh64Ux64 x (SUB <typ.UInt> (MOVDconst [64]) (AND <typ.UInt> y (MOVDconst [63])))) => (SRD x (SUB <typ.UInt> (MOVDconst [64]) (ANDconst <typ.UInt> [63] y))) +(Rsh64Ux64 x (SUBFCconst <typ.UInt> [64] (AND <typ.UInt> y (MOVDconst [63])))) => (SRD x (SUBFCconst <typ.UInt> [64] (ANDconst <typ.UInt> [63] y))) (Rsh64x64 x (AND y (MOVDconst [63]))) => (SRAD x (ANDconst <typ.Int64> [63] y)) (Rsh64x64 x (ANDconst <typ.UInt> [63] y)) => (SRAD x (ANDconst <typ.UInt> [63] y)) (Rsh64x64 x (SUB <typ.UInt> (MOVDconst [64]) (ANDconst <typ.UInt> [63] y))) => (SRAD x (SUB <typ.UInt> (MOVDconst [64]) (ANDconst <typ.UInt> [63] y))) +(Rsh64x64 x (SUBFCconst <typ.UInt> [64] (ANDconst <typ.UInt> [63] y))) => (SRAD x (SUBFCconst <typ.UInt> [64] (ANDconst <typ.UInt> [63] y))) (Rsh64x64 x (SUB <typ.UInt> (MOVDconst [64]) (AND <typ.UInt> y (MOVDconst [63])))) => (SRAD x (SUB <typ.UInt> (MOVDconst [64]) (ANDconst <typ.UInt> [63] y))) +(Rsh64x64 x (SUBFCconst <typ.UInt> [64] (AND <typ.UInt> y (MOVDconst [63])))) => (SRAD x (SUBFCconst <typ.UInt> [64] (ANDconst <typ.UInt> [63] y))) (Lsh64x64 x y) => (SLD x (ISEL [0] y (MOVDconst [-1]) (CMPU y (MOVDconst [64])))) (Rsh64x64 x y) => (SRAD x (ISEL [0] y (MOVDconst [-1]) (CMPU y (MOVDconst [64])))) @@ -208,12 +220,16 @@ (Rsh32Ux64 x (AND y (MOVDconst [31]))) => (SRW x (ANDconst <typ.Int32> [31] y)) (Rsh32Ux64 x (ANDconst <typ.UInt> [31] y)) => (SRW x (ANDconst <typ.UInt> [31] y)) (Rsh32Ux64 x (SUB <typ.UInt> (MOVDconst [32]) (ANDconst <typ.UInt> [31] y))) => (SRW x (SUB <typ.UInt> (MOVDconst [32]) (ANDconst <typ.UInt> [31] y))) +(Rsh32Ux64 x (SUBFCconst <typ.UInt> [32] (ANDconst <typ.UInt> [31] y))) => (SRW x (SUBFCconst <typ.UInt> [32] (ANDconst <typ.UInt> [31] y))) (Rsh32Ux64 x (SUB <typ.UInt> (MOVDconst [32]) (AND <typ.UInt> y (MOVDconst [31])))) => (SRW x (SUB <typ.UInt> (MOVDconst [32]) (ANDconst <typ.UInt> [31] y))) +(Rsh32Ux64 x (SUBFCconst <typ.UInt> [32] (AND <typ.UInt> y (MOVDconst [31])))) => (SRW x (SUBFCconst <typ.UInt> [32] (ANDconst <typ.UInt> [31] y))) (Rsh32x64 x (AND y (MOVDconst [31]))) => (SRAW x (ANDconst <typ.Int32> [31] y)) (Rsh32x64 x (ANDconst <typ.UInt> [31] y)) => (SRAW x (ANDconst <typ.UInt> [31] y)) (Rsh32x64 x (SUB <typ.UInt> (MOVDconst [32]) (ANDconst <typ.UInt> [31] y))) => (SRAW x (SUB <typ.UInt> (MOVDconst [32]) (ANDconst <typ.UInt> [31] y))) +(Rsh32x64 x (SUBFCconst <typ.UInt> [32] (ANDconst <typ.UInt> [31] y))) => (SRAW x (SUBFCconst <typ.UInt> [32] (ANDconst <typ.UInt> [31] y))) (Rsh32x64 x (SUB <typ.UInt> (MOVDconst [32]) (AND <typ.UInt> y (MOVDconst [31])))) => (SRAW x (SUB <typ.UInt> (MOVDconst [32]) (ANDconst <typ.UInt> [31] y))) +(Rsh32x64 x (SUBFCconst <typ.UInt> [32] (AND <typ.UInt> y (MOVDconst [31])))) => (SRAW x (SUBFCconst <typ.UInt> [32] (ANDconst <typ.UInt> [31] y))) (Rsh32x64 x y) => (SRAW x (ISEL [0] y (MOVDconst [-1]) (CMPU y (MOVDconst [32])))) (Rsh32Ux64 x y) => (SRW x (ISEL [0] y (MOVDconst [-1]) (CMPU y (MOVDconst [32])))) @@ -276,18 +292,11 @@ (Rsh8Ux8 x y) => (SRW (ZeroExt8to32 x) (ISEL [0] y (MOVDconst [-1]) (CMPU (ZeroExt8to64 y) (MOVDconst [8])))) (Lsh8x8 x y) => (SLW x (ISEL [0] y (MOVDconst [-1]) (CMPU (ZeroExt8to64 y) (MOVDconst [8])))) -// Cleaning up shift ops when input is masked -(MaskIfNotCarry (ADDconstForCarry [c] (ANDconst [d] _))) && c < 0 && d > 0 && int64(c) + d < 0 => (MOVDconst [-1]) +// Cleaning up shift ops (ISEL [0] (ANDconst [d] y) (MOVDconst [-1]) (CMPU (ANDconst [d] y) (MOVDconst [c]))) && c >= d => (ANDconst [d] y) (ISEL [0] (ANDconst [d] y) (MOVDconst [-1]) (CMPUconst [c] (ANDconst [d] y))) && c >= d => (ANDconst [d] y) (ORN x (MOVDconst [-1])) => x -(ADDconstForCarry [c] (MOVDconst [d])) && c < 0 && (c < 0 || int64(c) + d >= 0) => (FlagCarryClear) -(ADDconstForCarry [c] (MOVDconst [d])) && c < 0 && c >= 0 && int64(c) + d < 0 => (FlagCarrySet) - -(MaskIfNotCarry (FlagCarrySet)) => (MOVDconst [0]) -(MaskIfNotCarry (FlagCarryClear)) => (MOVDconst [-1]) - (S(RAD|RD|LD) x (MOVDconst [c])) => (S(RAD|RD|LD)const [c&63 | (c>>6&1*63)] x) (S(RAW|RW|LW) x (MOVDconst [c])) => (S(RAW|RW|LW)const [c&31 | (c>>5&1*31)] x) @@ -306,8 +315,8 @@ (Ctz16 x) => (POPCNTW (MOVHZreg (ANDN <typ.Int16> (ADDconst <typ.Int16> [-1] x) x))) (Ctz8 x) => (POPCNTB (MOVBZreg (ANDN <typ.UInt8> (ADDconst <typ.UInt8> [-1] x) x))) -(BitLen64 x) => (SUB (MOVDconst [64]) (CNTLZD <typ.Int> x)) -(BitLen32 x) => (SUB (MOVDconst [32]) (CNTLZW <typ.Int> x)) +(BitLen64 x) => (SUBFCconst [64] (CNTLZD <typ.Int> x)) +(BitLen32 x) => (SUBFCconst [32] (CNTLZW <typ.Int> x)) (PopCount64 ...) => (POPCNTD ...) (PopCount32 x) => (POPCNTW (MOVWZreg x)) @@ -777,10 +786,19 @@ (ADDconst [c] (ADDconst [d] x)) && is32Bit(c+d) => (ADDconst [c+d] x) (ADDconst [0] x) => x (SUB x (MOVDconst [c])) && is32Bit(-c) => (ADDconst [-c] x) -// TODO deal with subtract-from-const (ADDconst [c] (MOVDaddr [d] {sym} x)) && is32Bit(c+int64(d)) => (MOVDaddr [int32(c+int64(d))] {sym} x) +// Subtract from (with carry, but ignored) constant. +// Note, these clobber the carry bit. +(SUB (MOVDconst [c]) x) && is32Bit(c) => (SUBFCconst [c] x) +(SUBFCconst [c] (NEG x)) => (ADDconst [c] x) +(SUBFCconst [c] (SUBFCconst [d] x)) && is32Bit(c-d) => (ADDconst [c-d] x) +(SUBFCconst [0] x) => (NEG x) +(ADDconst [c] (SUBFCconst [d] x)) && is32Bit(c+d) => (SUBFCconst [c+d] x) +(NEG (ADDconst [c] x)) && is32Bit(-c) => (SUBFCconst [-c] x) +(NEG (SUBFCconst [c] x)) && is32Bit(-c) => (ADDconst [-c] x) + // Use register moves instead of stores and loads to move int<=>float values // Common with math Float64bits, Float64frombits (MOVDload [off] {sym} ptr (FMOVDstore [off] {sym} ptr x _)) => (MFVSRD x) diff --git a/src/cmd/compile/internal/ssa/gen/PPC64Ops.go b/src/cmd/compile/internal/ssa/gen/PPC64Ops.go index 825d0faf34..44f6a74c63 100644 --- a/src/cmd/compile/internal/ssa/gen/PPC64Ops.go +++ b/src/cmd/compile/internal/ssa/gen/PPC64Ops.go @@ -175,6 +175,7 @@ func init() { {name: "FADD", argLength: 2, reg: fp21, asm: "FADD", commutative: true}, // arg0+arg1 {name: "FADDS", argLength: 2, reg: fp21, asm: "FADDS", commutative: true}, // arg0+arg1 {name: "SUB", argLength: 2, reg: gp21, asm: "SUB"}, // arg0-arg1 + {name: "SUBFCconst", argLength: 1, reg: gp11, asm: "SUBC", aux: "Int64"}, // auxInt - arg0 (with carry) {name: "FSUB", argLength: 2, reg: fp21, asm: "FSUB"}, // arg0-arg1 {name: "FSUBS", argLength: 2, reg: fp21, asm: "FSUBS"}, // arg0-arg1 @@ -206,9 +207,7 @@ func init() { {name: "ROTL", argLength: 2, reg: gp21, asm: "ROTL"}, // arg0 rotate left by arg1 mod 64 {name: "ROTLW", argLength: 2, reg: gp21, asm: "ROTLW"}, // uint32(arg0) rotate left by arg1 mod 32 - {name: "LoweredAdd64Carry", argLength: 3, reg: gp32, resultNotInArgs: true}, // arg0 + arg1 + carry, returns (sum, carry) - {name: "ADDconstForCarry", argLength: 1, reg: regInfo{inputs: []regMask{gp | sp | sb}, clobbers: tmp}, aux: "Int16", asm: "ADDC", typ: "Flags"}, // _, carry := arg0 + auxint - {name: "MaskIfNotCarry", argLength: 1, reg: crgp, asm: "ADDME", typ: "Int64"}, // carry - 1 (if carry then 0 else -1) + {name: "LoweredAdd64Carry", argLength: 3, reg: gp32, resultNotInArgs: true}, // arg0 + arg1 + carry, returns (sum, carry) {name: "SRADconst", argLength: 1, reg: gp11, asm: "SRAD", aux: "Int64"}, // signed arg0 >> auxInt, 0 <= auxInt < 64, 64 bit width {name: "SRAWconst", argLength: 1, reg: gp11, asm: "SRAW", aux: "Int64"}, // signed arg0 >> auxInt, 0 <= auxInt < 32, 32 bit width @@ -674,11 +673,9 @@ func init() { // These ops are for temporary use by rewrite rules. They // cannot appear in the generated assembly. - {name: "FlagEQ"}, // equal - {name: "FlagLT"}, // signed < or unsigned < - {name: "FlagGT"}, // signed > or unsigned > - {name: "FlagCarrySet"}, // carry flag set - {name: "FlagCarryClear"}, // carry flag clear + {name: "FlagEQ"}, // equal + {name: "FlagLT"}, // signed < or unsigned < + {name: "FlagGT"}, // signed > or unsigned > } blocks := []blockData{ diff --git a/src/cmd/compile/internal/ssa/gen/S390X.rules b/src/cmd/compile/internal/ssa/gen/S390X.rules index 5e4c436ca1..e564f638d3 100644 --- a/src/cmd/compile/internal/ssa/gen/S390X.rules +++ b/src/cmd/compile/internal/ssa/gen/S390X.rules @@ -498,27 +498,19 @@ // Remove zero extensions after zero extending load. // Note: take care that if x is spilled it is restored correctly. (MOV(B|H|W)Zreg x:(MOVBZload _ _)) && (!x.Type.IsSigned() || x.Type.Size() > 1) => x -(MOV(B|H|W)Zreg x:(MOVBZloadidx _ _ _)) && (!x.Type.IsSigned() || x.Type.Size() > 1) => x (MOV(H|W)Zreg x:(MOVHZload _ _)) && (!x.Type.IsSigned() || x.Type.Size() > 2) => x -(MOV(H|W)Zreg x:(MOVHZloadidx _ _ _)) && (!x.Type.IsSigned() || x.Type.Size() > 2) => x (MOVWZreg x:(MOVWZload _ _)) && (!x.Type.IsSigned() || x.Type.Size() > 4) => x -(MOVWZreg x:(MOVWZloadidx _ _ _)) && (!x.Type.IsSigned() || x.Type.Size() > 4) => x // Remove sign extensions after sign extending load. // Note: take care that if x is spilled it is restored correctly. (MOV(B|H|W)reg x:(MOVBload _ _)) && (x.Type.IsSigned() || x.Type.Size() == 8) => x -(MOV(B|H|W)reg x:(MOVBloadidx _ _ _)) && (x.Type.IsSigned() || x.Type.Size() == 8) => x (MOV(H|W)reg x:(MOVHload _ _)) && (x.Type.IsSigned() || x.Type.Size() == 8) => x -(MOV(H|W)reg x:(MOVHloadidx _ _ _)) && (x.Type.IsSigned() || x.Type.Size() == 8) => x (MOVWreg x:(MOVWload _ _)) && (x.Type.IsSigned() || x.Type.Size() == 8) => x -(MOVWreg x:(MOVWloadidx _ _ _)) && (x.Type.IsSigned() || x.Type.Size() == 8) => x // Remove sign extensions after zero extending load. // These type checks are probably unnecessary but do them anyway just in case. (MOV(H|W)reg x:(MOVBZload _ _)) && (!x.Type.IsSigned() || x.Type.Size() > 1) => x -(MOV(H|W)reg x:(MOVBZloadidx _ _ _)) && (!x.Type.IsSigned() || x.Type.Size() > 1) => x (MOVWreg x:(MOVHZload _ _)) && (!x.Type.IsSigned() || x.Type.Size() > 2) => x -(MOVWreg x:(MOVHZloadidx _ _ _)) && (!x.Type.IsSigned() || x.Type.Size() > 2) => x // Fold sign and zero extensions into loads. // @@ -538,14 +530,6 @@ && x.Uses == 1 && clobber(x) => @x.Block (MOV(B|H|W)load <t> [o] {s} p mem) -(MOV(B|H|W)Zreg <t> x:(MOV(B|H|W)loadidx [o] {s} p i mem)) - && x.Uses == 1 - && clobber(x) - => @x.Block (MOV(B|H|W)Zloadidx <t> [o] {s} p i mem) -(MOV(B|H|W)reg <t> x:(MOV(B|H|W)Zloadidx [o] {s} p i mem)) - && x.Uses == 1 - && clobber(x) - => @x.Block (MOV(B|H|W)loadidx <t> [o] {s} p i mem) // Remove zero extensions after argument load. (MOVBZreg x:(Arg <t>)) && !t.IsSigned() && t.Size() == 1 => x @@ -641,41 +625,37 @@ (BRC {c} (CMPWUconst x [y]) yes no) && y == int32( int8(y)) && (c == s390x.Equal || c == s390x.LessOrGreater) => (CIJ {c} x [ int8(y)] yes no) // Fold constants into instructions. -(ADD x (MOVDconst [c])) && is32Bit(c) -> (ADDconst [c] x) -(ADDW x (MOVDconst [c])) -> (ADDWconst [int64(int32(c))] x) +(ADD x (MOVDconst [c])) && is32Bit(c) => (ADDconst [int32(c)] x) +(ADDW x (MOVDconst [c])) => (ADDWconst [int32(c)] x) -(SUB x (MOVDconst [c])) && is32Bit(c) -> (SUBconst x [c]) -(SUB (MOVDconst [c]) x) && is32Bit(c) -> (NEG (SUBconst <v.Type> x [c])) -(SUBW x (MOVDconst [c])) -> (SUBWconst x [int64(int32(c))]) -(SUBW (MOVDconst [c]) x) -> (NEGW (SUBWconst <v.Type> x [int64(int32(c))])) +(SUB x (MOVDconst [c])) && is32Bit(c) => (SUBconst x [int32(c)]) +(SUB (MOVDconst [c]) x) && is32Bit(c) => (NEG (SUBconst <v.Type> x [int32(c)])) +(SUBW x (MOVDconst [c])) => (SUBWconst x [int32(c)]) +(SUBW (MOVDconst [c]) x) => (NEGW (SUBWconst <v.Type> x [int32(c)])) -(MULLD x (MOVDconst [c])) && is32Bit(c) -> (MULLDconst [c] x) -(MULLW x (MOVDconst [c])) -> (MULLWconst [int64(int32(c))] x) +(MULLD x (MOVDconst [c])) && is32Bit(c) => (MULLDconst [int32(c)] x) +(MULLW x (MOVDconst [c])) => (MULLWconst [int32(c)] x) // NILF instructions leave the high 32 bits unchanged which is // equivalent to the leftmost 32 bits being set. // TODO(mundaym): modify the assembler to accept 64-bit values // and use isU32Bit(^c). (AND x (MOVDconst [c])) && is32Bit(c) && c < 0 => (ANDconst [c] x) -(AND x (MOVDconst [c])) && is32Bit(c) && c >= 0 -> (MOVWZreg (ANDWconst <typ.UInt32> [int64(int32(c))] x)) -(ANDW x (MOVDconst [c])) -> (ANDWconst [int64(int32(c))] x) +(AND x (MOVDconst [c])) && is32Bit(c) && c >= 0 => (MOVWZreg (ANDWconst <typ.UInt32> [int32(c)] x)) +(ANDW x (MOVDconst [c])) => (ANDWconst [int32(c)] x) -(ANDWconst [c] (ANDWconst [d] x)) => (ANDWconst [c & d] x) -(ANDconst [c] (ANDconst [d] x)) => (ANDconst [c & d] x) +((AND|ANDW)const [c] ((AND|ANDW)const [d] x)) => ((AND|ANDW)const [c&d] x) -(OR x (MOVDconst [c])) && isU32Bit(c) => (ORconst [c] x) -(ORW x (MOVDconst [c])) -> (ORWconst [int64(int32(c))] x) - -(XOR x (MOVDconst [c])) && isU32Bit(c) => (XORconst [c] x) -(XORW x (MOVDconst [c])) -> (XORWconst [int64(int32(c))] x) +((OR|XOR) x (MOVDconst [c])) && isU32Bit(c) => ((OR|XOR)const [c] x) +((OR|XOR)W x (MOVDconst [c])) => ((OR|XOR)Wconst [int32(c)] x) // Constant shifts. (S(LD|RD|RAD|LW|RW|RAW) x (MOVDconst [c])) - -> (S(LD|RD|RAD|LW|RW|RAW)const x [c&63]) + => (S(LD|RD|RAD|LW|RW|RAW)const x [int8(c&63)]) // Shifts only use the rightmost 6 bits of the shift value. (S(LD|RD|RAD|LW|RW|RAW) x (AND (MOVDconst [c]) y)) - -> (S(LD|RD|RAD|LW|RW|RAW) x (ANDWconst <typ.UInt32> [c&63] y)) + => (S(LD|RD|RAD|LW|RW|RAW) x (ANDWconst <typ.UInt32> [int32(c&63)] y)) (S(LD|RD|RAD|LW|RW|RAW) x (ANDWconst [c] y)) && c&63 == 63 => (S(LD|RD|RAD|LW|RW|RAW) x y) (SLD x (MOV(W|H|B|WZ|HZ|BZ)reg y)) => (SLD x y) @@ -686,8 +666,8 @@ (SRAW x (MOV(W|H|B|WZ|HZ|BZ)reg y)) => (SRAW x y) // Constant rotate generation -(RLL x (MOVDconst [c])) -> (RLLconst x [c&31]) -(RLLG x (MOVDconst [c])) -> (RLLGconst x [c&63]) +(RLL x (MOVDconst [c])) => (RLLconst x [int8(c&31)]) +(RLLG x (MOVDconst [c])) => (RLLGconst x [int8(c&63)]) (ADD (SLDconst x [c]) (SRDconst x [d])) && d == 64-c => (RLLGconst [c] x) ( OR (SLDconst x [c]) (SRDconst x [d])) && d == 64-c => (RLLGconst [c] x) @@ -697,14 +677,17 @@ ( ORW (SLWconst x [c]) (SRWconst x [d])) && d == 32-c => (RLLconst [c] x) (XORW (SLWconst x [c]) (SRWconst x [d])) && d == 32-c => (RLLconst [c] x) -(CMP x (MOVDconst [c])) && is32Bit(c) -> (CMPconst x [c]) -(CMP (MOVDconst [c]) x) && is32Bit(c) -> (InvertFlags (CMPconst x [c])) -(CMPW x (MOVDconst [c])) -> (CMPWconst x [int64(int32(c))]) -(CMPW (MOVDconst [c]) x) -> (InvertFlags (CMPWconst x [int64(int32(c))])) -(CMPU x (MOVDconst [c])) && isU32Bit(c) -> (CMPUconst x [int64(int32(c))]) -(CMPU (MOVDconst [c]) x) && isU32Bit(c) -> (InvertFlags (CMPUconst x [int64(int32(c))])) -(CMPWU x (MOVDconst [c])) -> (CMPWUconst x [int64(int32(c))]) -(CMPWU (MOVDconst [c]) x) -> (InvertFlags (CMPWUconst x [int64(int32(c))])) +// Signed 64-bit comparison with immediate. +(CMP x (MOVDconst [c])) && is32Bit(c) => (CMPconst x [int32(c)]) +(CMP (MOVDconst [c]) x) && is32Bit(c) => (InvertFlags (CMPconst x [int32(c)])) + +// Unsigned 64-bit comparison with immediate. +(CMPU x (MOVDconst [c])) && isU32Bit(c) => (CMPUconst x [int32(c)]) +(CMPU (MOVDconst [c]) x) && isU32Bit(c) => (InvertFlags (CMPUconst x [int32(c)])) + +// Signed and unsigned 32-bit comparison with immediate. +(CMP(W|WU) x (MOVDconst [c])) => (CMP(W|WU)const x [int32(c)]) +(CMP(W|WU) (MOVDconst [c]) x) => (InvertFlags (CMP(W|WU)const x [int32(c)])) // Canonicalize the order of arguments to comparisons - helps with CSE. ((CMP|CMPW|CMPU|CMPWU) x y) && x.ID > y.ID => (InvertFlags ((CMP|CMPW|CMPU|CMPWU) y x)) @@ -752,14 +735,14 @@ (SL(D|W)const <t> x [int8(log32(-c+(-c&^(-c-1))))])) // Fold ADD into MOVDaddr. Odd offsets from SB shouldn't be folded (LARL can't handle them). -(ADDconst [c] (MOVDaddr [d] {s} x:(SB))) && ((c+d)&1 == 0) && is32Bit(c+d) -> (MOVDaddr [c+d] {s} x) -(ADDconst [c] (MOVDaddr [d] {s} x)) && x.Op != OpSB && is20Bit(c+d) -> (MOVDaddr [c+d] {s} x) -(ADD idx (MOVDaddr [c] {s} ptr)) && ptr.Op != OpSB && idx.Op != OpSB => (MOVDaddridx [c] {s} ptr idx) +(ADDconst [c] (MOVDaddr [d] {s} x:(SB))) && ((c+d)&1 == 0) && is32Bit(int64(c)+int64(d)) => (MOVDaddr [c+d] {s} x) +(ADDconst [c] (MOVDaddr [d] {s} x)) && x.Op != OpSB && is20Bit(int64(c)+int64(d)) => (MOVDaddr [c+d] {s} x) +(ADD idx (MOVDaddr [c] {s} ptr)) && ptr.Op != OpSB => (MOVDaddridx [c] {s} ptr idx) // fold ADDconst into MOVDaddrx -(ADDconst [c] (MOVDaddridx [d] {s} x y)) && is20Bit(c+d) -> (MOVDaddridx [c+d] {s} x y) -(MOVDaddridx [c] {s} (ADDconst [d] x) y) && is20Bit(c+d) && x.Op != OpSB -> (MOVDaddridx [c+d] {s} x y) -(MOVDaddridx [c] {s} x (ADDconst [d] y)) && is20Bit(c+d) && y.Op != OpSB -> (MOVDaddridx [c+d] {s} x y) +(ADDconst [c] (MOVDaddridx [d] {s} x y)) && is20Bit(int64(c)+int64(d)) => (MOVDaddridx [c+d] {s} x y) +(MOVDaddridx [c] {s} (ADDconst [d] x) y) && is20Bit(int64(c)+int64(d)) => (MOVDaddridx [c+d] {s} x y) +(MOVDaddridx [c] {s} x (ADDconst [d] y)) && is20Bit(int64(c)+int64(d)) => (MOVDaddridx [c+d] {s} x y) // reverse ordering of compare instruction (LOCGR {c} x y (InvertFlags cmp)) => (LOCGR {c.ReverseComparison()} x y cmp) @@ -799,11 +782,11 @@ // detect copysign (OR (SLDconst [63] (SRDconst [63] (LGDR x))) (LGDR (LPDFR <t> y))) => (LGDR (CPSDR <t> y x)) -(OR (SLDconst [63] (SRDconst [63] (LGDR x))) (MOVDconst [c])) && c & -1<<63 == 0 -> (LGDR (CPSDR <x.Type> (FMOVDconst <x.Type> [c]) x)) +(OR (SLDconst [63] (SRDconst [63] (LGDR x))) (MOVDconst [c])) && c & -1<<63 == 0 => (LGDR (CPSDR <x.Type> (FMOVDconst <x.Type> [math.Float64frombits(uint64(c))]) x)) (OR (AND (MOVDconst [-1<<63]) (LGDR x)) (LGDR (LPDFR <t> y))) => (LGDR (CPSDR <t> y x)) -(OR (AND (MOVDconst [-1<<63]) (LGDR x)) (MOVDconst [c])) && c & -1<<63 == 0 -> (LGDR (CPSDR <x.Type> (FMOVDconst <x.Type> [c]) x)) -(CPSDR y (FMOVDconst [c])) && c & -1<<63 == 0 -> (LPDFR y) -(CPSDR y (FMOVDconst [c])) && c & -1<<63 != 0 -> (LNDFR y) +(OR (AND (MOVDconst [-1<<63]) (LGDR x)) (MOVDconst [c])) && c & -1<<63 == 0 => (LGDR (CPSDR <x.Type> (FMOVDconst <x.Type> [math.Float64frombits(uint64(c))]) x)) +(CPSDR y (FMOVDconst [c])) && !math.Signbit(c) => (LPDFR y) +(CPSDR y (FMOVDconst [c])) && math.Signbit(c) => (LNDFR y) // absorb negations into set/clear sign bit (FNEG (LPDFR x)) => (LNDFR x) @@ -832,216 +815,131 @@ // the ADDconst get eliminated, we still have to compute the ADDconst and we now // have potentially two live values (ptr and (ADDconst [off] ptr)) instead of one. // Nevertheless, let's do it! -(MOVDload [off1] {sym} (ADDconst [off2] ptr) mem) && is20Bit(off1+off2) -> (MOVDload [off1+off2] {sym} ptr mem) -(MOVWload [off1] {sym} (ADDconst [off2] ptr) mem) && is20Bit(off1+off2) -> (MOVWload [off1+off2] {sym} ptr mem) -(MOVHload [off1] {sym} (ADDconst [off2] ptr) mem) && is20Bit(off1+off2) -> (MOVHload [off1+off2] {sym} ptr mem) -(MOVBload [off1] {sym} (ADDconst [off2] ptr) mem) && is20Bit(off1+off2) -> (MOVBload [off1+off2] {sym} ptr mem) -(MOVWZload [off1] {sym} (ADDconst [off2] ptr) mem) && is20Bit(off1+off2) -> (MOVWZload [off1+off2] {sym} ptr mem) -(MOVHZload [off1] {sym} (ADDconst [off2] ptr) mem) && is20Bit(off1+off2) -> (MOVHZload [off1+off2] {sym} ptr mem) -(MOVBZload [off1] {sym} (ADDconst [off2] ptr) mem) && is20Bit(off1+off2) -> (MOVBZload [off1+off2] {sym} ptr mem) -(FMOVSload [off1] {sym} (ADDconst [off2] ptr) mem) && is20Bit(off1+off2) -> (FMOVSload [off1+off2] {sym} ptr mem) -(FMOVDload [off1] {sym} (ADDconst [off2] ptr) mem) && is20Bit(off1+off2) -> (FMOVDload [off1+off2] {sym} ptr mem) - -(MOVDstore [off1] {sym} (ADDconst [off2] ptr) val mem) && is20Bit(off1+off2) -> (MOVDstore [off1+off2] {sym} ptr val mem) -(MOVWstore [off1] {sym} (ADDconst [off2] ptr) val mem) && is20Bit(off1+off2) -> (MOVWstore [off1+off2] {sym} ptr val mem) -(MOVHstore [off1] {sym} (ADDconst [off2] ptr) val mem) && is20Bit(off1+off2) -> (MOVHstore [off1+off2] {sym} ptr val mem) -(MOVBstore [off1] {sym} (ADDconst [off2] ptr) val mem) && is20Bit(off1+off2) -> (MOVBstore [off1+off2] {sym} ptr val mem) -(FMOVSstore [off1] {sym} (ADDconst [off2] ptr) val mem) && is20Bit(off1+off2) -> (FMOVSstore [off1+off2] {sym} ptr val mem) -(FMOVDstore [off1] {sym} (ADDconst [off2] ptr) val mem) && is20Bit(off1+off2) -> (FMOVDstore [off1+off2] {sym} ptr val mem) - -(ADDload [off1] {sym} x (ADDconst [off2] ptr) mem) && ptr.Op != OpSB && is20Bit(off1+off2) -> (ADDload [off1+off2] {sym} x ptr mem) -(ADDWload [off1] {sym} x (ADDconst [off2] ptr) mem) && ptr.Op != OpSB && is20Bit(off1+off2) -> (ADDWload [off1+off2] {sym} x ptr mem) -(MULLDload [off1] {sym} x (ADDconst [off2] ptr) mem) && ptr.Op != OpSB && is20Bit(off1+off2) -> (MULLDload [off1+off2] {sym} x ptr mem) -(MULLWload [off1] {sym} x (ADDconst [off2] ptr) mem) && ptr.Op != OpSB && is20Bit(off1+off2) -> (MULLWload [off1+off2] {sym} x ptr mem) -(SUBload [off1] {sym} x (ADDconst [off2] ptr) mem) && ptr.Op != OpSB && is20Bit(off1+off2) -> (SUBload [off1+off2] {sym} x ptr mem) -(SUBWload [off1] {sym} x (ADDconst [off2] ptr) mem) && ptr.Op != OpSB && is20Bit(off1+off2) -> (SUBWload [off1+off2] {sym} x ptr mem) - -(ANDload [off1] {sym} x (ADDconst [off2] ptr) mem) && ptr.Op != OpSB && is20Bit(off1+off2) -> (ANDload [off1+off2] {sym} x ptr mem) -(ANDWload [off1] {sym} x (ADDconst [off2] ptr) mem) && ptr.Op != OpSB && is20Bit(off1+off2) -> (ANDWload [off1+off2] {sym} x ptr mem) -(ORload [off1] {sym} x (ADDconst [off2] ptr) mem) && ptr.Op != OpSB && is20Bit(off1+off2) -> (ORload [off1+off2] {sym} x ptr mem) -(ORWload [off1] {sym} x (ADDconst [off2] ptr) mem) && ptr.Op != OpSB && is20Bit(off1+off2) -> (ORWload [off1+off2] {sym} x ptr mem) -(XORload [off1] {sym} x (ADDconst [off2] ptr) mem) && ptr.Op != OpSB && is20Bit(off1+off2) -> (XORload [off1+off2] {sym} x ptr mem) -(XORWload [off1] {sym} x (ADDconst [off2] ptr) mem) && ptr.Op != OpSB && is20Bit(off1+off2) -> (XORWload [off1+off2] {sym} x ptr mem) +(MOVDload [off1] {sym} (ADDconst [off2] ptr) mem) && is20Bit(int64(off1)+int64(off2)) => (MOVDload [off1+off2] {sym} ptr mem) +(MOVWload [off1] {sym} (ADDconst [off2] ptr) mem) && is20Bit(int64(off1)+int64(off2)) => (MOVWload [off1+off2] {sym} ptr mem) +(MOVHload [off1] {sym} (ADDconst [off2] ptr) mem) && is20Bit(int64(off1)+int64(off2)) => (MOVHload [off1+off2] {sym} ptr mem) +(MOVBload [off1] {sym} (ADDconst [off2] ptr) mem) && is20Bit(int64(off1)+int64(off2)) => (MOVBload [off1+off2] {sym} ptr mem) +(MOVWZload [off1] {sym} (ADDconst [off2] ptr) mem) && is20Bit(int64(off1)+int64(off2)) => (MOVWZload [off1+off2] {sym} ptr mem) +(MOVHZload [off1] {sym} (ADDconst [off2] ptr) mem) && is20Bit(int64(off1)+int64(off2)) => (MOVHZload [off1+off2] {sym} ptr mem) +(MOVBZload [off1] {sym} (ADDconst [off2] ptr) mem) && is20Bit(int64(off1)+int64(off2)) => (MOVBZload [off1+off2] {sym} ptr mem) +(FMOVSload [off1] {sym} (ADDconst [off2] ptr) mem) && is20Bit(int64(off1)+int64(off2)) => (FMOVSload [off1+off2] {sym} ptr mem) +(FMOVDload [off1] {sym} (ADDconst [off2] ptr) mem) && is20Bit(int64(off1)+int64(off2)) => (FMOVDload [off1+off2] {sym} ptr mem) + +(MOVDstore [off1] {sym} (ADDconst [off2] ptr) val mem) && is20Bit(int64(off1)+int64(off2)) => (MOVDstore [off1+off2] {sym} ptr val mem) +(MOVWstore [off1] {sym} (ADDconst [off2] ptr) val mem) && is20Bit(int64(off1)+int64(off2)) => (MOVWstore [off1+off2] {sym} ptr val mem) +(MOVHstore [off1] {sym} (ADDconst [off2] ptr) val mem) && is20Bit(int64(off1)+int64(off2)) => (MOVHstore [off1+off2] {sym} ptr val mem) +(MOVBstore [off1] {sym} (ADDconst [off2] ptr) val mem) && is20Bit(int64(off1)+int64(off2)) => (MOVBstore [off1+off2] {sym} ptr val mem) +(FMOVSstore [off1] {sym} (ADDconst [off2] ptr) val mem) && is20Bit(int64(off1)+int64(off2)) => (FMOVSstore [off1+off2] {sym} ptr val mem) +(FMOVDstore [off1] {sym} (ADDconst [off2] ptr) val mem) && is20Bit(int64(off1)+int64(off2)) => (FMOVDstore [off1+off2] {sym} ptr val mem) + +(ADDload [off1] {sym} x (ADDconst [off2] ptr) mem) && ptr.Op != OpSB && is20Bit(int64(off1)+int64(off2)) => (ADDload [off1+off2] {sym} x ptr mem) +(ADDWload [off1] {sym} x (ADDconst [off2] ptr) mem) && ptr.Op != OpSB && is20Bit(int64(off1)+int64(off2)) => (ADDWload [off1+off2] {sym} x ptr mem) +(MULLDload [off1] {sym} x (ADDconst [off2] ptr) mem) && ptr.Op != OpSB && is20Bit(int64(off1)+int64(off2)) => (MULLDload [off1+off2] {sym} x ptr mem) +(MULLWload [off1] {sym} x (ADDconst [off2] ptr) mem) && ptr.Op != OpSB && is20Bit(int64(off1)+int64(off2)) => (MULLWload [off1+off2] {sym} x ptr mem) +(SUBload [off1] {sym} x (ADDconst [off2] ptr) mem) && ptr.Op != OpSB && is20Bit(int64(off1)+int64(off2)) => (SUBload [off1+off2] {sym} x ptr mem) +(SUBWload [off1] {sym} x (ADDconst [off2] ptr) mem) && ptr.Op != OpSB && is20Bit(int64(off1)+int64(off2)) => (SUBWload [off1+off2] {sym} x ptr mem) + +(ANDload [off1] {sym} x (ADDconst [off2] ptr) mem) && ptr.Op != OpSB && is20Bit(int64(off1)+int64(off2)) => (ANDload [off1+off2] {sym} x ptr mem) +(ANDWload [off1] {sym} x (ADDconst [off2] ptr) mem) && ptr.Op != OpSB && is20Bit(int64(off1)+int64(off2)) => (ANDWload [off1+off2] {sym} x ptr mem) +(ORload [off1] {sym} x (ADDconst [off2] ptr) mem) && ptr.Op != OpSB && is20Bit(int64(off1)+int64(off2)) => (ORload [off1+off2] {sym} x ptr mem) +(ORWload [off1] {sym} x (ADDconst [off2] ptr) mem) && ptr.Op != OpSB && is20Bit(int64(off1)+int64(off2)) => (ORWload [off1+off2] {sym} x ptr mem) +(XORload [off1] {sym} x (ADDconst [off2] ptr) mem) && ptr.Op != OpSB && is20Bit(int64(off1)+int64(off2)) => (XORload [off1+off2] {sym} x ptr mem) +(XORWload [off1] {sym} x (ADDconst [off2] ptr) mem) && ptr.Op != OpSB && is20Bit(int64(off1)+int64(off2)) => (XORWload [off1+off2] {sym} x ptr mem) // Fold constants into stores. -(MOVDstore [off] {sym} ptr (MOVDconst [c]) mem) && is16Bit(c) && isU12Bit(off) && ptr.Op != OpSB -> - (MOVDstoreconst [makeValAndOff(c,off)] {sym} ptr mem) -(MOVWstore [off] {sym} ptr (MOVDconst [c]) mem) && is16Bit(c) && isU12Bit(off) && ptr.Op != OpSB -> - (MOVWstoreconst [makeValAndOff(int64(int32(c)),off)] {sym} ptr mem) -(MOVHstore [off] {sym} ptr (MOVDconst [c]) mem) && isU12Bit(off) && ptr.Op != OpSB -> - (MOVHstoreconst [makeValAndOff(int64(int16(c)),off)] {sym} ptr mem) -(MOVBstore [off] {sym} ptr (MOVDconst [c]) mem) && is20Bit(off) && ptr.Op != OpSB -> - (MOVBstoreconst [makeValAndOff(int64(int8(c)),off)] {sym} ptr mem) +(MOVDstore [off] {sym} ptr (MOVDconst [c]) mem) && is16Bit(c) && isU12Bit(int64(off)) && ptr.Op != OpSB => + (MOVDstoreconst [makeValAndOff32(int32(c),off)] {sym} ptr mem) +(MOVWstore [off] {sym} ptr (MOVDconst [c]) mem) && is16Bit(c) && isU12Bit(int64(off)) && ptr.Op != OpSB => + (MOVWstoreconst [makeValAndOff32(int32(c),off)] {sym} ptr mem) +(MOVHstore [off] {sym} ptr (MOVDconst [c]) mem) && isU12Bit(int64(off)) && ptr.Op != OpSB => + (MOVHstoreconst [makeValAndOff32(int32(int16(c)),off)] {sym} ptr mem) +(MOVBstore [off] {sym} ptr (MOVDconst [c]) mem) && is20Bit(int64(off)) && ptr.Op != OpSB => + (MOVBstoreconst [makeValAndOff32(int32(int8(c)),off)] {sym} ptr mem) // Fold address offsets into constant stores. -(MOVDstoreconst [sc] {s} (ADDconst [off] ptr) mem) && isU12Bit(ValAndOff(sc).Off()+off) -> - (MOVDstoreconst [ValAndOff(sc).add(off)] {s} ptr mem) -(MOVWstoreconst [sc] {s} (ADDconst [off] ptr) mem) && isU12Bit(ValAndOff(sc).Off()+off) -> - (MOVWstoreconst [ValAndOff(sc).add(off)] {s} ptr mem) -(MOVHstoreconst [sc] {s} (ADDconst [off] ptr) mem) && isU12Bit(ValAndOff(sc).Off()+off) -> - (MOVHstoreconst [ValAndOff(sc).add(off)] {s} ptr mem) -(MOVBstoreconst [sc] {s} (ADDconst [off] ptr) mem) && is20Bit(ValAndOff(sc).Off()+off) -> - (MOVBstoreconst [ValAndOff(sc).add(off)] {s} ptr mem) +(MOVDstoreconst [sc] {s} (ADDconst [off] ptr) mem) && isU12Bit(sc.Off()+int64(off)) => + (MOVDstoreconst [sc.addOffset32(off)] {s} ptr mem) +(MOVWstoreconst [sc] {s} (ADDconst [off] ptr) mem) && isU12Bit(sc.Off()+int64(off)) => + (MOVWstoreconst [sc.addOffset32(off)] {s} ptr mem) +(MOVHstoreconst [sc] {s} (ADDconst [off] ptr) mem) && isU12Bit(sc.Off()+int64(off)) => + (MOVHstoreconst [sc.addOffset32(off)] {s} ptr mem) +(MOVBstoreconst [sc] {s} (ADDconst [off] ptr) mem) && is20Bit(sc.Off()+int64(off)) => + (MOVBstoreconst [sc.addOffset32(off)] {s} ptr mem) // Merge address calculations into loads and stores. // Offsets from SB must not be merged into unaligned memory accesses because // loads/stores using PC-relative addressing directly must be aligned to the // size of the target. -(MOVDload [off1] {sym1} (MOVDaddr <t> [off2] {sym2} base) mem) && is32Bit(off1+off2) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%8 == 0 && (off1+off2)%8 == 0)) -> - (MOVDload [off1+off2] {mergeSym(sym1,sym2)} base mem) -(MOVWZload [off1] {sym1} (MOVDaddr <t> [off2] {sym2} base) mem) && is32Bit(off1+off2) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%4 == 0 && (off1+off2)%4 == 0)) -> - (MOVWZload [off1+off2] {mergeSym(sym1,sym2)} base mem) -(MOVHZload [off1] {sym1} (MOVDaddr <t> [off2] {sym2} base) mem) && is32Bit(off1+off2) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%2 == 0 && (off1+off2)%2 == 0)) -> - (MOVHZload [off1+off2] {mergeSym(sym1,sym2)} base mem) -(MOVBZload [off1] {sym1} (MOVDaddr [off2] {sym2} base) mem) && is32Bit(off1+off2) && canMergeSym(sym1, sym2) -> - (MOVBZload [off1+off2] {mergeSym(sym1,sym2)} base mem) -(FMOVSload [off1] {sym1} (MOVDaddr [off2] {sym2} base) mem) && is32Bit(off1+off2) && canMergeSym(sym1, sym2) -> - (FMOVSload [off1+off2] {mergeSym(sym1,sym2)} base mem) -(FMOVDload [off1] {sym1} (MOVDaddr [off2] {sym2} base) mem) && is32Bit(off1+off2) && canMergeSym(sym1, sym2) -> - (FMOVDload [off1+off2] {mergeSym(sym1,sym2)} base mem) - -(MOVWload [off1] {sym1} (MOVDaddr <t> [off2] {sym2} base) mem) && is32Bit(off1+off2) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%4 == 0 && (off1+off2)%4 == 0)) -> - (MOVWload [off1+off2] {mergeSym(sym1,sym2)} base mem) -(MOVHload [off1] {sym1} (MOVDaddr <t> [off2] {sym2} base) mem) && is32Bit(off1+off2) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%2 == 0 && (off1+off2)%2 == 0)) -> - (MOVHload [off1+off2] {mergeSym(sym1,sym2)} base mem) -(MOVBload [off1] {sym1} (MOVDaddr [off2] {sym2} base) mem) && is32Bit(off1+off2) && canMergeSym(sym1, sym2) -> - (MOVBload [off1+off2] {mergeSym(sym1,sym2)} base mem) - -(MOVDstore [off1] {sym1} (MOVDaddr <t> [off2] {sym2} base) val mem) && is32Bit(off1+off2) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%8 == 0 && (off1+off2)%8 == 0)) -> - (MOVDstore [off1+off2] {mergeSym(sym1,sym2)} base val mem) -(MOVWstore [off1] {sym1} (MOVDaddr <t> [off2] {sym2} base) val mem) && is32Bit(off1+off2) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%4 == 0 && (off1+off2)%4 == 0)) -> - (MOVWstore [off1+off2] {mergeSym(sym1,sym2)} base val mem) -(MOVHstore [off1] {sym1} (MOVDaddr <t> [off2] {sym2} base) val mem) && is32Bit(off1+off2) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%2 == 0 && (off1+off2)%2 == 0)) -> - (MOVHstore [off1+off2] {mergeSym(sym1,sym2)} base val mem) -(MOVBstore [off1] {sym1} (MOVDaddr [off2] {sym2} base) val mem) && is32Bit(off1+off2) && canMergeSym(sym1, sym2) -> - (MOVBstore [off1+off2] {mergeSym(sym1,sym2)} base val mem) -(FMOVSstore [off1] {sym1} (MOVDaddr [off2] {sym2} base) val mem) && is32Bit(off1+off2) && canMergeSym(sym1, sym2) -> - (FMOVSstore [off1+off2] {mergeSym(sym1,sym2)} base val mem) -(FMOVDstore [off1] {sym1} (MOVDaddr [off2] {sym2} base) val mem) && is32Bit(off1+off2) && canMergeSym(sym1, sym2) -> - (FMOVDstore [off1+off2] {mergeSym(sym1,sym2)} base val mem) - -(ADDload [o1] {s1} x (MOVDaddr [o2] {s2} ptr) mem) && ptr.Op != OpSB && is20Bit(o1+o2) && canMergeSym(s1, s2) -> (ADDload [o1+o2] {mergeSym(s1, s2)} x ptr mem) -(ADDWload [o1] {s1} x (MOVDaddr [o2] {s2} ptr) mem) && ptr.Op != OpSB && is20Bit(o1+o2) && canMergeSym(s1, s2) -> (ADDWload [o1+o2] {mergeSym(s1, s2)} x ptr mem) -(MULLDload [o1] {s1} x (MOVDaddr [o2] {s2} ptr) mem) && ptr.Op != OpSB && is20Bit(o1+o2) && canMergeSym(s1, s2) -> (MULLDload [o1+o2] {mergeSym(s1, s2)} x ptr mem) -(MULLWload [o1] {s1} x (MOVDaddr [o2] {s2} ptr) mem) && ptr.Op != OpSB && is20Bit(o1+o2) && canMergeSym(s1, s2) -> (MULLWload [o1+o2] {mergeSym(s1, s2)} x ptr mem) -(SUBload [o1] {s1} x (MOVDaddr [o2] {s2} ptr) mem) && ptr.Op != OpSB && is20Bit(o1+o2) && canMergeSym(s1, s2) -> (SUBload [o1+o2] {mergeSym(s1, s2)} x ptr mem) -(SUBWload [o1] {s1} x (MOVDaddr [o2] {s2} ptr) mem) && ptr.Op != OpSB && is20Bit(o1+o2) && canMergeSym(s1, s2) -> (SUBWload [o1+o2] {mergeSym(s1, s2)} x ptr mem) - -(ANDload [o1] {s1} x (MOVDaddr [o2] {s2} ptr) mem) && ptr.Op != OpSB && is20Bit(o1+o2) && canMergeSym(s1, s2) -> (ANDload [o1+o2] {mergeSym(s1, s2)} x ptr mem) -(ANDWload [o1] {s1} x (MOVDaddr [o2] {s2} ptr) mem) && ptr.Op != OpSB && is20Bit(o1+o2) && canMergeSym(s1, s2) -> (ANDWload [o1+o2] {mergeSym(s1, s2)} x ptr mem) -(ORload [o1] {s1} x (MOVDaddr [o2] {s2} ptr) mem) && ptr.Op != OpSB && is20Bit(o1+o2) && canMergeSym(s1, s2) -> (ORload [o1+o2] {mergeSym(s1, s2)} x ptr mem) -(ORWload [o1] {s1} x (MOVDaddr [o2] {s2} ptr) mem) && ptr.Op != OpSB && is20Bit(o1+o2) && canMergeSym(s1, s2) -> (ORWload [o1+o2] {mergeSym(s1, s2)} x ptr mem) -(XORload [o1] {s1} x (MOVDaddr [o2] {s2} ptr) mem) && ptr.Op != OpSB && is20Bit(o1+o2) && canMergeSym(s1, s2) -> (XORload [o1+o2] {mergeSym(s1, s2)} x ptr mem) -(XORWload [o1] {s1} x (MOVDaddr [o2] {s2} ptr) mem) && ptr.Op != OpSB && is20Bit(o1+o2) && canMergeSym(s1, s2) -> (XORWload [o1+o2] {mergeSym(s1, s2)} x ptr mem) +(MOVDload [off1] {sym1} (MOVDaddr <t> [off2] {sym2} base) mem) && is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%8 == 0 && (off1+off2)%8 == 0)) => + (MOVDload [off1+off2] {mergeSymTyped(sym1,sym2)} base mem) +(MOVWZload [off1] {sym1} (MOVDaddr <t> [off2] {sym2} base) mem) && is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%4 == 0 && (off1+off2)%4 == 0)) => + (MOVWZload [off1+off2] {mergeSymTyped(sym1,sym2)} base mem) +(MOVHZload [off1] {sym1} (MOVDaddr <t> [off2] {sym2} base) mem) && is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%2 == 0 && (off1+off2)%2 == 0)) => + (MOVHZload [off1+off2] {mergeSymTyped(sym1,sym2)} base mem) +(MOVBZload [off1] {sym1} (MOVDaddr [off2] {sym2} base) mem) && is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) => + (MOVBZload [off1+off2] {mergeSymTyped(sym1,sym2)} base mem) +(FMOVSload [off1] {sym1} (MOVDaddr [off2] {sym2} base) mem) && is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) => + (FMOVSload [off1+off2] {mergeSymTyped(sym1,sym2)} base mem) +(FMOVDload [off1] {sym1} (MOVDaddr [off2] {sym2} base) mem) && is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) => + (FMOVDload [off1+off2] {mergeSymTyped(sym1,sym2)} base mem) + +(MOVWload [off1] {sym1} (MOVDaddr <t> [off2] {sym2} base) mem) && is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%4 == 0 && (off1+off2)%4 == 0)) => + (MOVWload [off1+off2] {mergeSymTyped(sym1,sym2)} base mem) +(MOVHload [off1] {sym1} (MOVDaddr <t> [off2] {sym2} base) mem) && is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%2 == 0 && (off1+off2)%2 == 0)) => + (MOVHload [off1+off2] {mergeSymTyped(sym1,sym2)} base mem) +(MOVBload [off1] {sym1} (MOVDaddr [off2] {sym2} base) mem) && is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) => + (MOVBload [off1+off2] {mergeSymTyped(sym1,sym2)} base mem) + +(MOVDstore [off1] {sym1} (MOVDaddr <t> [off2] {sym2} base) val mem) && is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%8 == 0 && (off1+off2)%8 == 0)) => + (MOVDstore [off1+off2] {mergeSymTyped(sym1,sym2)} base val mem) +(MOVWstore [off1] {sym1} (MOVDaddr <t> [off2] {sym2} base) val mem) && is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%4 == 0 && (off1+off2)%4 == 0)) => + (MOVWstore [off1+off2] {mergeSymTyped(sym1,sym2)} base val mem) +(MOVHstore [off1] {sym1} (MOVDaddr <t> [off2] {sym2} base) val mem) && is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%2 == 0 && (off1+off2)%2 == 0)) => + (MOVHstore [off1+off2] {mergeSymTyped(sym1,sym2)} base val mem) +(MOVBstore [off1] {sym1} (MOVDaddr [off2] {sym2} base) val mem) && is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) => + (MOVBstore [off1+off2] {mergeSymTyped(sym1,sym2)} base val mem) +(FMOVSstore [off1] {sym1} (MOVDaddr [off2] {sym2} base) val mem) && is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) => + (FMOVSstore [off1+off2] {mergeSymTyped(sym1,sym2)} base val mem) +(FMOVDstore [off1] {sym1} (MOVDaddr [off2] {sym2} base) val mem) && is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) => + (FMOVDstore [off1+off2] {mergeSymTyped(sym1,sym2)} base val mem) + +(ADDload [o1] {s1} x (MOVDaddr [o2] {s2} ptr) mem) && ptr.Op != OpSB && is20Bit(int64(o1)+int64(o2)) && canMergeSym(s1, s2) => (ADDload [o1+o2] {mergeSymTyped(s1, s2)} x ptr mem) +(ADDWload [o1] {s1} x (MOVDaddr [o2] {s2} ptr) mem) && ptr.Op != OpSB && is20Bit(int64(o1)+int64(o2)) && canMergeSym(s1, s2) => (ADDWload [o1+o2] {mergeSymTyped(s1, s2)} x ptr mem) +(MULLDload [o1] {s1} x (MOVDaddr [o2] {s2} ptr) mem) && ptr.Op != OpSB && is20Bit(int64(o1)+int64(o2)) && canMergeSym(s1, s2) => (MULLDload [o1+o2] {mergeSymTyped(s1, s2)} x ptr mem) +(MULLWload [o1] {s1} x (MOVDaddr [o2] {s2} ptr) mem) && ptr.Op != OpSB && is20Bit(int64(o1)+int64(o2)) && canMergeSym(s1, s2) => (MULLWload [o1+o2] {mergeSymTyped(s1, s2)} x ptr mem) +(SUBload [o1] {s1} x (MOVDaddr [o2] {s2} ptr) mem) && ptr.Op != OpSB && is20Bit(int64(o1)+int64(o2)) && canMergeSym(s1, s2) => (SUBload [o1+o2] {mergeSymTyped(s1, s2)} x ptr mem) +(SUBWload [o1] {s1} x (MOVDaddr [o2] {s2} ptr) mem) && ptr.Op != OpSB && is20Bit(int64(o1)+int64(o2)) && canMergeSym(s1, s2) => (SUBWload [o1+o2] {mergeSymTyped(s1, s2)} x ptr mem) + +(ANDload [o1] {s1} x (MOVDaddr [o2] {s2} ptr) mem) && ptr.Op != OpSB && is20Bit(int64(o1)+int64(o2)) && canMergeSym(s1, s2) => (ANDload [o1+o2] {mergeSymTyped(s1, s2)} x ptr mem) +(ANDWload [o1] {s1} x (MOVDaddr [o2] {s2} ptr) mem) && ptr.Op != OpSB && is20Bit(int64(o1)+int64(o2)) && canMergeSym(s1, s2) => (ANDWload [o1+o2] {mergeSymTyped(s1, s2)} x ptr mem) +(ORload [o1] {s1} x (MOVDaddr [o2] {s2} ptr) mem) && ptr.Op != OpSB && is20Bit(int64(o1)+int64(o2)) && canMergeSym(s1, s2) => (ORload [o1+o2] {mergeSymTyped(s1, s2)} x ptr mem) +(ORWload [o1] {s1} x (MOVDaddr [o2] {s2} ptr) mem) && ptr.Op != OpSB && is20Bit(int64(o1)+int64(o2)) && canMergeSym(s1, s2) => (ORWload [o1+o2] {mergeSymTyped(s1, s2)} x ptr mem) +(XORload [o1] {s1} x (MOVDaddr [o2] {s2} ptr) mem) && ptr.Op != OpSB && is20Bit(int64(o1)+int64(o2)) && canMergeSym(s1, s2) => (XORload [o1+o2] {mergeSymTyped(s1, s2)} x ptr mem) +(XORWload [o1] {s1} x (MOVDaddr [o2] {s2} ptr) mem) && ptr.Op != OpSB && is20Bit(int64(o1)+int64(o2)) && canMergeSym(s1, s2) => (XORWload [o1+o2] {mergeSymTyped(s1, s2)} x ptr mem) // Cannot store constant to SB directly (no 'move relative long immediate' instructions). -(MOVDstoreconst [sc] {sym1} (MOVDaddr [off] {sym2} ptr) mem) && ptr.Op != OpSB && canMergeSym(sym1, sym2) && ValAndOff(sc).canAdd(off) -> - (MOVDstoreconst [ValAndOff(sc).add(off)] {mergeSym(sym1, sym2)} ptr mem) -(MOVWstoreconst [sc] {sym1} (MOVDaddr [off] {sym2} ptr) mem) && ptr.Op != OpSB && canMergeSym(sym1, sym2) && ValAndOff(sc).canAdd(off) -> - (MOVWstoreconst [ValAndOff(sc).add(off)] {mergeSym(sym1, sym2)} ptr mem) -(MOVHstoreconst [sc] {sym1} (MOVDaddr [off] {sym2} ptr) mem) && ptr.Op != OpSB && canMergeSym(sym1, sym2) && ValAndOff(sc).canAdd(off) -> - (MOVHstoreconst [ValAndOff(sc).add(off)] {mergeSym(sym1, sym2)} ptr mem) -(MOVBstoreconst [sc] {sym1} (MOVDaddr [off] {sym2} ptr) mem) && ptr.Op != OpSB && canMergeSym(sym1, sym2) && ValAndOff(sc).canAdd(off) -> - (MOVBstoreconst [ValAndOff(sc).add(off)] {mergeSym(sym1, sym2)} ptr mem) - -// generating indexed loads and stores -(MOVBZload [off1] {sym1} (MOVDaddridx [off2] {sym2} ptr idx) mem) && is32Bit(off1+off2) && canMergeSym(sym1, sym2) -> - (MOVBZloadidx [off1+off2] {mergeSym(sym1,sym2)} ptr idx mem) -(MOVBload [off1] {sym1} (MOVDaddridx [off2] {sym2} ptr idx) mem) && is32Bit(off1+off2) && canMergeSym(sym1, sym2) -> - (MOVBloadidx [off1+off2] {mergeSym(sym1,sym2)} ptr idx mem) -(MOVHZload [off1] {sym1} (MOVDaddridx [off2] {sym2} ptr idx) mem) && is32Bit(off1+off2) && canMergeSym(sym1, sym2) -> - (MOVHZloadidx [off1+off2] {mergeSym(sym1,sym2)} ptr idx mem) -(MOVHload [off1] {sym1} (MOVDaddridx [off2] {sym2} ptr idx) mem) && is32Bit(off1+off2) && canMergeSym(sym1, sym2) -> - (MOVHloadidx [off1+off2] {mergeSym(sym1,sym2)} ptr idx mem) -(MOVWZload [off1] {sym1} (MOVDaddridx [off2] {sym2} ptr idx) mem) && is32Bit(off1+off2) && canMergeSym(sym1, sym2) -> - (MOVWZloadidx [off1+off2] {mergeSym(sym1,sym2)} ptr idx mem) -(MOVWload [off1] {sym1} (MOVDaddridx [off2] {sym2} ptr idx) mem) && is32Bit(off1+off2) && canMergeSym(sym1, sym2) -> - (MOVWloadidx [off1+off2] {mergeSym(sym1,sym2)} ptr idx mem) -(MOVDload [off1] {sym1} (MOVDaddridx [off2] {sym2} ptr idx) mem) && is32Bit(off1+off2) && canMergeSym(sym1, sym2) -> - (MOVDloadidx [off1+off2] {mergeSym(sym1,sym2)} ptr idx mem) -(FMOVSload [off1] {sym1} (MOVDaddridx [off2] {sym2} ptr idx) mem) && is32Bit(off1+off2) && canMergeSym(sym1, sym2) -> - (FMOVSloadidx [off1+off2] {mergeSym(sym1,sym2)} ptr idx mem) -(FMOVDload [off1] {sym1} (MOVDaddridx [off2] {sym2} ptr idx) mem) && is32Bit(off1+off2) && canMergeSym(sym1, sym2) -> - (FMOVDloadidx [off1+off2] {mergeSym(sym1,sym2)} ptr idx mem) - -(MOVBstore [off1] {sym1} (MOVDaddridx [off2] {sym2} ptr idx) val mem) && is32Bit(off1+off2) && canMergeSym(sym1, sym2) -> - (MOVBstoreidx [off1+off2] {mergeSym(sym1,sym2)} ptr idx val mem) -(MOVHstore [off1] {sym1} (MOVDaddridx [off2] {sym2} ptr idx) val mem) && is32Bit(off1+off2) && canMergeSym(sym1, sym2) -> - (MOVHstoreidx [off1+off2] {mergeSym(sym1,sym2)} ptr idx val mem) -(MOVWstore [off1] {sym1} (MOVDaddridx [off2] {sym2} ptr idx) val mem) && is32Bit(off1+off2) && canMergeSym(sym1, sym2) -> - (MOVWstoreidx [off1+off2] {mergeSym(sym1,sym2)} ptr idx val mem) -(MOVDstore [off1] {sym1} (MOVDaddridx [off2] {sym2} ptr idx) val mem) && is32Bit(off1+off2) && canMergeSym(sym1, sym2) -> - (MOVDstoreidx [off1+off2] {mergeSym(sym1,sym2)} ptr idx val mem) -(FMOVSstore [off1] {sym1} (MOVDaddridx [off2] {sym2} ptr idx) val mem) && is32Bit(off1+off2) && canMergeSym(sym1, sym2) -> - (FMOVSstoreidx [off1+off2] {mergeSym(sym1,sym2)} ptr idx val mem) -(FMOVDstore [off1] {sym1} (MOVDaddridx [off2] {sym2} ptr idx) val mem) && is32Bit(off1+off2) && canMergeSym(sym1, sym2) -> - (FMOVDstoreidx [off1+off2] {mergeSym(sym1,sym2)} ptr idx val mem) - -(MOVBZload [off] {sym} (ADD ptr idx) mem) && ptr.Op != OpSB => (MOVBZloadidx [off] {sym} ptr idx mem) -(MOVBload [off] {sym} (ADD ptr idx) mem) && ptr.Op != OpSB => (MOVBloadidx [off] {sym} ptr idx mem) -(MOVHZload [off] {sym} (ADD ptr idx) mem) && ptr.Op != OpSB => (MOVHZloadidx [off] {sym} ptr idx mem) -(MOVHload [off] {sym} (ADD ptr idx) mem) && ptr.Op != OpSB => (MOVHloadidx [off] {sym} ptr idx mem) -(MOVWZload [off] {sym} (ADD ptr idx) mem) && ptr.Op != OpSB => (MOVWZloadidx [off] {sym} ptr idx mem) -(MOVWload [off] {sym} (ADD ptr idx) mem) && ptr.Op != OpSB => (MOVWloadidx [off] {sym} ptr idx mem) -(MOVDload [off] {sym} (ADD ptr idx) mem) && ptr.Op != OpSB => (MOVDloadidx [off] {sym} ptr idx mem) -(FMOVSload [off] {sym} (ADD ptr idx) mem) && ptr.Op != OpSB => (FMOVSloadidx [off] {sym} ptr idx mem) -(FMOVDload [off] {sym} (ADD ptr idx) mem) && ptr.Op != OpSB => (FMOVDloadidx [off] {sym} ptr idx mem) - -(MOVBstore [off] {sym} (ADD ptr idx) val mem) && ptr.Op != OpSB => (MOVBstoreidx [off] {sym} ptr idx val mem) -(MOVHstore [off] {sym} (ADD ptr idx) val mem) && ptr.Op != OpSB => (MOVHstoreidx [off] {sym} ptr idx val mem) -(MOVWstore [off] {sym} (ADD ptr idx) val mem) && ptr.Op != OpSB => (MOVWstoreidx [off] {sym} ptr idx val mem) -(MOVDstore [off] {sym} (ADD ptr idx) val mem) && ptr.Op != OpSB => (MOVDstoreidx [off] {sym} ptr idx val mem) -(FMOVSstore [off] {sym} (ADD ptr idx) val mem) && ptr.Op != OpSB => (FMOVSstoreidx [off] {sym} ptr idx val mem) -(FMOVDstore [off] {sym} (ADD ptr idx) val mem) && ptr.Op != OpSB => (FMOVDstoreidx [off] {sym} ptr idx val mem) - -// combine ADD into indexed loads and stores -(MOVBZloadidx [c] {sym} (ADDconst [d] ptr) idx mem) && is20Bit(c+d) -> (MOVBZloadidx [c+d] {sym} ptr idx mem) -(MOVBloadidx [c] {sym} (ADDconst [d] ptr) idx mem) && is20Bit(c+d) -> (MOVBloadidx [c+d] {sym} ptr idx mem) -(MOVHZloadidx [c] {sym} (ADDconst [d] ptr) idx mem) && is20Bit(c+d) -> (MOVHZloadidx [c+d] {sym} ptr idx mem) -(MOVHloadidx [c] {sym} (ADDconst [d] ptr) idx mem) && is20Bit(c+d) -> (MOVHloadidx [c+d] {sym} ptr idx mem) -(MOVWZloadidx [c] {sym} (ADDconst [d] ptr) idx mem) && is20Bit(c+d) -> (MOVWZloadidx [c+d] {sym} ptr idx mem) -(MOVWloadidx [c] {sym} (ADDconst [d] ptr) idx mem) && is20Bit(c+d) -> (MOVWloadidx [c+d] {sym} ptr idx mem) -(MOVDloadidx [c] {sym} (ADDconst [d] ptr) idx mem) && is20Bit(c+d) -> (MOVDloadidx [c+d] {sym} ptr idx mem) -(FMOVSloadidx [c] {sym} (ADDconst [d] ptr) idx mem) && is20Bit(c+d) -> (FMOVSloadidx [c+d] {sym} ptr idx mem) -(FMOVDloadidx [c] {sym} (ADDconst [d] ptr) idx mem) && is20Bit(c+d) -> (FMOVDloadidx [c+d] {sym} ptr idx mem) - -(MOVBstoreidx [c] {sym} (ADDconst [d] ptr) idx val mem) && is20Bit(c+d) -> (MOVBstoreidx [c+d] {sym} ptr idx val mem) -(MOVHstoreidx [c] {sym} (ADDconst [d] ptr) idx val mem) && is20Bit(c+d) -> (MOVHstoreidx [c+d] {sym} ptr idx val mem) -(MOVWstoreidx [c] {sym} (ADDconst [d] ptr) idx val mem) && is20Bit(c+d) -> (MOVWstoreidx [c+d] {sym} ptr idx val mem) -(MOVDstoreidx [c] {sym} (ADDconst [d] ptr) idx val mem) && is20Bit(c+d) -> (MOVDstoreidx [c+d] {sym} ptr idx val mem) -(FMOVSstoreidx [c] {sym} (ADDconst [d] ptr) idx val mem) && is20Bit(c+d) -> (FMOVSstoreidx [c+d] {sym} ptr idx val mem) -(FMOVDstoreidx [c] {sym} (ADDconst [d] ptr) idx val mem) && is20Bit(c+d) -> (FMOVDstoreidx [c+d] {sym} ptr idx val mem) - -(MOVBZloadidx [c] {sym} ptr (ADDconst [d] idx) mem) && is20Bit(c+d) -> (MOVBZloadidx [c+d] {sym} ptr idx mem) -(MOVBloadidx [c] {sym} ptr (ADDconst [d] idx) mem) && is20Bit(c+d) -> (MOVBloadidx [c+d] {sym} ptr idx mem) -(MOVHZloadidx [c] {sym} ptr (ADDconst [d] idx) mem) && is20Bit(c+d) -> (MOVHZloadidx [c+d] {sym} ptr idx mem) -(MOVHloadidx [c] {sym} ptr (ADDconst [d] idx) mem) && is20Bit(c+d) -> (MOVHloadidx [c+d] {sym} ptr idx mem) -(MOVWZloadidx [c] {sym} ptr (ADDconst [d] idx) mem) && is20Bit(c+d) -> (MOVWZloadidx [c+d] {sym} ptr idx mem) -(MOVWloadidx [c] {sym} ptr (ADDconst [d] idx) mem) && is20Bit(c+d) -> (MOVWloadidx [c+d] {sym} ptr idx mem) -(MOVDloadidx [c] {sym} ptr (ADDconst [d] idx) mem) && is20Bit(c+d) -> (MOVDloadidx [c+d] {sym} ptr idx mem) -(FMOVSloadidx [c] {sym} ptr (ADDconst [d] idx) mem) && is20Bit(c+d) -> (FMOVSloadidx [c+d] {sym} ptr idx mem) -(FMOVDloadidx [c] {sym} ptr (ADDconst [d] idx) mem) && is20Bit(c+d) -> (FMOVDloadidx [c+d] {sym} ptr idx mem) - -(MOVBstoreidx [c] {sym} ptr (ADDconst [d] idx) val mem) && is20Bit(c+d) -> (MOVBstoreidx [c+d] {sym} ptr idx val mem) -(MOVHstoreidx [c] {sym} ptr (ADDconst [d] idx) val mem) && is20Bit(c+d) -> (MOVHstoreidx [c+d] {sym} ptr idx val mem) -(MOVWstoreidx [c] {sym} ptr (ADDconst [d] idx) val mem) && is20Bit(c+d) -> (MOVWstoreidx [c+d] {sym} ptr idx val mem) -(MOVDstoreidx [c] {sym} ptr (ADDconst [d] idx) val mem) && is20Bit(c+d) -> (MOVDstoreidx [c+d] {sym} ptr idx val mem) -(FMOVSstoreidx [c] {sym} ptr (ADDconst [d] idx) val mem) && is20Bit(c+d) -> (FMOVSstoreidx [c+d] {sym} ptr idx val mem) -(FMOVDstoreidx [c] {sym} ptr (ADDconst [d] idx) val mem) && is20Bit(c+d) -> (FMOVDstoreidx [c+d] {sym} ptr idx val mem) +(MOVDstoreconst [sc] {sym1} (MOVDaddr [off] {sym2} ptr) mem) && ptr.Op != OpSB && canMergeSym(sym1, sym2) && sc.canAdd32(off) => + (MOVDstoreconst [sc.addOffset32(off)] {mergeSymTyped(sym1, sym2)} ptr mem) +(MOVWstoreconst [sc] {sym1} (MOVDaddr [off] {sym2} ptr) mem) && ptr.Op != OpSB && canMergeSym(sym1, sym2) && sc.canAdd32(off) => + (MOVWstoreconst [sc.addOffset32(off)] {mergeSymTyped(sym1, sym2)} ptr mem) +(MOVHstoreconst [sc] {sym1} (MOVDaddr [off] {sym2} ptr) mem) && ptr.Op != OpSB && canMergeSym(sym1, sym2) && sc.canAdd32(off) => + (MOVHstoreconst [sc.addOffset32(off)] {mergeSymTyped(sym1, sym2)} ptr mem) +(MOVBstoreconst [sc] {sym1} (MOVDaddr [off] {sym2} ptr) mem) && ptr.Op != OpSB && canMergeSym(sym1, sym2) && sc.canAdd32(off) => + (MOVBstoreconst [sc.addOffset32(off)] {mergeSymTyped(sym1, sym2)} ptr mem) // MOVDaddr into MOVDaddridx -(MOVDaddridx [off1] {sym1} (MOVDaddr [off2] {sym2} x) y) && is32Bit(off1+off2) && canMergeSym(sym1, sym2) && x.Op != OpSB -> - (MOVDaddridx [off1+off2] {mergeSym(sym1,sym2)} x y) -(MOVDaddridx [off1] {sym1} x (MOVDaddr [off2] {sym2} y)) && is32Bit(off1+off2) && canMergeSym(sym1, sym2) && y.Op != OpSB -> - (MOVDaddridx [off1+off2] {mergeSym(sym1,sym2)} x y) +(MOVDaddridx [off1] {sym1} (MOVDaddr [off2] {sym2} x) y) && is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) && x.Op != OpSB => + (MOVDaddridx [off1+off2] {mergeSymTyped(sym1,sym2)} x y) +(MOVDaddridx [off1] {sym1} x (MOVDaddr [off2] {sym2} y)) && is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) && y.Op != OpSB => + (MOVDaddridx [off1+off2] {mergeSymTyped(sym1,sym2)} x y) // Absorb InvertFlags into branches. (BRC {c} (InvertFlags cmp) yes no) => (BRC {c.ReverseComparison()} cmp yes no) // Constant comparisons. -(CMPconst (MOVDconst [x]) [y]) && x==y -> (FlagEQ) -(CMPconst (MOVDconst [x]) [y]) && x<y -> (FlagLT) -(CMPconst (MOVDconst [x]) [y]) && x>y -> (FlagGT) +(CMPconst (MOVDconst [x]) [y]) && x==int64(y) => (FlagEQ) +(CMPconst (MOVDconst [x]) [y]) && x<int64(y) => (FlagLT) +(CMPconst (MOVDconst [x]) [y]) && x>int64(y) => (FlagGT) (CMPUconst (MOVDconst [x]) [y]) && uint64(x)==uint64(y) => (FlagEQ) (CMPUconst (MOVDconst [x]) [y]) && uint64(x)<uint64(y) => (FlagLT) (CMPUconst (MOVDconst [x]) [y]) && uint64(x)>uint64(y) => (FlagGT) @@ -1158,31 +1056,31 @@ // Convert constant subtracts to constant adds. (SUBconst [c] x) && c != -(1<<31) => (ADDconst [-c] x) -(SUBWconst [c] x) -> (ADDWconst [int64(int32(-c))] x) +(SUBWconst [c] x) => (ADDWconst [-int32(c)] x) // generic constant folding // TODO: more of this -(ADDconst [c] (MOVDconst [d])) -> (MOVDconst [c+d]) -(ADDWconst [c] (MOVDconst [d])) -> (MOVDconst [int64(int32(c+d))]) -(ADDconst [c] (ADDconst [d] x)) && is32Bit(c+d) -> (ADDconst [c+d] x) -(ADDWconst [c] (ADDWconst [d] x)) -> (ADDWconst [int64(int32(c+d))] x) -(SUBconst (MOVDconst [d]) [c]) -> (MOVDconst [d-c]) -(SUBconst (SUBconst x [d]) [c]) && is32Bit(-c-d) -> (ADDconst [-c-d] x) +(ADDconst [c] (MOVDconst [d])) => (MOVDconst [int64(c)+d]) +(ADDWconst [c] (MOVDconst [d])) => (MOVDconst [int64(c)+d]) +(ADDconst [c] (ADDconst [d] x)) && is32Bit(int64(c)+int64(d)) => (ADDconst [c+d] x) +(ADDWconst [c] (ADDWconst [d] x)) => (ADDWconst [int32(c+d)] x) +(SUBconst (MOVDconst [d]) [c]) => (MOVDconst [d-int64(c)]) +(SUBconst (SUBconst x [d]) [c]) && is32Bit(-int64(c)-int64(d)) => (ADDconst [-c-d] x) (SRADconst [c] (MOVDconst [d])) => (MOVDconst [d>>uint64(c)]) (SRAWconst [c] (MOVDconst [d])) => (MOVDconst [int64(int32(d))>>uint64(c)]) (NEG (MOVDconst [c])) => (MOVDconst [-c]) (NEGW (MOVDconst [c])) => (MOVDconst [int64(int32(-c))]) -(MULLDconst [c] (MOVDconst [d])) -> (MOVDconst [c*d]) -(MULLWconst [c] (MOVDconst [d])) -> (MOVDconst [int64(int32(c*d))]) +(MULLDconst [c] (MOVDconst [d])) => (MOVDconst [int64(c)*d]) +(MULLWconst [c] (MOVDconst [d])) => (MOVDconst [int64(c*int32(d))]) (AND (MOVDconst [c]) (MOVDconst [d])) => (MOVDconst [c&d]) (ANDconst [c] (MOVDconst [d])) => (MOVDconst [c&d]) -(ANDWconst [c] (MOVDconst [d])) -> (MOVDconst [c&d]) +(ANDWconst [c] (MOVDconst [d])) => (MOVDconst [int64(c)&d]) (OR (MOVDconst [c]) (MOVDconst [d])) => (MOVDconst [c|d]) (ORconst [c] (MOVDconst [d])) => (MOVDconst [c|d]) -(ORWconst [c] (MOVDconst [d])) -> (MOVDconst [c|d]) +(ORWconst [c] (MOVDconst [d])) => (MOVDconst [int64(c)|d]) (XOR (MOVDconst [c]) (MOVDconst [d])) => (MOVDconst [c^d]) (XORconst [c] (MOVDconst [d])) => (MOVDconst [c^d]) -(XORWconst [c] (MOVDconst [d])) -> (MOVDconst [c^d]) +(XORWconst [c] (MOVDconst [d])) => (MOVDconst [int64(c)^d]) (LoweredRound32F x:(FMOVSconst)) => x (LoweredRound64F x:(FMOVDconst)) => x @@ -1199,19 +1097,19 @@ (XOR x x) => (MOVDconst [0]) (XORW x x) => (MOVDconst [0]) (NEG (ADDconst [c] (NEG x))) && c != -(1<<31) => (ADDconst [-c] x) -(MOVBZreg (ANDWconst [m] x)) -> (MOVWZreg (ANDWconst <typ.UInt32> [int64( uint8(m))] x)) -(MOVHZreg (ANDWconst [m] x)) -> (MOVWZreg (ANDWconst <typ.UInt32> [int64(uint16(m))] x)) -(MOVBreg (ANDWconst [m] x)) && int8(m) >= 0 -> (MOVWZreg (ANDWconst <typ.UInt32> [int64( uint8(m))] x)) -(MOVHreg (ANDWconst [m] x)) && int16(m) >= 0 -> (MOVWZreg (ANDWconst <typ.UInt32> [int64(uint16(m))] x)) +(MOVBZreg (ANDWconst [m] x)) => (MOVWZreg (ANDWconst <typ.UInt32> [int32( uint8(m))] x)) +(MOVHZreg (ANDWconst [m] x)) => (MOVWZreg (ANDWconst <typ.UInt32> [int32(uint16(m))] x)) +(MOVBreg (ANDWconst [m] x)) && int8(m) >= 0 => (MOVWZreg (ANDWconst <typ.UInt32> [int32( uint8(m))] x)) +(MOVHreg (ANDWconst [m] x)) && int16(m) >= 0 => (MOVWZreg (ANDWconst <typ.UInt32> [int32(uint16(m))] x)) // carry flag generation // (only constant fold carry of zero) (Select1 (ADDCconst (MOVDconst [c]) [d])) - && uint64(c+d) >= uint64(c) && c+d == 0 - -> (FlagEQ) + && uint64(c+int64(d)) >= uint64(c) && c+int64(d) == 0 + => (FlagEQ) (Select1 (ADDCconst (MOVDconst [c]) [d])) - && uint64(c+d) >= uint64(c) && c+d != 0 - -> (FlagLT) + && uint64(c+int64(d)) >= uint64(c) && c+int64(d) != 0 + => (FlagLT) // borrow flag generation // (only constant fold borrow of zero) @@ -1225,8 +1123,8 @@ // add with carry (ADDE x y (FlagEQ)) => (ADDC x y) (ADDE x y (FlagLT)) => (ADDC x y) -(ADDC x (MOVDconst [c])) && is16Bit(c) -> (ADDCconst x [c]) -(Select0 (ADDCconst (MOVDconst [c]) [d])) -> (MOVDconst [c+d]) +(ADDC x (MOVDconst [c])) && is16Bit(c) => (ADDCconst x [int16(c)]) +(Select0 (ADDCconst (MOVDconst [c]) [d])) => (MOVDconst [c+int64(d)]) // subtract with borrow (SUBE x y (FlagGT)) => (SUBC x y) @@ -1256,14 +1154,12 @@ (C(G|LG)IJ {s390x.Greater} (NEG (Select0 (SUBE (MOVDconst [0]) (MOVDconst [0]) borrow))) [0]) => (BRC {s390x.Borrow} borrow) // fused multiply-add -(Select0 (F(ADD|SUB) (FMUL y z) x)) -> (FM(ADD|SUB) x y z) -(Select0 (F(ADDS|SUBS) (FMULS y z) x)) -> (FM(ADDS|SUBS) x y z) +(Select0 (F(ADD|SUB) (FMUL y z) x)) => (FM(ADD|SUB) x y z) +(Select0 (F(ADDS|SUBS) (FMULS y z) x)) => (FM(ADDS|SUBS) x y z) // Convert floating point comparisons against zero into 'load and test' instructions. -(FCMP x (FMOVDconst [c])) && auxTo64F(c) == 0 -> (LTDBR x) -(FCMPS x (FMOVSconst [c])) && auxTo32F(c) == 0 -> (LTEBR x) -(FCMP (FMOVDconst [c]) x) && auxTo64F(c) == 0 -> (InvertFlags (LTDBR <v.Type> x)) -(FCMPS (FMOVSconst [c]) x) && auxTo32F(c) == 0 -> (InvertFlags (LTEBR <v.Type> x)) +(F(CMP|CMPS) x (FMOV(D|S)const [0.0])) => (LT(D|E)BR x) +(F(CMP|CMPS) (FMOV(D|S)const [0.0]) x) => (InvertFlags (LT(D|E)BR <v.Type> x)) // FSUB, FSUBS, FADD, FADDS now produce a condition code representing the // comparison of the result with 0.0. If a compare with zero instruction @@ -1274,30 +1170,30 @@ // but moving the flag generating value to a different block seems to // increase the likelihood that the flags value will have to be regenerated // by flagalloc which is not what we want. -(LTDBR (Select0 x:(F(ADD|SUB) _ _))) && b == x.Block -> (Select1 x) -(LTEBR (Select0 x:(F(ADDS|SUBS) _ _))) && b == x.Block -> (Select1 x) +(LTDBR (Select0 x:(F(ADD|SUB) _ _))) && b == x.Block => (Select1 x) +(LTEBR (Select0 x:(F(ADDS|SUBS) _ _))) && b == x.Block => (Select1 x) // Fold memory operations into operations. // Exclude global data (SB) because these instructions cannot handle relative addresses. // TODO(mundaym): indexed versions of these? ((ADD|SUB|MULLD|AND|OR|XOR) <t> x g:(MOVDload [off] {sym} ptr mem)) && ptr.Op != OpSB - && is20Bit(off) + && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g) - -> ((ADD|SUB|MULLD|AND|OR|XOR)load <t> [off] {sym} x ptr mem) + => ((ADD|SUB|MULLD|AND|OR|XOR)load <t> [off] {sym} x ptr mem) ((ADD|SUB|MULL|AND|OR|XOR)W <t> x g:(MOVWload [off] {sym} ptr mem)) && ptr.Op != OpSB - && is20Bit(off) + && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g) - -> ((ADD|SUB|MULL|AND|OR|XOR)Wload <t> [off] {sym} x ptr mem) + => ((ADD|SUB|MULL|AND|OR|XOR)Wload <t> [off] {sym} x ptr mem) ((ADD|SUB|MULL|AND|OR|XOR)W <t> x g:(MOVWZload [off] {sym} ptr mem)) && ptr.Op != OpSB - && is20Bit(off) + && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g) - -> ((ADD|SUB|MULL|AND|OR|XOR)Wload <t> [off] {sym} x ptr mem) + => ((ADD|SUB|MULL|AND|OR|XOR)Wload <t> [off] {sym} x ptr mem) // Combine constant stores into larger (unaligned) stores. // Avoid SB because constant stores to relative offsets are @@ -1305,21 +1201,21 @@ (MOVBstoreconst [c] {s} p x:(MOVBstoreconst [a] {s} p mem)) && p.Op != OpSB && x.Uses == 1 - && ValAndOff(a).Off() + 1 == ValAndOff(c).Off() + && a.Off() + 1 == c.Off() && clobber(x) - -> (MOVHstoreconst [makeValAndOff(ValAndOff(c).Val()&0xff | ValAndOff(a).Val()<<8, ValAndOff(a).Off())] {s} p mem) + => (MOVHstoreconst [makeValAndOff32(c.Val32()&0xff | a.Val32()<<8, a.Off32())] {s} p mem) (MOVHstoreconst [c] {s} p x:(MOVHstoreconst [a] {s} p mem)) && p.Op != OpSB && x.Uses == 1 - && ValAndOff(a).Off() + 2 == ValAndOff(c).Off() + && a.Off() + 2 == c.Off() && clobber(x) - -> (MOVWstore [ValAndOff(a).Off()] {s} p (MOVDconst [int64(int32(ValAndOff(c).Val()&0xffff | ValAndOff(a).Val()<<16))]) mem) + => (MOVWstore [a.Off32()] {s} p (MOVDconst [int64(c.Val32()&0xffff | a.Val32()<<16)]) mem) (MOVWstoreconst [c] {s} p x:(MOVWstoreconst [a] {s} p mem)) && p.Op != OpSB && x.Uses == 1 - && ValAndOff(a).Off() + 4 == ValAndOff(c).Off() + && a.Off() + 4 == c.Off() && clobber(x) - -> (MOVDstore [ValAndOff(a).Off()] {s} p (MOVDconst [ValAndOff(c).Val()&0xffffffff | ValAndOff(a).Val()<<32]) mem) + => (MOVDstore [a.Off32()] {s} p (MOVDconst [c.Val()&0xffffffff | a.Val()<<32]) mem) // Combine stores into larger (unaligned) stores. // It doesn't work on global data (based on SB) because stores with relative addressing @@ -1328,93 +1224,52 @@ && p.Op != OpSB && x.Uses == 1 && clobber(x) - -> (MOVHstore [i-1] {s} p w mem) + => (MOVHstore [i-1] {s} p w mem) (MOVBstore [i] {s} p w0:(SRDconst [j] w) x:(MOVBstore [i-1] {s} p (SRDconst [j+8] w) mem)) && p.Op != OpSB && x.Uses == 1 && clobber(x) - -> (MOVHstore [i-1] {s} p w0 mem) + => (MOVHstore [i-1] {s} p w0 mem) (MOVBstore [i] {s} p w x:(MOVBstore [i-1] {s} p (SRWconst [8] w) mem)) && p.Op != OpSB && x.Uses == 1 && clobber(x) - -> (MOVHstore [i-1] {s} p w mem) + => (MOVHstore [i-1] {s} p w mem) (MOVBstore [i] {s} p w0:(SRWconst [j] w) x:(MOVBstore [i-1] {s} p (SRWconst [j+8] w) mem)) && p.Op != OpSB && x.Uses == 1 && clobber(x) - -> (MOVHstore [i-1] {s} p w0 mem) + => (MOVHstore [i-1] {s} p w0 mem) (MOVHstore [i] {s} p w x:(MOVHstore [i-2] {s} p (SRDconst [16] w) mem)) && p.Op != OpSB && x.Uses == 1 && clobber(x) - -> (MOVWstore [i-2] {s} p w mem) + => (MOVWstore [i-2] {s} p w mem) (MOVHstore [i] {s} p w0:(SRDconst [j] w) x:(MOVHstore [i-2] {s} p (SRDconst [j+16] w) mem)) && p.Op != OpSB && x.Uses == 1 && clobber(x) - -> (MOVWstore [i-2] {s} p w0 mem) + => (MOVWstore [i-2] {s} p w0 mem) (MOVHstore [i] {s} p w x:(MOVHstore [i-2] {s} p (SRWconst [16] w) mem)) && p.Op != OpSB && x.Uses == 1 && clobber(x) - -> (MOVWstore [i-2] {s} p w mem) + => (MOVWstore [i-2] {s} p w mem) (MOVHstore [i] {s} p w0:(SRWconst [j] w) x:(MOVHstore [i-2] {s} p (SRWconst [j+16] w) mem)) && p.Op != OpSB && x.Uses == 1 && clobber(x) - -> (MOVWstore [i-2] {s} p w0 mem) + => (MOVWstore [i-2] {s} p w0 mem) (MOVWstore [i] {s} p (SRDconst [32] w) x:(MOVWstore [i-4] {s} p w mem)) && p.Op != OpSB && x.Uses == 1 && clobber(x) - -> (MOVDstore [i-4] {s} p w mem) + => (MOVDstore [i-4] {s} p w mem) (MOVWstore [i] {s} p w0:(SRDconst [j] w) x:(MOVWstore [i-4] {s} p (SRDconst [j+32] w) mem)) && p.Op != OpSB && x.Uses == 1 && clobber(x) - -> (MOVDstore [i-4] {s} p w0 mem) - -(MOVBstoreidx [i] {s} p idx w x:(MOVBstoreidx [i-1] {s} p idx (SRDconst [8] w) mem)) - && x.Uses == 1 - && clobber(x) - -> (MOVHstoreidx [i-1] {s} p idx w mem) -(MOVBstoreidx [i] {s} p idx w0:(SRDconst [j] w) x:(MOVBstoreidx [i-1] {s} p idx (SRDconst [j+8] w) mem)) - && x.Uses == 1 - && clobber(x) - -> (MOVHstoreidx [i-1] {s} p idx w0 mem) -(MOVBstoreidx [i] {s} p idx w x:(MOVBstoreidx [i-1] {s} p idx (SRWconst [8] w) mem)) - && x.Uses == 1 - && clobber(x) - -> (MOVHstoreidx [i-1] {s} p idx w mem) -(MOVBstoreidx [i] {s} p idx w0:(SRWconst [j] w) x:(MOVBstoreidx [i-1] {s} p idx (SRWconst [j+8] w) mem)) - && x.Uses == 1 - && clobber(x) - -> (MOVHstoreidx [i-1] {s} p idx w0 mem) -(MOVHstoreidx [i] {s} p idx w x:(MOVHstoreidx [i-2] {s} p idx (SRDconst [16] w) mem)) - && x.Uses == 1 - && clobber(x) - -> (MOVWstoreidx [i-2] {s} p idx w mem) -(MOVHstoreidx [i] {s} p idx w0:(SRDconst [j] w) x:(MOVHstoreidx [i-2] {s} p idx (SRDconst [j+16] w) mem)) - && x.Uses == 1 - && clobber(x) - -> (MOVWstoreidx [i-2] {s} p idx w0 mem) -(MOVHstoreidx [i] {s} p idx w x:(MOVHstoreidx [i-2] {s} p idx (SRWconst [16] w) mem)) - && x.Uses == 1 - && clobber(x) - -> (MOVWstoreidx [i-2] {s} p idx w mem) -(MOVHstoreidx [i] {s} p idx w0:(SRWconst [j] w) x:(MOVHstoreidx [i-2] {s} p idx (SRWconst [j+16] w) mem)) - && x.Uses == 1 - && clobber(x) - -> (MOVWstoreidx [i-2] {s} p idx w0 mem) -(MOVWstoreidx [i] {s} p idx w x:(MOVWstoreidx [i-4] {s} p idx (SRDconst [32] w) mem)) - && x.Uses == 1 - && clobber(x) - -> (MOVDstoreidx [i-4] {s} p idx w mem) -(MOVWstoreidx [i] {s} p idx w0:(SRDconst [j] w) x:(MOVWstoreidx [i-4] {s} p idx (SRDconst [j+32] w) mem)) - && x.Uses == 1 - && clobber(x) - -> (MOVDstoreidx [i-4] {s} p idx w0 mem) + => (MOVDstore [i-4] {s} p w0 mem) // Combine stores into larger (unaligned) stores with the bytes reversed (little endian). // Store-with-bytes-reversed instructions do not support relative memory addresses, @@ -1423,87 +1278,46 @@ && p.Op != OpSB && x.Uses == 1 && clobber(x) - -> (MOVHBRstore [i-1] {s} p w mem) + => (MOVHBRstore [i-1] {s} p w mem) (MOVBstore [i] {s} p (SRDconst [j] w) x:(MOVBstore [i-1] {s} p w0:(SRDconst [j-8] w) mem)) && p.Op != OpSB && x.Uses == 1 && clobber(x) - -> (MOVHBRstore [i-1] {s} p w0 mem) + => (MOVHBRstore [i-1] {s} p w0 mem) (MOVBstore [i] {s} p (SRWconst [8] w) x:(MOVBstore [i-1] {s} p w mem)) && p.Op != OpSB && x.Uses == 1 && clobber(x) - -> (MOVHBRstore [i-1] {s} p w mem) + => (MOVHBRstore [i-1] {s} p w mem) (MOVBstore [i] {s} p (SRWconst [j] w) x:(MOVBstore [i-1] {s} p w0:(SRWconst [j-8] w) mem)) && p.Op != OpSB && x.Uses == 1 && clobber(x) - -> (MOVHBRstore [i-1] {s} p w0 mem) + => (MOVHBRstore [i-1] {s} p w0 mem) (MOVHBRstore [i] {s} p (SRDconst [16] w) x:(MOVHBRstore [i-2] {s} p w mem)) && x.Uses == 1 && clobber(x) - -> (MOVWBRstore [i-2] {s} p w mem) + => (MOVWBRstore [i-2] {s} p w mem) (MOVHBRstore [i] {s} p (SRDconst [j] w) x:(MOVHBRstore [i-2] {s} p w0:(SRDconst [j-16] w) mem)) && x.Uses == 1 && clobber(x) - -> (MOVWBRstore [i-2] {s} p w0 mem) + => (MOVWBRstore [i-2] {s} p w0 mem) (MOVHBRstore [i] {s} p (SRWconst [16] w) x:(MOVHBRstore [i-2] {s} p w mem)) && x.Uses == 1 && clobber(x) - -> (MOVWBRstore [i-2] {s} p w mem) + => (MOVWBRstore [i-2] {s} p w mem) (MOVHBRstore [i] {s} p (SRWconst [j] w) x:(MOVHBRstore [i-2] {s} p w0:(SRWconst [j-16] w) mem)) && x.Uses == 1 && clobber(x) - -> (MOVWBRstore [i-2] {s} p w0 mem) + => (MOVWBRstore [i-2] {s} p w0 mem) (MOVWBRstore [i] {s} p (SRDconst [32] w) x:(MOVWBRstore [i-4] {s} p w mem)) && x.Uses == 1 && clobber(x) - -> (MOVDBRstore [i-4] {s} p w mem) + => (MOVDBRstore [i-4] {s} p w mem) (MOVWBRstore [i] {s} p (SRDconst [j] w) x:(MOVWBRstore [i-4] {s} p w0:(SRDconst [j-32] w) mem)) && x.Uses == 1 && clobber(x) - -> (MOVDBRstore [i-4] {s} p w0 mem) - -(MOVBstoreidx [i] {s} p idx (SRDconst [8] w) x:(MOVBstoreidx [i-1] {s} p idx w mem)) - && x.Uses == 1 - && clobber(x) - -> (MOVHBRstoreidx [i-1] {s} p idx w mem) -(MOVBstoreidx [i] {s} p idx (SRDconst [j] w) x:(MOVBstoreidx [i-1] {s} p idx w0:(SRDconst [j-8] w) mem)) - && x.Uses == 1 - && clobber(x) - -> (MOVHBRstoreidx [i-1] {s} p idx w0 mem) -(MOVBstoreidx [i] {s} p idx (SRWconst [8] w) x:(MOVBstoreidx [i-1] {s} p idx w mem)) - && x.Uses == 1 - && clobber(x) - -> (MOVHBRstoreidx [i-1] {s} p idx w mem) -(MOVBstoreidx [i] {s} p idx (SRWconst [j] w) x:(MOVBstoreidx [i-1] {s} p idx w0:(SRWconst [j-8] w) mem)) - && x.Uses == 1 - && clobber(x) - -> (MOVHBRstoreidx [i-1] {s} p idx w0 mem) -(MOVHBRstoreidx [i] {s} p idx (SRDconst [16] w) x:(MOVHBRstoreidx [i-2] {s} p idx w mem)) - && x.Uses == 1 - && clobber(x) - -> (MOVWBRstoreidx [i-2] {s} p idx w mem) -(MOVHBRstoreidx [i] {s} p idx (SRDconst [j] w) x:(MOVHBRstoreidx [i-2] {s} p idx w0:(SRDconst [j-16] w) mem)) - && x.Uses == 1 - && clobber(x) - -> (MOVWBRstoreidx [i-2] {s} p idx w0 mem) -(MOVHBRstoreidx [i] {s} p idx (SRWconst [16] w) x:(MOVHBRstoreidx [i-2] {s} p idx w mem)) - && x.Uses == 1 - && clobber(x) - -> (MOVWBRstoreidx [i-2] {s} p idx w mem) -(MOVHBRstoreidx [i] {s} p idx (SRWconst [j] w) x:(MOVHBRstoreidx [i-2] {s} p idx w0:(SRWconst [j-16] w) mem)) - && x.Uses == 1 - && clobber(x) - -> (MOVWBRstoreidx [i-2] {s} p idx w0 mem) -(MOVWBRstoreidx [i] {s} p idx (SRDconst [32] w) x:(MOVWBRstoreidx [i-4] {s} p idx w mem)) - && x.Uses == 1 - && clobber(x) - -> (MOVDBRstoreidx [i-4] {s} p idx w mem) -(MOVWBRstoreidx [i] {s} p idx (SRDconst [j] w) x:(MOVWBRstoreidx [i-4] {s} p idx w0:(SRDconst [j-32] w) mem)) - && x.Uses == 1 - && clobber(x) - -> (MOVDBRstoreidx [i-4] {s} p idx w0 mem) + => (MOVDBRstore [i-4] {s} p w0 mem) // Combining byte loads into larger (unaligned) loads. @@ -1518,7 +1332,7 @@ && sh.Uses == 1 && mergePoint(b,x0,x1) != nil && clobber(x0, x1, sh) - -> @mergePoint(b,x0,x1) (MOVHZload [i0] {s} p mem) + => @mergePoint(b,x0,x1) (MOVHZload [i0] {s} p mem) (OR x1:(MOVBZload [i1] {s} p mem) sh:(SLDconst [8] x0:(MOVBZload [i0] {s} p mem))) @@ -1529,7 +1343,7 @@ && sh.Uses == 1 && mergePoint(b,x0,x1) != nil && clobber(x0, x1, sh) - -> @mergePoint(b,x0,x1) (MOVHZload [i0] {s} p mem) + => @mergePoint(b,x0,x1) (MOVHZload [i0] {s} p mem) (ORW x1:(MOVHZload [i1] {s} p mem) sh:(SLWconst [16] x0:(MOVHZload [i0] {s} p mem))) @@ -1540,7 +1354,7 @@ && sh.Uses == 1 && mergePoint(b,x0,x1) != nil && clobber(x0, x1, sh) - -> @mergePoint(b,x0,x1) (MOVWZload [i0] {s} p mem) + => @mergePoint(b,x0,x1) (MOVWZload [i0] {s} p mem) (OR x1:(MOVHZload [i1] {s} p mem) sh:(SLDconst [16] x0:(MOVHZload [i0] {s} p mem))) @@ -1551,7 +1365,7 @@ && sh.Uses == 1 && mergePoint(b,x0,x1) != nil && clobber(x0, x1, sh) - -> @mergePoint(b,x0,x1) (MOVWZload [i0] {s} p mem) + => @mergePoint(b,x0,x1) (MOVWZload [i0] {s} p mem) (OR x1:(MOVWZload [i1] {s} p mem) sh:(SLDconst [32] x0:(MOVWZload [i0] {s} p mem))) @@ -1562,7 +1376,7 @@ && sh.Uses == 1 && mergePoint(b,x0,x1) != nil && clobber(x0, x1, sh) - -> @mergePoint(b,x0,x1) (MOVDload [i0] {s} p mem) + => @mergePoint(b,x0,x1) (MOVDload [i0] {s} p mem) (ORW s0:(SLWconst [j0] x0:(MOVBZload [i0] {s} p mem)) @@ -1579,7 +1393,7 @@ && or.Uses == 1 && mergePoint(b,x0,x1,y) != nil && clobber(x0, x1, s0, s1, or) - -> @mergePoint(b,x0,x1,y) (ORW <v.Type> (SLWconst <v.Type> [j1] (MOVHZload [i0] {s} p mem)) y) + => @mergePoint(b,x0,x1,y) (ORW <v.Type> (SLWconst <v.Type> [j1] (MOVHZload [i0] {s} p mem)) y) (OR s0:(SLDconst [j0] x0:(MOVBZload [i0] {s} p mem)) @@ -1596,7 +1410,7 @@ && or.Uses == 1 && mergePoint(b,x0,x1,y) != nil && clobber(x0, x1, s0, s1, or) - -> @mergePoint(b,x0,x1,y) (OR <v.Type> (SLDconst <v.Type> [j1] (MOVHZload [i0] {s} p mem)) y) + => @mergePoint(b,x0,x1,y) (OR <v.Type> (SLDconst <v.Type> [j1] (MOVHZload [i0] {s} p mem)) y) (OR s0:(SLDconst [j0] x0:(MOVHZload [i0] {s} p mem)) @@ -1613,115 +1427,7 @@ && or.Uses == 1 && mergePoint(b,x0,x1,y) != nil && clobber(x0, x1, s0, s1, or) - -> @mergePoint(b,x0,x1,y) (OR <v.Type> (SLDconst <v.Type> [j1] (MOVWZload [i0] {s} p mem)) y) - -// Big-endian indexed loads - -(ORW x1:(MOVBZloadidx [i1] {s} p idx mem) - sh:(SLWconst [8] x0:(MOVBZloadidx [i0] {s} p idx mem))) - && i1 == i0+1 - && p.Op != OpSB - && x0.Uses == 1 - && x1.Uses == 1 - && sh.Uses == 1 - && mergePoint(b,x0,x1) != nil - && clobber(x0, x1, sh) - -> @mergePoint(b,x0,x1) (MOVHZloadidx [i0] {s} p idx mem) - -(OR x1:(MOVBZloadidx [i1] {s} p idx mem) - sh:(SLDconst [8] x0:(MOVBZloadidx [i0] {s} p idx mem))) - && i1 == i0+1 - && p.Op != OpSB - && x0.Uses == 1 - && x1.Uses == 1 - && sh.Uses == 1 - && mergePoint(b,x0,x1) != nil - && clobber(x0, x1, sh) - -> @mergePoint(b,x0,x1) (MOVHZloadidx [i0] {s} p idx mem) - -(ORW x1:(MOVHZloadidx [i1] {s} p idx mem) - sh:(SLWconst [16] x0:(MOVHZloadidx [i0] {s} p idx mem))) - && i1 == i0+2 - && p.Op != OpSB - && x0.Uses == 1 - && x1.Uses == 1 - && sh.Uses == 1 - && mergePoint(b,x0,x1) != nil - && clobber(x0, x1, sh) - -> @mergePoint(b,x0,x1) (MOVWZloadidx [i0] {s} p idx mem) - -(OR x1:(MOVHZloadidx [i1] {s} p idx mem) - sh:(SLDconst [16] x0:(MOVHZloadidx [i0] {s} p idx mem))) - && i1 == i0+2 - && p.Op != OpSB - && x0.Uses == 1 - && x1.Uses == 1 - && sh.Uses == 1 - && mergePoint(b,x0,x1) != nil - && clobber(x0, x1, sh) - -> @mergePoint(b,x0,x1) (MOVWZloadidx [i0] {s} p idx mem) - -(OR x1:(MOVWZloadidx [i1] {s} p idx mem) - sh:(SLDconst [32] x0:(MOVWZloadidx [i0] {s} p idx mem))) - && i1 == i0+4 - && p.Op != OpSB - && x0.Uses == 1 - && x1.Uses == 1 - && sh.Uses == 1 - && mergePoint(b,x0,x1) != nil - && clobber(x0, x1, sh) - -> @mergePoint(b,x0,x1) (MOVDloadidx [i0] {s} p idx mem) - -(ORW - s0:(SLWconst [j0] x0:(MOVBZloadidx [i0] {s} p idx mem)) - or:(ORW - s1:(SLWconst [j1] x1:(MOVBZloadidx [i1] {s} p idx mem)) - y)) - && i1 == i0+1 - && j1 == j0-8 - && j1 % 16 == 0 - && x0.Uses == 1 - && x1.Uses == 1 - && s0.Uses == 1 - && s1.Uses == 1 - && or.Uses == 1 - && mergePoint(b,x0,x1,y) != nil - && clobber(x0, x1, s0, s1, or) - -> @mergePoint(b,x0,x1,y) (ORW <v.Type> (SLWconst <v.Type> [j1] (MOVHZloadidx [i0] {s} p idx mem)) y) - -(OR - s0:(SLDconst [j0] x0:(MOVBZloadidx [i0] {s} p idx mem)) - or:(OR - s1:(SLDconst [j1] x1:(MOVBZloadidx [i1] {s} p idx mem)) - y)) - && i1 == i0+1 - && j1 == j0-8 - && j1 % 16 == 0 - && x0.Uses == 1 - && x1.Uses == 1 - && s0.Uses == 1 - && s1.Uses == 1 - && or.Uses == 1 - && mergePoint(b,x0,x1,y) != nil - && clobber(x0, x1, s0, s1, or) - -> @mergePoint(b,x0,x1,y) (OR <v.Type> (SLDconst <v.Type> [j1] (MOVHZloadidx [i0] {s} p idx mem)) y) - -(OR - s0:(SLDconst [j0] x0:(MOVHZloadidx [i0] {s} p idx mem)) - or:(OR - s1:(SLDconst [j1] x1:(MOVHZloadidx [i1] {s} p idx mem)) - y)) - && i1 == i0+2 - && j1 == j0-16 - && j1 % 32 == 0 - && x0.Uses == 1 - && x1.Uses == 1 - && s0.Uses == 1 - && s1.Uses == 1 - && or.Uses == 1 - && mergePoint(b,x0,x1,y) != nil - && clobber(x0, x1, s0, s1, or) - -> @mergePoint(b,x0,x1,y) (OR <v.Type> (SLDconst <v.Type> [j1] (MOVWZloadidx [i0] {s} p idx mem)) y) + => @mergePoint(b,x0,x1,y) (OR <v.Type> (SLDconst <v.Type> [j1] (MOVWZload [i0] {s} p mem)) y) // Little-endian loads @@ -1734,7 +1440,7 @@ && sh.Uses == 1 && mergePoint(b,x0,x1) != nil && clobber(x0, x1, sh) - -> @mergePoint(b,x0,x1) (MOVHZreg (MOVHBRload [i0] {s} p mem)) + => @mergePoint(b,x0,x1) (MOVHZreg (MOVHBRload [i0] {s} p mem)) (OR x0:(MOVBZload [i0] {s} p mem) sh:(SLDconst [8] x1:(MOVBZload [i1] {s} p mem))) @@ -1745,7 +1451,7 @@ && sh.Uses == 1 && mergePoint(b,x0,x1) != nil && clobber(x0, x1, sh) - -> @mergePoint(b,x0,x1) (MOVHZreg (MOVHBRload [i0] {s} p mem)) + => @mergePoint(b,x0,x1) (MOVHZreg (MOVHBRload [i0] {s} p mem)) (ORW r0:(MOVHZreg x0:(MOVHBRload [i0] {s} p mem)) sh:(SLWconst [16] r1:(MOVHZreg x1:(MOVHBRload [i1] {s} p mem)))) @@ -1757,7 +1463,7 @@ && sh.Uses == 1 && mergePoint(b,x0,x1) != nil && clobber(x0, x1, r0, r1, sh) - -> @mergePoint(b,x0,x1) (MOVWBRload [i0] {s} p mem) + => @mergePoint(b,x0,x1) (MOVWBRload [i0] {s} p mem) (OR r0:(MOVHZreg x0:(MOVHBRload [i0] {s} p mem)) sh:(SLDconst [16] r1:(MOVHZreg x1:(MOVHBRload [i1] {s} p mem)))) @@ -1769,7 +1475,7 @@ && sh.Uses == 1 && mergePoint(b,x0,x1) != nil && clobber(x0, x1, r0, r1, sh) - -> @mergePoint(b,x0,x1) (MOVWZreg (MOVWBRload [i0] {s} p mem)) + => @mergePoint(b,x0,x1) (MOVWZreg (MOVWBRload [i0] {s} p mem)) (OR r0:(MOVWZreg x0:(MOVWBRload [i0] {s} p mem)) sh:(SLDconst [32] r1:(MOVWZreg x1:(MOVWBRload [i1] {s} p mem)))) @@ -1781,7 +1487,7 @@ && sh.Uses == 1 && mergePoint(b,x0,x1) != nil && clobber(x0, x1, r0, r1, sh) - -> @mergePoint(b,x0,x1) (MOVDBRload [i0] {s} p mem) + => @mergePoint(b,x0,x1) (MOVDBRload [i0] {s} p mem) (ORW s1:(SLWconst [j1] x1:(MOVBZload [i1] {s} p mem)) @@ -1799,7 +1505,7 @@ && or.Uses == 1 && mergePoint(b,x0,x1,y) != nil && clobber(x0, x1, s0, s1, or) - -> @mergePoint(b,x0,x1,y) (ORW <v.Type> (SLWconst <v.Type> [j0] (MOVHZreg (MOVHBRload [i0] {s} p mem))) y) + => @mergePoint(b,x0,x1,y) (ORW <v.Type> (SLWconst <v.Type> [j0] (MOVHZreg (MOVHBRload [i0] {s} p mem))) y) (OR s1:(SLDconst [j1] x1:(MOVBZload [i1] {s} p mem)) @@ -1817,7 +1523,7 @@ && or.Uses == 1 && mergePoint(b,x0,x1,y) != nil && clobber(x0, x1, s0, s1, or) - -> @mergePoint(b,x0,x1,y) (OR <v.Type> (SLDconst <v.Type> [j0] (MOVHZreg (MOVHBRload [i0] {s} p mem))) y) + => @mergePoint(b,x0,x1,y) (OR <v.Type> (SLDconst <v.Type> [j0] (MOVHZreg (MOVHBRload [i0] {s} p mem))) y) (OR s1:(SLDconst [j1] r1:(MOVHZreg x1:(MOVHBRload [i1] {s} p mem))) @@ -1836,168 +1542,53 @@ && or.Uses == 1 && mergePoint(b,x0,x1,y) != nil && clobber(x0, x1, r0, r1, s0, s1, or) - -> @mergePoint(b,x0,x1,y) (OR <v.Type> (SLDconst <v.Type> [j0] (MOVWZreg (MOVWBRload [i0] {s} p mem))) y) - -// Little-endian indexed loads - -(ORW x0:(MOVBZloadidx [i0] {s} p idx mem) - sh:(SLWconst [8] x1:(MOVBZloadidx [i1] {s} p idx mem))) - && p.Op != OpSB - && i1 == i0+1 - && x0.Uses == 1 - && x1.Uses == 1 - && sh.Uses == 1 - && mergePoint(b,x0,x1) != nil - && clobber(x0, x1, sh) - -> @mergePoint(b,x0,x1) (MOVHZreg (MOVHBRloadidx [i0] {s} p idx mem)) - -(OR x0:(MOVBZloadidx [i0] {s} p idx mem) - sh:(SLDconst [8] x1:(MOVBZloadidx [i1] {s} p idx mem))) - && p.Op != OpSB - && i1 == i0+1 - && x0.Uses == 1 - && x1.Uses == 1 - && sh.Uses == 1 - && mergePoint(b,x0,x1) != nil - && clobber(x0, x1, sh) - -> @mergePoint(b,x0,x1) (MOVHZreg (MOVHBRloadidx [i0] {s} p idx mem)) - -(ORW r0:(MOVHZreg x0:(MOVHBRloadidx [i0] {s} p idx mem)) - sh:(SLWconst [16] r1:(MOVHZreg x1:(MOVHBRloadidx [i1] {s} p idx mem)))) - && i1 == i0+2 - && x0.Uses == 1 - && x1.Uses == 1 - && r0.Uses == 1 - && r1.Uses == 1 - && sh.Uses == 1 - && mergePoint(b,x0,x1) != nil - && clobber(x0, x1, r0, r1, sh) - -> @mergePoint(b,x0,x1) (MOVWBRloadidx [i0] {s} p idx mem) - -(OR r0:(MOVHZreg x0:(MOVHBRloadidx [i0] {s} p idx mem)) - sh:(SLDconst [16] r1:(MOVHZreg x1:(MOVHBRloadidx [i1] {s} p idx mem)))) - && i1 == i0+2 - && x0.Uses == 1 - && x1.Uses == 1 - && r0.Uses == 1 - && r1.Uses == 1 - && sh.Uses == 1 - && mergePoint(b,x0,x1) != nil - && clobber(x0, x1, r0, r1, sh) - -> @mergePoint(b,x0,x1) (MOVWZreg (MOVWBRloadidx [i0] {s} p idx mem)) - -(OR r0:(MOVWZreg x0:(MOVWBRloadidx [i0] {s} p idx mem)) - sh:(SLDconst [32] r1:(MOVWZreg x1:(MOVWBRloadidx [i1] {s} p idx mem)))) - && i1 == i0+4 - && x0.Uses == 1 - && x1.Uses == 1 - && r0.Uses == 1 - && r1.Uses == 1 - && sh.Uses == 1 - && mergePoint(b,x0,x1) != nil - && clobber(x0, x1, r0, r1, sh) - -> @mergePoint(b,x0,x1) (MOVDBRloadidx [i0] {s} p idx mem) - -(ORW - s1:(SLWconst [j1] x1:(MOVBZloadidx [i1] {s} p idx mem)) - or:(ORW - s0:(SLWconst [j0] x0:(MOVBZloadidx [i0] {s} p idx mem)) - y)) - && p.Op != OpSB - && i1 == i0+1 - && j1 == j0+8 - && j0 % 16 == 0 - && x0.Uses == 1 - && x1.Uses == 1 - && s0.Uses == 1 - && s1.Uses == 1 - && or.Uses == 1 - && mergePoint(b,x0,x1,y) != nil - && clobber(x0, x1, s0, s1, or) - -> @mergePoint(b,x0,x1,y) (ORW <v.Type> (SLWconst <v.Type> [j0] (MOVHZreg (MOVHBRloadidx [i0] {s} p idx mem))) y) - -(OR - s1:(SLDconst [j1] x1:(MOVBZloadidx [i1] {s} p idx mem)) - or:(OR - s0:(SLDconst [j0] x0:(MOVBZloadidx [i0] {s} p idx mem)) - y)) - && p.Op != OpSB - && i1 == i0+1 - && j1 == j0+8 - && j0 % 16 == 0 - && x0.Uses == 1 - && x1.Uses == 1 - && s0.Uses == 1 - && s1.Uses == 1 - && or.Uses == 1 - && mergePoint(b,x0,x1,y) != nil - && clobber(x0, x1, s0, s1, or) - -> @mergePoint(b,x0,x1,y) (OR <v.Type> (SLDconst <v.Type> [j0] (MOVHZreg (MOVHBRloadidx [i0] {s} p idx mem))) y) - -(OR - s1:(SLDconst [j1] r1:(MOVHZreg x1:(MOVHBRloadidx [i1] {s} p idx mem))) - or:(OR - s0:(SLDconst [j0] r0:(MOVHZreg x0:(MOVHBRloadidx [i0] {s} p idx mem))) - y)) - && i1 == i0+2 - && j1 == j0+16 - && j0 % 32 == 0 - && x0.Uses == 1 - && x1.Uses == 1 - && r0.Uses == 1 - && r1.Uses == 1 - && s0.Uses == 1 - && s1.Uses == 1 - && or.Uses == 1 - && mergePoint(b,x0,x1,y) != nil - && clobber(x0, x1, r0, r1, s0, s1, or) - -> @mergePoint(b,x0,x1,y) (OR <v.Type> (SLDconst <v.Type> [j0] (MOVWZreg (MOVWBRloadidx [i0] {s} p idx mem))) y) + => @mergePoint(b,x0,x1,y) (OR <v.Type> (SLDconst <v.Type> [j0] (MOVWZreg (MOVWBRload [i0] {s} p mem))) y) // Combine stores into store multiples. // 32-bit (MOVWstore [i] {s} p w1 x:(MOVWstore [i-4] {s} p w0 mem)) && p.Op != OpSB && x.Uses == 1 - && is20Bit(i-4) + && is20Bit(int64(i)-4) && clobber(x) - -> (STM2 [i-4] {s} p w0 w1 mem) + => (STM2 [i-4] {s} p w0 w1 mem) (MOVWstore [i] {s} p w2 x:(STM2 [i-8] {s} p w0 w1 mem)) && x.Uses == 1 - && is20Bit(i-8) + && is20Bit(int64(i)-8) && clobber(x) - -> (STM3 [i-8] {s} p w0 w1 w2 mem) + => (STM3 [i-8] {s} p w0 w1 w2 mem) (MOVWstore [i] {s} p w3 x:(STM3 [i-12] {s} p w0 w1 w2 mem)) && x.Uses == 1 - && is20Bit(i-12) + && is20Bit(int64(i)-12) && clobber(x) - -> (STM4 [i-12] {s} p w0 w1 w2 w3 mem) + => (STM4 [i-12] {s} p w0 w1 w2 w3 mem) (STM2 [i] {s} p w2 w3 x:(STM2 [i-8] {s} p w0 w1 mem)) && x.Uses == 1 - && is20Bit(i-8) + && is20Bit(int64(i)-8) && clobber(x) - -> (STM4 [i-8] {s} p w0 w1 w2 w3 mem) + => (STM4 [i-8] {s} p w0 w1 w2 w3 mem) // 64-bit (MOVDstore [i] {s} p w1 x:(MOVDstore [i-8] {s} p w0 mem)) && p.Op != OpSB && x.Uses == 1 - && is20Bit(i-8) + && is20Bit(int64(i)-8) && clobber(x) - -> (STMG2 [i-8] {s} p w0 w1 mem) + => (STMG2 [i-8] {s} p w0 w1 mem) (MOVDstore [i] {s} p w2 x:(STMG2 [i-16] {s} p w0 w1 mem)) && x.Uses == 1 - && is20Bit(i-16) + && is20Bit(int64(i)-16) && clobber(x) - -> (STMG3 [i-16] {s} p w0 w1 w2 mem) + => (STMG3 [i-16] {s} p w0 w1 w2 mem) (MOVDstore [i] {s} p w3 x:(STMG3 [i-24] {s} p w0 w1 w2 mem)) && x.Uses == 1 - && is20Bit(i-24) + && is20Bit(int64(i)-24) && clobber(x) - -> (STMG4 [i-24] {s} p w0 w1 w2 w3 mem) + => (STMG4 [i-24] {s} p w0 w1 w2 w3 mem) (STMG2 [i] {s} p w2 w3 x:(STMG2 [i-16] {s} p w0 w1 mem)) && x.Uses == 1 - && is20Bit(i-16) + && is20Bit(int64(i)-16) && clobber(x) - -> (STMG4 [i-16] {s} p w0 w1 w2 w3 mem) + => (STMG4 [i-16] {s} p w0 w1 w2 w3 mem) // Convert 32-bit store multiples into 64-bit stores. -(STM2 [i] {s} p (SRDconst [32] x) x mem) -> (MOVDstore [i] {s} p x mem) +(STM2 [i] {s} p (SRDconst [32] x) x mem) => (MOVDstore [i] {s} p x mem) diff --git a/src/cmd/compile/internal/ssa/gen/dec.rules b/src/cmd/compile/internal/ssa/gen/dec.rules index 3fd2be409f..4c677f8418 100644 --- a/src/cmd/compile/internal/ssa/gen/dec.rules +++ b/src/cmd/compile/internal/ssa/gen/dec.rules @@ -66,14 +66,14 @@ (Load <typ.Int> (OffPtr <typ.IntPtr> [2*config.PtrSize] ptr) mem)) -(Store dst (SliceMake ptr len cap) mem) => +(Store {t} dst (SliceMake ptr len cap) mem) => (Store {typ.Int} (OffPtr <typ.IntPtr> [2*config.PtrSize] dst) cap (Store {typ.Int} (OffPtr <typ.IntPtr> [config.PtrSize] dst) len - (Store {typ.BytePtr} dst ptr mem))) + (Store {t.Elem().PtrTo()} dst ptr mem))) // interface ops (ITab (IMake itab _)) => itab diff --git a/src/cmd/compile/internal/ssa/gen/rulegen.go b/src/cmd/compile/internal/ssa/gen/rulegen.go index e520503ab1..9e2e112cd7 100644 --- a/src/cmd/compile/internal/ssa/gen/rulegen.go +++ b/src/cmd/compile/internal/ssa/gen/rulegen.go @@ -1423,7 +1423,8 @@ func parseValue(val string, arch arch, loc string) (op opData, oparch, typ, auxi func opHasAuxInt(op opData) bool { switch op.aux { - case "Bool", "Int8", "Int16", "Int32", "Int64", "Int128", "Float32", "Float64", "SymOff", "SymValAndOff", "TypSize", "ARM64BitField", "FlagConstant": + case "Bool", "Int8", "Int16", "Int32", "Int64", "Int128", "Float32", "Float64", + "SymOff", "SymValAndOff", "TypSize", "ARM64BitField", "FlagConstant", "CCop": return true } return false @@ -1431,7 +1432,7 @@ func opHasAuxInt(op opData) bool { func opHasAux(op opData) bool { switch op.aux { - case "String", "Sym", "SymOff", "SymValAndOff", "Typ", "TypSize", "CCop", + case "String", "Sym", "SymOff", "SymValAndOff", "Typ", "TypSize", "S390XCCMask", "S390XRotateParams": return true } @@ -1784,8 +1785,6 @@ func (op opData) auxType() string { return "s390x.CCMask" case "S390XRotateParams": return "s390x.RotateParams" - case "CCop": - return "CCop" default: return "invalid" } diff --git a/src/cmd/compile/internal/ssa/lower.go b/src/cmd/compile/internal/ssa/lower.go index ab0fa803bf..f332b2e028 100644 --- a/src/cmd/compile/internal/ssa/lower.go +++ b/src/cmd/compile/internal/ssa/lower.go @@ -7,7 +7,7 @@ package ssa // convert to machine-dependent ops func lower(f *Func) { // repeat rewrites until we find no more rewrites - applyRewrite(f, f.Config.lowerBlock, f.Config.lowerValue) + applyRewrite(f, f.Config.lowerBlock, f.Config.lowerValue, removeDeadValues) } // checkLower checks for unlowered opcodes and fails if we find one. diff --git a/src/cmd/compile/internal/ssa/nilcheck.go b/src/cmd/compile/internal/ssa/nilcheck.go index 6b24371ac7..d1bad529e7 100644 --- a/src/cmd/compile/internal/ssa/nilcheck.go +++ b/src/cmd/compile/internal/ssa/nilcheck.go @@ -235,7 +235,7 @@ func nilcheckelim2(f *Func) { continue } if v.Type.IsMemory() || v.Type.IsTuple() && v.Type.FieldType(1).IsMemory() { - if v.Op == OpVarKill || v.Op == OpVarLive || (v.Op == OpVarDef && !v.Aux.(GCNode).Typ().HasHeapPointer()) { + if v.Op == OpVarKill || v.Op == OpVarLive || (v.Op == OpVarDef && !v.Aux.(GCNode).Typ().HasPointers()) { // These ops don't really change memory. continue // Note: OpVarDef requires that the defined variable not have pointers. diff --git a/src/cmd/compile/internal/ssa/opGen.go b/src/cmd/compile/internal/ssa/opGen.go index 4cd72799e8..45401898c8 100644 --- a/src/cmd/compile/internal/ssa/opGen.go +++ b/src/cmd/compile/internal/ssa/opGen.go @@ -1828,6 +1828,7 @@ const ( OpPPC64FADD OpPPC64FADDS OpPPC64SUB + OpPPC64SUBFCconst OpPPC64FSUB OpPPC64FSUBS OpPPC64MULLD @@ -1853,8 +1854,6 @@ const ( OpPPC64ROTL OpPPC64ROTLW OpPPC64LoweredAdd64Carry - OpPPC64ADDconstForCarry - OpPPC64MaskIfNotCarry OpPPC64SRADconst OpPPC64SRAWconst OpPPC64SRDconst @@ -2027,8 +2026,6 @@ const ( OpPPC64FlagEQ OpPPC64FlagLT OpPPC64FlagGT - OpPPC64FlagCarrySet - OpPPC64FlagCarryClear OpRISCV64ADD OpRISCV64ADDI @@ -24318,6 +24315,20 @@ var opcodeTable = [...]opInfo{ }, }, { + name: "SUBFCconst", + auxType: auxInt64, + argLen: 1, + asm: ppc64.ASUBC, + reg: regInfo{ + inputs: []inputInfo{ + {0, 1073733630}, // SP SB R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R14 R15 R16 R17 R18 R19 R20 R21 R22 R23 R24 R25 R26 R27 R28 R29 + }, + outputs: []outputInfo{ + {0, 1073733624}, // R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R14 R15 R16 R17 R18 R19 R20 R21 R22 R23 R24 R25 R26 R27 R28 R29 + }, + }, + }, + { name: "FSUB", argLen: 2, asm: ppc64.AFSUB, @@ -24684,28 +24695,6 @@ var opcodeTable = [...]opInfo{ }, }, { - name: "ADDconstForCarry", - auxType: auxInt16, - argLen: 1, - asm: ppc64.AADDC, - reg: regInfo{ - inputs: []inputInfo{ - {0, 1073733630}, // SP SB R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R14 R15 R16 R17 R18 R19 R20 R21 R22 R23 R24 R25 R26 R27 R28 R29 - }, - clobbers: 2147483648, // R31 - }, - }, - { - name: "MaskIfNotCarry", - argLen: 1, - asm: ppc64.AADDME, - reg: regInfo{ - outputs: []outputInfo{ - {0, 1073733624}, // R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R14 R15 R16 R17 R18 R19 R20 R21 R22 R23 R24 R25 R26 R27 R28 R29 - }, - }, - }, - { name: "SRADconst", auxType: auxInt64, argLen: 1, @@ -26964,16 +26953,6 @@ var opcodeTable = [...]opInfo{ argLen: 0, reg: regInfo{}, }, - { - name: "FlagCarrySet", - argLen: 0, - reg: regInfo{}, - }, - { - name: "FlagCarryClear", - argLen: 0, - reg: regInfo{}, - }, { name: "ADD", diff --git a/src/cmd/compile/internal/ssa/opt.go b/src/cmd/compile/internal/ssa/opt.go index 6e91fd7da3..128e614175 100644 --- a/src/cmd/compile/internal/ssa/opt.go +++ b/src/cmd/compile/internal/ssa/opt.go @@ -6,5 +6,5 @@ package ssa // machine-independent optimization func opt(f *Func) { - applyRewrite(f, rewriteBlockgeneric, rewriteValuegeneric) + applyRewrite(f, rewriteBlockgeneric, rewriteValuegeneric, removeDeadValues) } diff --git a/src/cmd/compile/internal/ssa/regalloc.go b/src/cmd/compile/internal/ssa/regalloc.go index a2be7bb596..64c6aed3e7 100644 --- a/src/cmd/compile/internal/ssa/regalloc.go +++ b/src/cmd/compile/internal/ssa/regalloc.go @@ -588,7 +588,7 @@ func (s *regAllocState) init(f *Func) { if s.f.Config.hasGReg { s.allocatable &^= 1 << s.GReg } - if s.f.Config.ctxt.Framepointer_enabled && s.f.Config.FPReg >= 0 { + if objabi.Framepointer_enabled && s.f.Config.FPReg >= 0 { s.allocatable &^= 1 << uint(s.f.Config.FPReg) } if s.f.Config.LinkReg != -1 { diff --git a/src/cmd/compile/internal/ssa/rewrite.go b/src/cmd/compile/internal/ssa/rewrite.go index fb35691296..09f94ef53e 100644 --- a/src/cmd/compile/internal/ssa/rewrite.go +++ b/src/cmd/compile/internal/ssa/rewrite.go @@ -20,7 +20,15 @@ import ( "path/filepath" ) -func applyRewrite(f *Func, rb blockRewriter, rv valueRewriter) { +type deadValueChoice bool + +const ( + leaveDeadValues deadValueChoice = false + removeDeadValues = true +) + +// deadcode indicates that rewrite should try to remove any values that become dead. +func applyRewrite(f *Func, rb blockRewriter, rv valueRewriter, deadcode deadValueChoice) { // repeat rewrites until we find no more rewrites pendingLines := f.cachedLineStarts // Holds statement boundaries that need to be moved to a new value/block pendingLines.clear() @@ -56,6 +64,18 @@ func applyRewrite(f *Func, rb blockRewriter, rv valueRewriter) { *v0 = *v v0.Args = append([]*Value{}, v.Args...) // make a new copy, not aliasing } + if v.Uses == 0 && v.removeable() { + if v.Op != OpInvalid && deadcode == removeDeadValues { + // Reset any values that are now unused, so that we decrement + // the use count of all of its arguments. + // Not quite a deadcode pass, because it does not handle cycles. + // But it should help Uses==1 rules to fire. + v.reset(OpInvalid) + change = true + } + // No point rewriting values which aren't used. + continue + } vchange := phielimValue(v) if vchange && debug > 1 { @@ -631,6 +651,10 @@ func auxIntToFlagConstant(x int64) flagConstant { return flagConstant(x) } +func auxIntToOp(cc int64) Op { + return Op(cc) +} + func boolToAuxInt(b bool) int64 { if b { return 1 @@ -674,6 +698,10 @@ func flagConstantToAuxInt(x flagConstant) int64 { return int64(x) } +func opToAuxInt(o Op) int64 { + return int64(o) +} + func auxToString(i interface{}) string { return i.(string) } @@ -707,13 +735,6 @@ func s390xCCMaskToAux(c s390x.CCMask) interface{} { func s390xRotateParamsToAux(r s390x.RotateParams) interface{} { return r } -func cCopToAux(o Op) interface{} { - return o -} - -func auxToCCop(cc interface{}) Op { - return cc.(Op) -} // uaddOvf reports whether unsigned a+b would overflow. func uaddOvf(a, b int64) bool { diff --git a/src/cmd/compile/internal/ssa/rewriteAMD64.go b/src/cmd/compile/internal/ssa/rewriteAMD64.go index cda9df56f4..89d64052fe 100644 --- a/src/cmd/compile/internal/ssa/rewriteAMD64.go +++ b/src/cmd/compile/internal/ssa/rewriteAMD64.go @@ -1245,9 +1245,9 @@ func rewriteValueAMD64_OpAMD64ADDL(v *Value) bool { if v_1.Op != OpAMD64MOVLconst { continue } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) v.reset(OpAMD64ADDLconst) - v.AuxInt = c + v.AuxInt = int32ToAuxInt(c) v.AddArg(x) return true } @@ -1261,17 +1261,17 @@ func rewriteValueAMD64_OpAMD64ADDL(v *Value) bool { if v_0.Op != OpAMD64SHLLconst { continue } - c := v_0.AuxInt + c := auxIntToInt8(v_0.AuxInt) x := v_0.Args[0] if v_1.Op != OpAMD64SHRLconst { continue } - d := v_1.AuxInt + d := auxIntToInt8(v_1.AuxInt) if x != v_1.Args[0] || !(d == 32-c) { continue } v.reset(OpAMD64ROLLconst) - v.AuxInt = c + v.AuxInt = int8ToAuxInt(c) v.AddArg(x) return true } @@ -1286,17 +1286,17 @@ func rewriteValueAMD64_OpAMD64ADDL(v *Value) bool { if v_0.Op != OpAMD64SHLLconst { continue } - c := v_0.AuxInt + c := auxIntToInt8(v_0.AuxInt) x := v_0.Args[0] if v_1.Op != OpAMD64SHRWconst { continue } - d := v_1.AuxInt + d := auxIntToInt8(v_1.AuxInt) if x != v_1.Args[0] || !(d == 16-c && c < 16 && t.Size() == 2) { continue } v.reset(OpAMD64ROLWconst) - v.AuxInt = c + v.AuxInt = int8ToAuxInt(c) v.AddArg(x) return true } @@ -1311,17 +1311,17 @@ func rewriteValueAMD64_OpAMD64ADDL(v *Value) bool { if v_0.Op != OpAMD64SHLLconst { continue } - c := v_0.AuxInt + c := auxIntToInt8(v_0.AuxInt) x := v_0.Args[0] if v_1.Op != OpAMD64SHRBconst { continue } - d := v_1.AuxInt + d := auxIntToInt8(v_1.AuxInt) if x != v_1.Args[0] || !(d == 8-c && c < 8 && t.Size() == 1) { continue } v.reset(OpAMD64ROLBconst) - v.AuxInt = c + v.AuxInt = int8ToAuxInt(c) v.AddArg(x) return true } @@ -1332,7 +1332,7 @@ func rewriteValueAMD64_OpAMD64ADDL(v *Value) bool { for { for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { x := v_0 - if v_1.Op != OpAMD64SHLLconst || v_1.AuxInt != 3 { + if v_1.Op != OpAMD64SHLLconst || auxIntToInt8(v_1.AuxInt) != 3 { continue } y := v_1.Args[0] @@ -1347,7 +1347,7 @@ func rewriteValueAMD64_OpAMD64ADDL(v *Value) bool { for { for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { x := v_0 - if v_1.Op != OpAMD64SHLLconst || v_1.AuxInt != 2 { + if v_1.Op != OpAMD64SHLLconst || auxIntToInt8(v_1.AuxInt) != 2 { continue } y := v_1.Args[0] @@ -1362,7 +1362,7 @@ func rewriteValueAMD64_OpAMD64ADDL(v *Value) bool { for { for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { x := v_0 - if v_1.Op != OpAMD64SHLLconst || v_1.AuxInt != 1 { + if v_1.Op != OpAMD64SHLLconst || auxIntToInt8(v_1.AuxInt) != 1 { continue } y := v_1.Args[0] @@ -1420,11 +1420,11 @@ func rewriteValueAMD64_OpAMD64ADDL(v *Value) bool { if v_0.Op != OpAMD64ADDLconst { continue } - c := v_0.AuxInt + c := auxIntToInt32(v_0.AuxInt) x := v_0.Args[0] y := v_1 v.reset(OpAMD64LEAL1) - v.AuxInt = c + v.AuxInt = int32ToAuxInt(c) v.AddArg2(x, y) return true } @@ -1439,15 +1439,15 @@ func rewriteValueAMD64_OpAMD64ADDL(v *Value) bool { if v_1.Op != OpAMD64LEAL { continue } - c := v_1.AuxInt - s := v_1.Aux + c := auxIntToInt32(v_1.AuxInt) + s := auxToSym(v_1.Aux) y := v_1.Args[0] if !(x.Op != OpSB && y.Op != OpSB) { continue } v.reset(OpAMD64LEAL1) - v.AuxInt = c - v.Aux = s + v.AuxInt = int32ToAuxInt(c) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } @@ -1500,131 +1500,131 @@ func rewriteValueAMD64_OpAMD64ADDLconst(v *Value) bool { // match: (ADDLconst [c] (ADDL x y)) // result: (LEAL1 [c] x y) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) if v_0.Op != OpAMD64ADDL { break } y := v_0.Args[1] x := v_0.Args[0] v.reset(OpAMD64LEAL1) - v.AuxInt = c + v.AuxInt = int32ToAuxInt(c) v.AddArg2(x, y) return true } // match: (ADDLconst [c] (SHLLconst [1] x)) // result: (LEAL1 [c] x x) for { - c := v.AuxInt - if v_0.Op != OpAMD64SHLLconst || v_0.AuxInt != 1 { + c := auxIntToInt32(v.AuxInt) + if v_0.Op != OpAMD64SHLLconst || auxIntToInt8(v_0.AuxInt) != 1 { break } x := v_0.Args[0] v.reset(OpAMD64LEAL1) - v.AuxInt = c + v.AuxInt = int32ToAuxInt(c) v.AddArg2(x, x) return true } // match: (ADDLconst [c] (LEAL [d] {s} x)) - // cond: is32Bit(c+d) + // cond: is32Bit(int64(c)+int64(d)) // result: (LEAL [c+d] {s} x) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) if v_0.Op != OpAMD64LEAL { break } - d := v_0.AuxInt - s := v_0.Aux + d := auxIntToInt32(v_0.AuxInt) + s := auxToSym(v_0.Aux) x := v_0.Args[0] - if !(is32Bit(c + d)) { + if !(is32Bit(int64(c) + int64(d))) { break } v.reset(OpAMD64LEAL) - v.AuxInt = c + d - v.Aux = s + v.AuxInt = int32ToAuxInt(c + d) + v.Aux = symToAux(s) v.AddArg(x) return true } // match: (ADDLconst [c] (LEAL1 [d] {s} x y)) - // cond: is32Bit(c+d) + // cond: is32Bit(int64(c)+int64(d)) // result: (LEAL1 [c+d] {s} x y) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) if v_0.Op != OpAMD64LEAL1 { break } - d := v_0.AuxInt - s := v_0.Aux + d := auxIntToInt32(v_0.AuxInt) + s := auxToSym(v_0.Aux) y := v_0.Args[1] x := v_0.Args[0] - if !(is32Bit(c + d)) { + if !(is32Bit(int64(c) + int64(d))) { break } v.reset(OpAMD64LEAL1) - v.AuxInt = c + d - v.Aux = s + v.AuxInt = int32ToAuxInt(c + d) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } // match: (ADDLconst [c] (LEAL2 [d] {s} x y)) - // cond: is32Bit(c+d) + // cond: is32Bit(int64(c)+int64(d)) // result: (LEAL2 [c+d] {s} x y) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) if v_0.Op != OpAMD64LEAL2 { break } - d := v_0.AuxInt - s := v_0.Aux + d := auxIntToInt32(v_0.AuxInt) + s := auxToSym(v_0.Aux) y := v_0.Args[1] x := v_0.Args[0] - if !(is32Bit(c + d)) { + if !(is32Bit(int64(c) + int64(d))) { break } v.reset(OpAMD64LEAL2) - v.AuxInt = c + d - v.Aux = s + v.AuxInt = int32ToAuxInt(c + d) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } // match: (ADDLconst [c] (LEAL4 [d] {s} x y)) - // cond: is32Bit(c+d) + // cond: is32Bit(int64(c)+int64(d)) // result: (LEAL4 [c+d] {s} x y) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) if v_0.Op != OpAMD64LEAL4 { break } - d := v_0.AuxInt - s := v_0.Aux + d := auxIntToInt32(v_0.AuxInt) + s := auxToSym(v_0.Aux) y := v_0.Args[1] x := v_0.Args[0] - if !(is32Bit(c + d)) { + if !(is32Bit(int64(c) + int64(d))) { break } v.reset(OpAMD64LEAL4) - v.AuxInt = c + d - v.Aux = s + v.AuxInt = int32ToAuxInt(c + d) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } // match: (ADDLconst [c] (LEAL8 [d] {s} x y)) - // cond: is32Bit(c+d) + // cond: is32Bit(int64(c)+int64(d)) // result: (LEAL8 [c+d] {s} x y) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) if v_0.Op != OpAMD64LEAL8 { break } - d := v_0.AuxInt - s := v_0.Aux + d := auxIntToInt32(v_0.AuxInt) + s := auxToSym(v_0.Aux) y := v_0.Args[1] x := v_0.Args[0] - if !(is32Bit(c + d)) { + if !(is32Bit(int64(c) + int64(d))) { break } v.reset(OpAMD64LEAL8) - v.AuxInt = c + d - v.Aux = s + v.AuxInt = int32ToAuxInt(c + d) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } @@ -1685,23 +1685,23 @@ func rewriteValueAMD64_OpAMD64ADDLconstmodify(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (ADDLconstmodify [valoff1] {sym} (ADDQconst [off2] base) mem) - // cond: ValAndOff(valoff1).canAdd(off2) - // result: (ADDLconstmodify [ValAndOff(valoff1).add(off2)] {sym} base mem) + // cond: ValAndOff(valoff1).canAdd32(off2) + // result: (ADDLconstmodify [ValAndOff(valoff1).addOffset32(off2)] {sym} base mem) for { - valoff1 := v.AuxInt - sym := v.Aux + valoff1 := auxIntToValAndOff(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] mem := v_1 - if !(ValAndOff(valoff1).canAdd(off2)) { + if !(ValAndOff(valoff1).canAdd32(off2)) { break } v.reset(OpAMD64ADDLconstmodify) - v.AuxInt = ValAndOff(valoff1).add(off2) - v.Aux = sym + v.AuxInt = valAndOffToAuxInt(ValAndOff(valoff1).addOffset32(off2)) + v.Aux = symToAux(sym) v.AddArg2(base, mem) return true } @@ -1736,24 +1736,24 @@ func rewriteValueAMD64_OpAMD64ADDLload(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (ADDLload [off1] {sym} val (ADDQconst [off2] base) mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (ADDLload [off1+off2] {sym} val base mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) val := v_0 if v_1.Op != OpAMD64ADDQconst { break } - off2 := v_1.AuxInt + off2 := auxIntToInt32(v_1.AuxInt) base := v_1.Args[0] mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64ADDLload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(val, base, mem) return true } @@ -1807,24 +1807,24 @@ func rewriteValueAMD64_OpAMD64ADDLmodify(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (ADDLmodify [off1] {sym} (ADDQconst [off2] base) val mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (ADDLmodify [off1+off2] {sym} base val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64ADDLmodify) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(base, val, mem) return true } @@ -1858,39 +1858,35 @@ func rewriteValueAMD64_OpAMD64ADDQ(v *Value) bool { v_0 := v.Args[0] // match: (ADDQ x (MOVQconst [c])) // cond: is32Bit(c) - // result: (ADDQconst [c] x) + // result: (ADDQconst [int32(c)] x) for { for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { x := v_0 if v_1.Op != OpAMD64MOVQconst { continue } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) if !(is32Bit(c)) { continue } v.reset(OpAMD64ADDQconst) - v.AuxInt = c + v.AuxInt = int32ToAuxInt(int32(c)) v.AddArg(x) return true } break } // match: (ADDQ x (MOVLconst [c])) - // cond: is32Bit(c) - // result: (ADDQconst [int64(int32(c))] x) + // result: (ADDQconst [c] x) for { for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { x := v_0 if v_1.Op != OpAMD64MOVLconst { continue } - c := v_1.AuxInt - if !(is32Bit(c)) { - continue - } + c := auxIntToInt32(v_1.AuxInt) v.reset(OpAMD64ADDQconst) - v.AuxInt = int64(int32(c)) + v.AuxInt = int32ToAuxInt(c) v.AddArg(x) return true } @@ -1904,17 +1900,17 @@ func rewriteValueAMD64_OpAMD64ADDQ(v *Value) bool { if v_0.Op != OpAMD64SHLQconst { continue } - c := v_0.AuxInt + c := auxIntToInt8(v_0.AuxInt) x := v_0.Args[0] if v_1.Op != OpAMD64SHRQconst { continue } - d := v_1.AuxInt + d := auxIntToInt8(v_1.AuxInt) if x != v_1.Args[0] || !(d == 64-c) { continue } v.reset(OpAMD64ROLQconst) - v.AuxInt = c + v.AuxInt = int8ToAuxInt(c) v.AddArg(x) return true } @@ -1925,7 +1921,7 @@ func rewriteValueAMD64_OpAMD64ADDQ(v *Value) bool { for { for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { x := v_0 - if v_1.Op != OpAMD64SHLQconst || v_1.AuxInt != 3 { + if v_1.Op != OpAMD64SHLQconst || auxIntToInt8(v_1.AuxInt) != 3 { continue } y := v_1.Args[0] @@ -1940,7 +1936,7 @@ func rewriteValueAMD64_OpAMD64ADDQ(v *Value) bool { for { for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { x := v_0 - if v_1.Op != OpAMD64SHLQconst || v_1.AuxInt != 2 { + if v_1.Op != OpAMD64SHLQconst || auxIntToInt8(v_1.AuxInt) != 2 { continue } y := v_1.Args[0] @@ -1955,7 +1951,7 @@ func rewriteValueAMD64_OpAMD64ADDQ(v *Value) bool { for { for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { x := v_0 - if v_1.Op != OpAMD64SHLQconst || v_1.AuxInt != 1 { + if v_1.Op != OpAMD64SHLQconst || auxIntToInt8(v_1.AuxInt) != 1 { continue } y := v_1.Args[0] @@ -2013,11 +2009,11 @@ func rewriteValueAMD64_OpAMD64ADDQ(v *Value) bool { if v_0.Op != OpAMD64ADDQconst { continue } - c := v_0.AuxInt + c := auxIntToInt32(v_0.AuxInt) x := v_0.Args[0] y := v_1 v.reset(OpAMD64LEAQ1) - v.AuxInt = c + v.AuxInt = int32ToAuxInt(c) v.AddArg2(x, y) return true } @@ -2032,15 +2028,15 @@ func rewriteValueAMD64_OpAMD64ADDQ(v *Value) bool { if v_1.Op != OpAMD64LEAQ { continue } - c := v_1.AuxInt - s := v_1.Aux + c := auxIntToInt32(v_1.AuxInt) + s := auxToSym(v_1.Aux) y := v_1.Args[0] if !(x.Op != OpSB && y.Op != OpSB) { continue } v.reset(OpAMD64LEAQ1) - v.AuxInt = c - v.Aux = s + v.AuxInt = int32ToAuxInt(c) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } @@ -2118,131 +2114,131 @@ func rewriteValueAMD64_OpAMD64ADDQconst(v *Value) bool { // match: (ADDQconst [c] (ADDQ x y)) // result: (LEAQ1 [c] x y) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) if v_0.Op != OpAMD64ADDQ { break } y := v_0.Args[1] x := v_0.Args[0] v.reset(OpAMD64LEAQ1) - v.AuxInt = c + v.AuxInt = int32ToAuxInt(c) v.AddArg2(x, y) return true } // match: (ADDQconst [c] (SHLQconst [1] x)) // result: (LEAQ1 [c] x x) for { - c := v.AuxInt - if v_0.Op != OpAMD64SHLQconst || v_0.AuxInt != 1 { + c := auxIntToInt32(v.AuxInt) + if v_0.Op != OpAMD64SHLQconst || auxIntToInt8(v_0.AuxInt) != 1 { break } x := v_0.Args[0] v.reset(OpAMD64LEAQ1) - v.AuxInt = c + v.AuxInt = int32ToAuxInt(c) v.AddArg2(x, x) return true } // match: (ADDQconst [c] (LEAQ [d] {s} x)) - // cond: is32Bit(c+d) + // cond: is32Bit(int64(c)+int64(d)) // result: (LEAQ [c+d] {s} x) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) if v_0.Op != OpAMD64LEAQ { break } - d := v_0.AuxInt - s := v_0.Aux + d := auxIntToInt32(v_0.AuxInt) + s := auxToSym(v_0.Aux) x := v_0.Args[0] - if !(is32Bit(c + d)) { + if !(is32Bit(int64(c) + int64(d))) { break } v.reset(OpAMD64LEAQ) - v.AuxInt = c + d - v.Aux = s + v.AuxInt = int32ToAuxInt(c + d) + v.Aux = symToAux(s) v.AddArg(x) return true } // match: (ADDQconst [c] (LEAQ1 [d] {s} x y)) - // cond: is32Bit(c+d) + // cond: is32Bit(int64(c)+int64(d)) // result: (LEAQ1 [c+d] {s} x y) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) if v_0.Op != OpAMD64LEAQ1 { break } - d := v_0.AuxInt - s := v_0.Aux + d := auxIntToInt32(v_0.AuxInt) + s := auxToSym(v_0.Aux) y := v_0.Args[1] x := v_0.Args[0] - if !(is32Bit(c + d)) { + if !(is32Bit(int64(c) + int64(d))) { break } v.reset(OpAMD64LEAQ1) - v.AuxInt = c + d - v.Aux = s + v.AuxInt = int32ToAuxInt(c + d) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } // match: (ADDQconst [c] (LEAQ2 [d] {s} x y)) - // cond: is32Bit(c+d) + // cond: is32Bit(int64(c)+int64(d)) // result: (LEAQ2 [c+d] {s} x y) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) if v_0.Op != OpAMD64LEAQ2 { break } - d := v_0.AuxInt - s := v_0.Aux + d := auxIntToInt32(v_0.AuxInt) + s := auxToSym(v_0.Aux) y := v_0.Args[1] x := v_0.Args[0] - if !(is32Bit(c + d)) { + if !(is32Bit(int64(c) + int64(d))) { break } v.reset(OpAMD64LEAQ2) - v.AuxInt = c + d - v.Aux = s + v.AuxInt = int32ToAuxInt(c + d) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } // match: (ADDQconst [c] (LEAQ4 [d] {s} x y)) - // cond: is32Bit(c+d) + // cond: is32Bit(int64(c)+int64(d)) // result: (LEAQ4 [c+d] {s} x y) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) if v_0.Op != OpAMD64LEAQ4 { break } - d := v_0.AuxInt - s := v_0.Aux + d := auxIntToInt32(v_0.AuxInt) + s := auxToSym(v_0.Aux) y := v_0.Args[1] x := v_0.Args[0] - if !(is32Bit(c + d)) { + if !(is32Bit(int64(c) + int64(d))) { break } v.reset(OpAMD64LEAQ4) - v.AuxInt = c + d - v.Aux = s + v.AuxInt = int32ToAuxInt(c + d) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } // match: (ADDQconst [c] (LEAQ8 [d] {s} x y)) - // cond: is32Bit(c+d) + // cond: is32Bit(int64(c)+int64(d)) // result: (LEAQ8 [c+d] {s} x y) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) if v_0.Op != OpAMD64LEAQ8 { break } - d := v_0.AuxInt - s := v_0.Aux + d := auxIntToInt32(v_0.AuxInt) + s := auxToSym(v_0.Aux) y := v_0.Args[1] x := v_0.Args[0] - if !(is32Bit(c + d)) { + if !(is32Bit(int64(c) + int64(d))) { break } v.reset(OpAMD64LEAQ8) - v.AuxInt = c + d - v.Aux = s + v.AuxInt = int32ToAuxInt(c + d) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } @@ -2305,23 +2301,23 @@ func rewriteValueAMD64_OpAMD64ADDQconstmodify(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (ADDQconstmodify [valoff1] {sym} (ADDQconst [off2] base) mem) - // cond: ValAndOff(valoff1).canAdd(off2) - // result: (ADDQconstmodify [ValAndOff(valoff1).add(off2)] {sym} base mem) + // cond: ValAndOff(valoff1).canAdd32(off2) + // result: (ADDQconstmodify [ValAndOff(valoff1).addOffset32(off2)] {sym} base mem) for { - valoff1 := v.AuxInt - sym := v.Aux + valoff1 := auxIntToValAndOff(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] mem := v_1 - if !(ValAndOff(valoff1).canAdd(off2)) { + if !(ValAndOff(valoff1).canAdd32(off2)) { break } v.reset(OpAMD64ADDQconstmodify) - v.AuxInt = ValAndOff(valoff1).add(off2) - v.Aux = sym + v.AuxInt = valAndOffToAuxInt(ValAndOff(valoff1).addOffset32(off2)) + v.Aux = symToAux(sym) v.AddArg2(base, mem) return true } @@ -2356,24 +2352,24 @@ func rewriteValueAMD64_OpAMD64ADDQload(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (ADDQload [off1] {sym} val (ADDQconst [off2] base) mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (ADDQload [off1+off2] {sym} val base mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) val := v_0 if v_1.Op != OpAMD64ADDQconst { break } - off2 := v_1.AuxInt + off2 := auxIntToInt32(v_1.AuxInt) base := v_1.Args[0] mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64ADDQload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(val, base, mem) return true } @@ -2427,24 +2423,24 @@ func rewriteValueAMD64_OpAMD64ADDQmodify(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (ADDQmodify [off1] {sym} (ADDQconst [off2] base) val mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (ADDQmodify [off1+off2] {sym} base val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64ADDQmodify) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(base, val, mem) return true } @@ -2510,24 +2506,24 @@ func rewriteValueAMD64_OpAMD64ADDSDload(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (ADDSDload [off1] {sym} val (ADDQconst [off2] base) mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (ADDSDload [off1+off2] {sym} val base mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) val := v_0 if v_1.Op != OpAMD64ADDQconst { break } - off2 := v_1.AuxInt + off2 := auxIntToInt32(v_1.AuxInt) base := v_1.Args[0] mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64ADDSDload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(val, base, mem) return true } @@ -2613,24 +2609,24 @@ func rewriteValueAMD64_OpAMD64ADDSSload(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (ADDSSload [off1] {sym} val (ADDQconst [off2] base) mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (ADDSSload [off1+off2] {sym} val base mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) val := v_0 if v_1.Op != OpAMD64ADDQconst { break } - off2 := v_1.AuxInt + off2 := auxIntToInt32(v_1.AuxInt) base := v_1.Args[0] mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64ADDSSload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(val, base, mem) return true } @@ -2695,7 +2691,7 @@ func rewriteValueAMD64_OpAMD64ANDL(v *Value) bool { } y := v_0_0.Args[1] v_0_0_0 := v_0_0.Args[0] - if v_0_0_0.Op != OpAMD64MOVLconst || v_0_0_0.AuxInt != 1 { + if v_0_0_0.Op != OpAMD64MOVLconst || auxIntToInt32(v_0_0_0.AuxInt) != 1 { continue } x := v_1 @@ -2706,20 +2702,20 @@ func rewriteValueAMD64_OpAMD64ANDL(v *Value) bool { break } // match: (ANDL (MOVLconst [c]) x) - // cond: isUint32PowerOfTwo(^c) && uint64(^c) >= 128 - // result: (BTRLconst [log2uint32(^c)] x) + // cond: isUint32PowerOfTwo(int64(^c)) && uint64(^c) >= 128 + // result: (BTRLconst [int8(log32(^c))] x) for { for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { if v_0.Op != OpAMD64MOVLconst { continue } - c := v_0.AuxInt + c := auxIntToInt32(v_0.AuxInt) x := v_1 - if !(isUint32PowerOfTwo(^c) && uint64(^c) >= 128) { + if !(isUint32PowerOfTwo(int64(^c)) && uint64(^c) >= 128) { continue } v.reset(OpAMD64BTRLconst) - v.AuxInt = log2uint32(^c) + v.AuxInt = int8ToAuxInt(int8(log32(^c))) v.AddArg(x) return true } @@ -2733,9 +2729,9 @@ func rewriteValueAMD64_OpAMD64ANDL(v *Value) bool { if v_1.Op != OpAMD64MOVLconst { continue } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) v.reset(OpAMD64ANDLconst) - v.AuxInt = c + v.AuxInt = int32ToAuxInt(c) v.AddArg(x) return true } @@ -2781,16 +2777,16 @@ func rewriteValueAMD64_OpAMD64ANDL(v *Value) bool { func rewriteValueAMD64_OpAMD64ANDLconst(v *Value) bool { v_0 := v.Args[0] // match: (ANDLconst [c] x) - // cond: isUint32PowerOfTwo(^c) && uint64(^c) >= 128 - // result: (BTRLconst [log2uint32(^c)] x) + // cond: isUint32PowerOfTwo(int64(^c)) && uint64(^c) >= 128 + // result: (BTRLconst [int8(log32(^c))] x) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) x := v_0 - if !(isUint32PowerOfTwo(^c) && uint64(^c) >= 128) { + if !(isUint32PowerOfTwo(int64(^c)) && uint64(^c) >= 128) { break } v.reset(OpAMD64BTRLconst) - v.AuxInt = log2uint32(^c) + v.AuxInt = int8ToAuxInt(int8(log32(^c))) v.AddArg(x) return true } @@ -2825,7 +2821,7 @@ func rewriteValueAMD64_OpAMD64ANDLconst(v *Value) bool { // match: (ANDLconst [ 0xFF] x) // result: (MOVBQZX x) for { - if v.AuxInt != 0xFF { + if auxIntToInt32(v.AuxInt) != 0xFF { break } x := v_0 @@ -2836,7 +2832,7 @@ func rewriteValueAMD64_OpAMD64ANDLconst(v *Value) bool { // match: (ANDLconst [0xFFFF] x) // result: (MOVWQZX x) for { - if v.AuxInt != 0xFFFF { + if auxIntToInt32(v.AuxInt) != 0xFFFF { break } x := v_0 @@ -2886,23 +2882,23 @@ func rewriteValueAMD64_OpAMD64ANDLconstmodify(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (ANDLconstmodify [valoff1] {sym} (ADDQconst [off2] base) mem) - // cond: ValAndOff(valoff1).canAdd(off2) - // result: (ANDLconstmodify [ValAndOff(valoff1).add(off2)] {sym} base mem) + // cond: ValAndOff(valoff1).canAdd32(off2) + // result: (ANDLconstmodify [ValAndOff(valoff1).addOffset32(off2)] {sym} base mem) for { - valoff1 := v.AuxInt - sym := v.Aux + valoff1 := auxIntToValAndOff(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] mem := v_1 - if !(ValAndOff(valoff1).canAdd(off2)) { + if !(ValAndOff(valoff1).canAdd32(off2)) { break } v.reset(OpAMD64ANDLconstmodify) - v.AuxInt = ValAndOff(valoff1).add(off2) - v.Aux = sym + v.AuxInt = valAndOffToAuxInt(ValAndOff(valoff1).addOffset32(off2)) + v.Aux = symToAux(sym) v.AddArg2(base, mem) return true } @@ -2937,24 +2933,24 @@ func rewriteValueAMD64_OpAMD64ANDLload(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (ANDLload [off1] {sym} val (ADDQconst [off2] base) mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (ANDLload [off1+off2] {sym} val base mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) val := v_0 if v_1.Op != OpAMD64ADDQconst { break } - off2 := v_1.AuxInt + off2 := auxIntToInt32(v_1.AuxInt) base := v_1.Args[0] mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64ANDLload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(val, base, mem) return true } @@ -3008,24 +3004,24 @@ func rewriteValueAMD64_OpAMD64ANDLmodify(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (ANDLmodify [off1] {sym} (ADDQconst [off2] base) val mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (ANDLmodify [off1+off2] {sym} base val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64ANDLmodify) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(base, val, mem) return true } @@ -3070,7 +3066,7 @@ func rewriteValueAMD64_OpAMD64ANDQ(v *Value) bool { } y := v_0_0.Args[1] v_0_0_0 := v_0_0.Args[0] - if v_0_0_0.Op != OpAMD64MOVQconst || v_0_0_0.AuxInt != 1 { + if v_0_0_0.Op != OpAMD64MOVQconst || auxIntToInt64(v_0_0_0.AuxInt) != 1 { continue } x := v_1 @@ -3082,19 +3078,19 @@ func rewriteValueAMD64_OpAMD64ANDQ(v *Value) bool { } // match: (ANDQ (MOVQconst [c]) x) // cond: isUint64PowerOfTwo(^c) && uint64(^c) >= 128 - // result: (BTRQconst [log2(^c)] x) + // result: (BTRQconst [int8(log2(^c))] x) for { for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { if v_0.Op != OpAMD64MOVQconst { continue } - c := v_0.AuxInt + c := auxIntToInt64(v_0.AuxInt) x := v_1 if !(isUint64PowerOfTwo(^c) && uint64(^c) >= 128) { continue } v.reset(OpAMD64BTRQconst) - v.AuxInt = log2(^c) + v.AuxInt = int8ToAuxInt(int8(log2(^c))) v.AddArg(x) return true } @@ -3102,19 +3098,19 @@ func rewriteValueAMD64_OpAMD64ANDQ(v *Value) bool { } // match: (ANDQ x (MOVQconst [c])) // cond: is32Bit(c) - // result: (ANDQconst [c] x) + // result: (ANDQconst [int32(c)] x) for { for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { x := v_0 if v_1.Op != OpAMD64MOVQconst { continue } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) if !(is32Bit(c)) { continue } v.reset(OpAMD64ANDQconst) - v.AuxInt = c + v.AuxInt = int32ToAuxInt(int32(c)) v.AddArg(x) return true } @@ -3160,16 +3156,16 @@ func rewriteValueAMD64_OpAMD64ANDQ(v *Value) bool { func rewriteValueAMD64_OpAMD64ANDQconst(v *Value) bool { v_0 := v.Args[0] // match: (ANDQconst [c] x) - // cond: isUint64PowerOfTwo(^c) && uint64(^c) >= 128 - // result: (BTRQconst [log2(^c)] x) + // cond: isUint64PowerOfTwo(int64(^c)) && uint64(^c) >= 128 + // result: (BTRQconst [int8(log32(^c))] x) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) x := v_0 - if !(isUint64PowerOfTwo(^c) && uint64(^c) >= 128) { + if !(isUint64PowerOfTwo(int64(^c)) && uint64(^c) >= 128) { break } v.reset(OpAMD64BTRQconst) - v.AuxInt = log2(^c) + v.AuxInt = int8ToAuxInt(int8(log32(^c))) v.AddArg(x) return true } @@ -3208,7 +3204,7 @@ func rewriteValueAMD64_OpAMD64ANDQconst(v *Value) bool { // match: (ANDQconst [ 0xFF] x) // result: (MOVBQZX x) for { - if v.AuxInt != 0xFF { + if auxIntToInt32(v.AuxInt) != 0xFF { break } x := v_0 @@ -3219,7 +3215,7 @@ func rewriteValueAMD64_OpAMD64ANDQconst(v *Value) bool { // match: (ANDQconst [0xFFFF] x) // result: (MOVWQZX x) for { - if v.AuxInt != 0xFFFF { + if auxIntToInt32(v.AuxInt) != 0xFFFF { break } x := v_0 @@ -3227,17 +3223,6 @@ func rewriteValueAMD64_OpAMD64ANDQconst(v *Value) bool { v.AddArg(x) return true } - // match: (ANDQconst [0xFFFFFFFF] x) - // result: (MOVLQZX x) - for { - if v.AuxInt != 0xFFFFFFFF { - break - } - x := v_0 - v.reset(OpAMD64MOVLQZX) - v.AddArg(x) - return true - } // match: (ANDQconst [0] _) // result: (MOVQconst [0]) for { @@ -3276,23 +3261,23 @@ func rewriteValueAMD64_OpAMD64ANDQconstmodify(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (ANDQconstmodify [valoff1] {sym} (ADDQconst [off2] base) mem) - // cond: ValAndOff(valoff1).canAdd(off2) - // result: (ANDQconstmodify [ValAndOff(valoff1).add(off2)] {sym} base mem) + // cond: ValAndOff(valoff1).canAdd32(off2) + // result: (ANDQconstmodify [ValAndOff(valoff1).addOffset32(off2)] {sym} base mem) for { - valoff1 := v.AuxInt - sym := v.Aux + valoff1 := auxIntToValAndOff(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] mem := v_1 - if !(ValAndOff(valoff1).canAdd(off2)) { + if !(ValAndOff(valoff1).canAdd32(off2)) { break } v.reset(OpAMD64ANDQconstmodify) - v.AuxInt = ValAndOff(valoff1).add(off2) - v.Aux = sym + v.AuxInt = valAndOffToAuxInt(ValAndOff(valoff1).addOffset32(off2)) + v.Aux = symToAux(sym) v.AddArg2(base, mem) return true } @@ -3327,24 +3312,24 @@ func rewriteValueAMD64_OpAMD64ANDQload(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (ANDQload [off1] {sym} val (ADDQconst [off2] base) mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (ANDQload [off1+off2] {sym} val base mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) val := v_0 if v_1.Op != OpAMD64ADDQconst { break } - off2 := v_1.AuxInt + off2 := auxIntToInt32(v_1.AuxInt) base := v_1.Args[0] mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64ANDQload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(val, base, mem) return true } @@ -3398,24 +3383,24 @@ func rewriteValueAMD64_OpAMD64ANDQmodify(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (ANDQmodify [off1] {sym} (ADDQconst [off2] base) val mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (ANDQmodify [off1+off2] {sym} base val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64ANDQmodify) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(base, val, mem) return true } @@ -3541,23 +3526,23 @@ func rewriteValueAMD64_OpAMD64BTCLconstmodify(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (BTCLconstmodify [valoff1] {sym} (ADDQconst [off2] base) mem) - // cond: ValAndOff(valoff1).canAdd(off2) - // result: (BTCLconstmodify [ValAndOff(valoff1).add(off2)] {sym} base mem) + // cond: ValAndOff(valoff1).canAdd32(off2) + // result: (BTCLconstmodify [ValAndOff(valoff1).addOffset32(off2)] {sym} base mem) for { - valoff1 := v.AuxInt - sym := v.Aux + valoff1 := auxIntToValAndOff(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] mem := v_1 - if !(ValAndOff(valoff1).canAdd(off2)) { + if !(ValAndOff(valoff1).canAdd32(off2)) { break } v.reset(OpAMD64BTCLconstmodify) - v.AuxInt = ValAndOff(valoff1).add(off2) - v.Aux = sym + v.AuxInt = valAndOffToAuxInt(ValAndOff(valoff1).addOffset32(off2)) + v.Aux = symToAux(sym) v.AddArg2(base, mem) return true } @@ -3590,24 +3575,24 @@ func rewriteValueAMD64_OpAMD64BTCLmodify(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (BTCLmodify [off1] {sym} (ADDQconst [off2] base) val mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (BTCLmodify [off1+off2] {sym} base val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64BTCLmodify) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(base, val, mem) return true } @@ -3692,23 +3677,23 @@ func rewriteValueAMD64_OpAMD64BTCQconstmodify(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (BTCQconstmodify [valoff1] {sym} (ADDQconst [off2] base) mem) - // cond: ValAndOff(valoff1).canAdd(off2) - // result: (BTCQconstmodify [ValAndOff(valoff1).add(off2)] {sym} base mem) + // cond: ValAndOff(valoff1).canAdd32(off2) + // result: (BTCQconstmodify [ValAndOff(valoff1).addOffset32(off2)] {sym} base mem) for { - valoff1 := v.AuxInt - sym := v.Aux + valoff1 := auxIntToValAndOff(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] mem := v_1 - if !(ValAndOff(valoff1).canAdd(off2)) { + if !(ValAndOff(valoff1).canAdd32(off2)) { break } v.reset(OpAMD64BTCQconstmodify) - v.AuxInt = ValAndOff(valoff1).add(off2) - v.Aux = sym + v.AuxInt = valAndOffToAuxInt(ValAndOff(valoff1).addOffset32(off2)) + v.Aux = symToAux(sym) v.AddArg2(base, mem) return true } @@ -3741,24 +3726,24 @@ func rewriteValueAMD64_OpAMD64BTCQmodify(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (BTCQmodify [off1] {sym} (ADDQconst [off2] base) val mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (BTCQmodify [off1+off2] {sym} base val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64BTCQmodify) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(base, val, mem) return true } @@ -3793,17 +3778,17 @@ func rewriteValueAMD64_OpAMD64BTLconst(v *Value) bool { // cond: (c+d)<64 // result: (BTQconst [c+d] x) for { - c := v.AuxInt + c := auxIntToInt8(v.AuxInt) if v_0.Op != OpAMD64SHRQconst { break } - d := v_0.AuxInt + d := auxIntToInt8(v_0.AuxInt) x := v_0.Args[0] if !((c + d) < 64) { break } v.reset(OpAMD64BTQconst) - v.AuxInt = c + d + v.AuxInt = int8ToAuxInt(c + d) v.AddArg(x) return true } @@ -3811,24 +3796,24 @@ func rewriteValueAMD64_OpAMD64BTLconst(v *Value) bool { // cond: c>d // result: (BTLconst [c-d] x) for { - c := v.AuxInt + c := auxIntToInt8(v.AuxInt) if v_0.Op != OpAMD64SHLQconst { break } - d := v_0.AuxInt + d := auxIntToInt8(v_0.AuxInt) x := v_0.Args[0] if !(c > d) { break } v.reset(OpAMD64BTLconst) - v.AuxInt = c - d + v.AuxInt = int8ToAuxInt(c - d) v.AddArg(x) return true } // match: (BTLconst [0] s:(SHRQ x y)) // result: (BTQ y x) for { - if v.AuxInt != 0 { + if auxIntToInt8(v.AuxInt) != 0 { break } s := v_0 @@ -3845,17 +3830,17 @@ func rewriteValueAMD64_OpAMD64BTLconst(v *Value) bool { // cond: (c+d)<32 // result: (BTLconst [c+d] x) for { - c := v.AuxInt + c := auxIntToInt8(v.AuxInt) if v_0.Op != OpAMD64SHRLconst { break } - d := v_0.AuxInt + d := auxIntToInt8(v_0.AuxInt) x := v_0.Args[0] if !((c + d) < 32) { break } v.reset(OpAMD64BTLconst) - v.AuxInt = c + d + v.AuxInt = int8ToAuxInt(c + d) v.AddArg(x) return true } @@ -3863,24 +3848,24 @@ func rewriteValueAMD64_OpAMD64BTLconst(v *Value) bool { // cond: c>d // result: (BTLconst [c-d] x) for { - c := v.AuxInt + c := auxIntToInt8(v.AuxInt) if v_0.Op != OpAMD64SHLLconst { break } - d := v_0.AuxInt + d := auxIntToInt8(v_0.AuxInt) x := v_0.Args[0] if !(c > d) { break } v.reset(OpAMD64BTLconst) - v.AuxInt = c - d + v.AuxInt = int8ToAuxInt(c - d) v.AddArg(x) return true } // match: (BTLconst [0] s:(SHRL x y)) // result: (BTL y x) for { - if v.AuxInt != 0 { + if auxIntToInt8(v.AuxInt) != 0 { break } s := v_0 @@ -3901,17 +3886,17 @@ func rewriteValueAMD64_OpAMD64BTQconst(v *Value) bool { // cond: (c+d)<64 // result: (BTQconst [c+d] x) for { - c := v.AuxInt + c := auxIntToInt8(v.AuxInt) if v_0.Op != OpAMD64SHRQconst { break } - d := v_0.AuxInt + d := auxIntToInt8(v_0.AuxInt) x := v_0.Args[0] if !((c + d) < 64) { break } v.reset(OpAMD64BTQconst) - v.AuxInt = c + d + v.AuxInt = int8ToAuxInt(c + d) v.AddArg(x) return true } @@ -3919,24 +3904,24 @@ func rewriteValueAMD64_OpAMD64BTQconst(v *Value) bool { // cond: c>d // result: (BTQconst [c-d] x) for { - c := v.AuxInt + c := auxIntToInt8(v.AuxInt) if v_0.Op != OpAMD64SHLQconst { break } - d := v_0.AuxInt + d := auxIntToInt8(v_0.AuxInt) x := v_0.Args[0] if !(c > d) { break } v.reset(OpAMD64BTQconst) - v.AuxInt = c - d + v.AuxInt = int8ToAuxInt(c - d) v.AddArg(x) return true } // match: (BTQconst [0] s:(SHRQ x y)) // result: (BTQ y x) for { - if v.AuxInt != 0 { + if auxIntToInt8(v.AuxInt) != 0 { break } s := v_0 @@ -3956,26 +3941,26 @@ func rewriteValueAMD64_OpAMD64BTRLconst(v *Value) bool { // match: (BTRLconst [c] (BTSLconst [c] x)) // result: (BTRLconst [c] x) for { - c := v.AuxInt - if v_0.Op != OpAMD64BTSLconst || v_0.AuxInt != c { + c := auxIntToInt8(v.AuxInt) + if v_0.Op != OpAMD64BTSLconst || auxIntToInt8(v_0.AuxInt) != c { break } x := v_0.Args[0] v.reset(OpAMD64BTRLconst) - v.AuxInt = c + v.AuxInt = int8ToAuxInt(c) v.AddArg(x) return true } // match: (BTRLconst [c] (BTCLconst [c] x)) // result: (BTRLconst [c] x) for { - c := v.AuxInt - if v_0.Op != OpAMD64BTCLconst || v_0.AuxInt != c { + c := auxIntToInt8(v.AuxInt) + if v_0.Op != OpAMD64BTCLconst || auxIntToInt8(v_0.AuxInt) != c { break } x := v_0.Args[0] v.reset(OpAMD64BTRLconst) - v.AuxInt = c + v.AuxInt = int8ToAuxInt(c) v.AddArg(x) return true } @@ -4025,23 +4010,23 @@ func rewriteValueAMD64_OpAMD64BTRLconstmodify(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (BTRLconstmodify [valoff1] {sym} (ADDQconst [off2] base) mem) - // cond: ValAndOff(valoff1).canAdd(off2) - // result: (BTRLconstmodify [ValAndOff(valoff1).add(off2)] {sym} base mem) + // cond: ValAndOff(valoff1).canAdd32(off2) + // result: (BTRLconstmodify [ValAndOff(valoff1).addOffset32(off2)] {sym} base mem) for { - valoff1 := v.AuxInt - sym := v.Aux + valoff1 := auxIntToValAndOff(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] mem := v_1 - if !(ValAndOff(valoff1).canAdd(off2)) { + if !(ValAndOff(valoff1).canAdd32(off2)) { break } v.reset(OpAMD64BTRLconstmodify) - v.AuxInt = ValAndOff(valoff1).add(off2) - v.Aux = sym + v.AuxInt = valAndOffToAuxInt(ValAndOff(valoff1).addOffset32(off2)) + v.Aux = symToAux(sym) v.AddArg2(base, mem) return true } @@ -4074,24 +4059,24 @@ func rewriteValueAMD64_OpAMD64BTRLmodify(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (BTRLmodify [off1] {sym} (ADDQconst [off2] base) val mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (BTRLmodify [off1+off2] {sym} base val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64BTRLmodify) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(base, val, mem) return true } @@ -4125,26 +4110,26 @@ func rewriteValueAMD64_OpAMD64BTRQconst(v *Value) bool { // match: (BTRQconst [c] (BTSQconst [c] x)) // result: (BTRQconst [c] x) for { - c := v.AuxInt - if v_0.Op != OpAMD64BTSQconst || v_0.AuxInt != c { + c := auxIntToInt8(v.AuxInt) + if v_0.Op != OpAMD64BTSQconst || auxIntToInt8(v_0.AuxInt) != c { break } x := v_0.Args[0] v.reset(OpAMD64BTRQconst) - v.AuxInt = c + v.AuxInt = int8ToAuxInt(c) v.AddArg(x) return true } // match: (BTRQconst [c] (BTCQconst [c] x)) // result: (BTRQconst [c] x) for { - c := v.AuxInt - if v_0.Op != OpAMD64BTCQconst || v_0.AuxInt != c { + c := auxIntToInt8(v.AuxInt) + if v_0.Op != OpAMD64BTCQconst || auxIntToInt8(v_0.AuxInt) != c { break } x := v_0.Args[0] v.reset(OpAMD64BTRQconst) - v.AuxInt = c + v.AuxInt = int8ToAuxInt(c) v.AddArg(x) return true } @@ -4202,23 +4187,23 @@ func rewriteValueAMD64_OpAMD64BTRQconstmodify(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (BTRQconstmodify [valoff1] {sym} (ADDQconst [off2] base) mem) - // cond: ValAndOff(valoff1).canAdd(off2) - // result: (BTRQconstmodify [ValAndOff(valoff1).add(off2)] {sym} base mem) + // cond: ValAndOff(valoff1).canAdd32(off2) + // result: (BTRQconstmodify [ValAndOff(valoff1).addOffset32(off2)] {sym} base mem) for { - valoff1 := v.AuxInt - sym := v.Aux + valoff1 := auxIntToValAndOff(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] mem := v_1 - if !(ValAndOff(valoff1).canAdd(off2)) { + if !(ValAndOff(valoff1).canAdd32(off2)) { break } v.reset(OpAMD64BTRQconstmodify) - v.AuxInt = ValAndOff(valoff1).add(off2) - v.Aux = sym + v.AuxInt = valAndOffToAuxInt(ValAndOff(valoff1).addOffset32(off2)) + v.Aux = symToAux(sym) v.AddArg2(base, mem) return true } @@ -4251,24 +4236,24 @@ func rewriteValueAMD64_OpAMD64BTRQmodify(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (BTRQmodify [off1] {sym} (ADDQconst [off2] base) val mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (BTRQmodify [off1+off2] {sym} base val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64BTRQmodify) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(base, val, mem) return true } @@ -4302,26 +4287,26 @@ func rewriteValueAMD64_OpAMD64BTSLconst(v *Value) bool { // match: (BTSLconst [c] (BTRLconst [c] x)) // result: (BTSLconst [c] x) for { - c := v.AuxInt - if v_0.Op != OpAMD64BTRLconst || v_0.AuxInt != c { + c := auxIntToInt8(v.AuxInt) + if v_0.Op != OpAMD64BTRLconst || auxIntToInt8(v_0.AuxInt) != c { break } x := v_0.Args[0] v.reset(OpAMD64BTSLconst) - v.AuxInt = c + v.AuxInt = int8ToAuxInt(c) v.AddArg(x) return true } // match: (BTSLconst [c] (BTCLconst [c] x)) // result: (BTSLconst [c] x) for { - c := v.AuxInt - if v_0.Op != OpAMD64BTCLconst || v_0.AuxInt != c { + c := auxIntToInt8(v.AuxInt) + if v_0.Op != OpAMD64BTCLconst || auxIntToInt8(v_0.AuxInt) != c { break } x := v_0.Args[0] v.reset(OpAMD64BTSLconst) - v.AuxInt = c + v.AuxInt = int8ToAuxInt(c) v.AddArg(x) return true } @@ -4371,23 +4356,23 @@ func rewriteValueAMD64_OpAMD64BTSLconstmodify(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (BTSLconstmodify [valoff1] {sym} (ADDQconst [off2] base) mem) - // cond: ValAndOff(valoff1).canAdd(off2) - // result: (BTSLconstmodify [ValAndOff(valoff1).add(off2)] {sym} base mem) + // cond: ValAndOff(valoff1).canAdd32(off2) + // result: (BTSLconstmodify [ValAndOff(valoff1).addOffset32(off2)] {sym} base mem) for { - valoff1 := v.AuxInt - sym := v.Aux + valoff1 := auxIntToValAndOff(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] mem := v_1 - if !(ValAndOff(valoff1).canAdd(off2)) { + if !(ValAndOff(valoff1).canAdd32(off2)) { break } v.reset(OpAMD64BTSLconstmodify) - v.AuxInt = ValAndOff(valoff1).add(off2) - v.Aux = sym + v.AuxInt = valAndOffToAuxInt(ValAndOff(valoff1).addOffset32(off2)) + v.Aux = symToAux(sym) v.AddArg2(base, mem) return true } @@ -4420,24 +4405,24 @@ func rewriteValueAMD64_OpAMD64BTSLmodify(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (BTSLmodify [off1] {sym} (ADDQconst [off2] base) val mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (BTSLmodify [off1+off2] {sym} base val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64BTSLmodify) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(base, val, mem) return true } @@ -4471,26 +4456,26 @@ func rewriteValueAMD64_OpAMD64BTSQconst(v *Value) bool { // match: (BTSQconst [c] (BTRQconst [c] x)) // result: (BTSQconst [c] x) for { - c := v.AuxInt - if v_0.Op != OpAMD64BTRQconst || v_0.AuxInt != c { + c := auxIntToInt8(v.AuxInt) + if v_0.Op != OpAMD64BTRQconst || auxIntToInt8(v_0.AuxInt) != c { break } x := v_0.Args[0] v.reset(OpAMD64BTSQconst) - v.AuxInt = c + v.AuxInt = int8ToAuxInt(c) v.AddArg(x) return true } // match: (BTSQconst [c] (BTCQconst [c] x)) // result: (BTSQconst [c] x) for { - c := v.AuxInt - if v_0.Op != OpAMD64BTCQconst || v_0.AuxInt != c { + c := auxIntToInt8(v.AuxInt) + if v_0.Op != OpAMD64BTCQconst || auxIntToInt8(v_0.AuxInt) != c { break } x := v_0.Args[0] v.reset(OpAMD64BTSQconst) - v.AuxInt = c + v.AuxInt = int8ToAuxInt(c) v.AddArg(x) return true } @@ -4548,23 +4533,23 @@ func rewriteValueAMD64_OpAMD64BTSQconstmodify(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (BTSQconstmodify [valoff1] {sym} (ADDQconst [off2] base) mem) - // cond: ValAndOff(valoff1).canAdd(off2) - // result: (BTSQconstmodify [ValAndOff(valoff1).add(off2)] {sym} base mem) + // cond: ValAndOff(valoff1).canAdd32(off2) + // result: (BTSQconstmodify [ValAndOff(valoff1).addOffset32(off2)] {sym} base mem) for { - valoff1 := v.AuxInt - sym := v.Aux + valoff1 := auxIntToValAndOff(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] mem := v_1 - if !(ValAndOff(valoff1).canAdd(off2)) { + if !(ValAndOff(valoff1).canAdd32(off2)) { break } v.reset(OpAMD64BTSQconstmodify) - v.AuxInt = ValAndOff(valoff1).add(off2) - v.Aux = sym + v.AuxInt = valAndOffToAuxInt(ValAndOff(valoff1).addOffset32(off2)) + v.Aux = symToAux(sym) v.AddArg2(base, mem) return true } @@ -4597,24 +4582,24 @@ func rewriteValueAMD64_OpAMD64BTSQmodify(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (BTSQmodify [off1] {sym} (ADDQconst [off2] base) val mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (BTSQmodify [off1+off2] {sym} base val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64BTSQmodify) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(base, val, mem) return true } @@ -6741,29 +6726,29 @@ func rewriteValueAMD64_OpAMD64CMPB(v *Value) bool { v_0 := v.Args[0] b := v.Block // match: (CMPB x (MOVLconst [c])) - // result: (CMPBconst x [int64(int8(c))]) + // result: (CMPBconst x [int8(c)]) for { x := v_0 if v_1.Op != OpAMD64MOVLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) v.reset(OpAMD64CMPBconst) - v.AuxInt = int64(int8(c)) + v.AuxInt = int8ToAuxInt(int8(c)) v.AddArg(x) return true } // match: (CMPB (MOVLconst [c]) x) - // result: (InvertFlags (CMPBconst x [int64(int8(c))])) + // result: (InvertFlags (CMPBconst x [int8(c)])) for { if v_0.Op != OpAMD64MOVLconst { break } - c := v_0.AuxInt + c := auxIntToInt32(v_0.AuxInt) x := v_1 v.reset(OpAMD64InvertFlags) v0 := b.NewValue0(v.Pos, OpAMD64CMPBconst, types.TypeFlags) - v0.AuxInt = int64(int8(c)) + v0.AuxInt = int8ToAuxInt(int8(c)) v0.AddArg(x) v.AddArg(v0) return true @@ -7006,23 +6991,23 @@ func rewriteValueAMD64_OpAMD64CMPBconstload(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (CMPBconstload [valoff1] {sym} (ADDQconst [off2] base) mem) - // cond: ValAndOff(valoff1).canAdd(off2) - // result: (CMPBconstload [ValAndOff(valoff1).add(off2)] {sym} base mem) + // cond: ValAndOff(valoff1).canAdd32(off2) + // result: (CMPBconstload [ValAndOff(valoff1).addOffset32(off2)] {sym} base mem) for { - valoff1 := v.AuxInt - sym := v.Aux + valoff1 := auxIntToValAndOff(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] mem := v_1 - if !(ValAndOff(valoff1).canAdd(off2)) { + if !(ValAndOff(valoff1).canAdd32(off2)) { break } v.reset(OpAMD64CMPBconstload) - v.AuxInt = ValAndOff(valoff1).add(off2) - v.Aux = sym + v.AuxInt = valAndOffToAuxInt(ValAndOff(valoff1).addOffset32(off2)) + v.Aux = symToAux(sym) v.AddArg2(base, mem) return true } @@ -7055,24 +7040,24 @@ func rewriteValueAMD64_OpAMD64CMPBload(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (CMPBload [off1] {sym} (ADDQconst [off2] base) val mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (CMPBload [off1+off2] {sym} base val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64CMPBload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(base, val, mem) return true } @@ -7133,9 +7118,9 @@ func rewriteValueAMD64_OpAMD64CMPL(v *Value) bool { if v_1.Op != OpAMD64MOVLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) v.reset(OpAMD64CMPLconst) - v.AuxInt = c + v.AuxInt = int32ToAuxInt(c) v.AddArg(x) return true } @@ -7145,11 +7130,11 @@ func rewriteValueAMD64_OpAMD64CMPL(v *Value) bool { if v_0.Op != OpAMD64MOVLconst { break } - c := v_0.AuxInt + c := auxIntToInt32(v_0.AuxInt) x := v_1 v.reset(OpAMD64InvertFlags) v0 := b.NewValue0(v.Pos, OpAMD64CMPLconst, types.TypeFlags) - v0.AuxInt = c + v0.AuxInt = int32ToAuxInt(c) v0.AddArg(x) v.AddArg(v0) return true @@ -7407,23 +7392,23 @@ func rewriteValueAMD64_OpAMD64CMPLconstload(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (CMPLconstload [valoff1] {sym} (ADDQconst [off2] base) mem) - // cond: ValAndOff(valoff1).canAdd(off2) - // result: (CMPLconstload [ValAndOff(valoff1).add(off2)] {sym} base mem) + // cond: ValAndOff(valoff1).canAdd32(off2) + // result: (CMPLconstload [ValAndOff(valoff1).addOffset32(off2)] {sym} base mem) for { - valoff1 := v.AuxInt - sym := v.Aux + valoff1 := auxIntToValAndOff(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] mem := v_1 - if !(ValAndOff(valoff1).canAdd(off2)) { + if !(ValAndOff(valoff1).canAdd32(off2)) { break } v.reset(OpAMD64CMPLconstload) - v.AuxInt = ValAndOff(valoff1).add(off2) - v.Aux = sym + v.AuxInt = valAndOffToAuxInt(ValAndOff(valoff1).addOffset32(off2)) + v.Aux = symToAux(sym) v.AddArg2(base, mem) return true } @@ -7456,24 +7441,24 @@ func rewriteValueAMD64_OpAMD64CMPLload(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (CMPLload [off1] {sym} (ADDQconst [off2] base) val mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (CMPLload [off1+off2] {sym} base val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64CMPLload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(base, val, mem) return true } @@ -7529,36 +7514,36 @@ func rewriteValueAMD64_OpAMD64CMPQ(v *Value) bool { b := v.Block // match: (CMPQ x (MOVQconst [c])) // cond: is32Bit(c) - // result: (CMPQconst x [c]) + // result: (CMPQconst x [int32(c)]) for { x := v_0 if v_1.Op != OpAMD64MOVQconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) if !(is32Bit(c)) { break } v.reset(OpAMD64CMPQconst) - v.AuxInt = c + v.AuxInt = int32ToAuxInt(int32(c)) v.AddArg(x) return true } // match: (CMPQ (MOVQconst [c]) x) // cond: is32Bit(c) - // result: (InvertFlags (CMPQconst x [c])) + // result: (InvertFlags (CMPQconst x [int32(c)])) for { if v_0.Op != OpAMD64MOVQconst { break } - c := v_0.AuxInt + c := auxIntToInt64(v_0.AuxInt) x := v_1 if !(is32Bit(c)) { break } v.reset(OpAMD64InvertFlags) v0 := b.NewValue0(v.Pos, OpAMD64CMPQconst, types.TypeFlags) - v0.AuxInt = c + v0.AuxInt = int32ToAuxInt(int32(c)) v0.AddArg(x) v.AddArg(v0) return true @@ -7722,15 +7707,15 @@ func rewriteValueAMD64_OpAMD64CMPQconst(v *Value) bool { // match: (CMPQconst (NEGQ (ADDQconst [-16] (ANDQconst [15] _))) [32]) // result: (FlagLT_ULT) for { - if v.AuxInt != 32 || v_0.Op != OpAMD64NEGQ { + if auxIntToInt32(v.AuxInt) != 32 || v_0.Op != OpAMD64NEGQ { break } v_0_0 := v_0.Args[0] - if v_0_0.Op != OpAMD64ADDQconst || v_0_0.AuxInt != -16 { + if v_0_0.Op != OpAMD64ADDQconst || auxIntToInt32(v_0_0.AuxInt) != -16 { break } v_0_0_0 := v_0_0.Args[0] - if v_0_0_0.Op != OpAMD64ANDQconst || v_0_0_0.AuxInt != 15 { + if v_0_0_0.Op != OpAMD64ANDQconst || auxIntToInt32(v_0_0_0.AuxInt) != 15 { break } v.reset(OpAMD64FlagLT_ULT) @@ -7739,15 +7724,15 @@ func rewriteValueAMD64_OpAMD64CMPQconst(v *Value) bool { // match: (CMPQconst (NEGQ (ADDQconst [ -8] (ANDQconst [7] _))) [32]) // result: (FlagLT_ULT) for { - if v.AuxInt != 32 || v_0.Op != OpAMD64NEGQ { + if auxIntToInt32(v.AuxInt) != 32 || v_0.Op != OpAMD64NEGQ { break } v_0_0 := v_0.Args[0] - if v_0_0.Op != OpAMD64ADDQconst || v_0_0.AuxInt != -8 { + if v_0_0.Op != OpAMD64ADDQconst || auxIntToInt32(v_0_0.AuxInt) != -8 { break } v_0_0_0 := v_0_0.Args[0] - if v_0_0_0.Op != OpAMD64ANDQconst || v_0_0_0.AuxInt != 7 { + if v_0_0_0.Op != OpAMD64ANDQconst || auxIntToInt32(v_0_0_0.AuxInt) != 7 { break } v.reset(OpAMD64FlagLT_ULT) @@ -7988,23 +7973,23 @@ func rewriteValueAMD64_OpAMD64CMPQconstload(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (CMPQconstload [valoff1] {sym} (ADDQconst [off2] base) mem) - // cond: ValAndOff(valoff1).canAdd(off2) - // result: (CMPQconstload [ValAndOff(valoff1).add(off2)] {sym} base mem) + // cond: ValAndOff(valoff1).canAdd32(off2) + // result: (CMPQconstload [ValAndOff(valoff1).addOffset32(off2)] {sym} base mem) for { - valoff1 := v.AuxInt - sym := v.Aux + valoff1 := auxIntToValAndOff(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] mem := v_1 - if !(ValAndOff(valoff1).canAdd(off2)) { + if !(ValAndOff(valoff1).canAdd32(off2)) { break } v.reset(OpAMD64CMPQconstload) - v.AuxInt = ValAndOff(valoff1).add(off2) - v.Aux = sym + v.AuxInt = valAndOffToAuxInt(ValAndOff(valoff1).addOffset32(off2)) + v.Aux = symToAux(sym) v.AddArg2(base, mem) return true } @@ -8037,24 +8022,24 @@ func rewriteValueAMD64_OpAMD64CMPQload(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (CMPQload [off1] {sym} (ADDQconst [off2] base) val mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (CMPQload [off1+off2] {sym} base val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64CMPQload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(base, val, mem) return true } @@ -8109,29 +8094,29 @@ func rewriteValueAMD64_OpAMD64CMPW(v *Value) bool { v_0 := v.Args[0] b := v.Block // match: (CMPW x (MOVLconst [c])) - // result: (CMPWconst x [int64(int16(c))]) + // result: (CMPWconst x [int16(c)]) for { x := v_0 if v_1.Op != OpAMD64MOVLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) v.reset(OpAMD64CMPWconst) - v.AuxInt = int64(int16(c)) + v.AuxInt = int16ToAuxInt(int16(c)) v.AddArg(x) return true } // match: (CMPW (MOVLconst [c]) x) - // result: (InvertFlags (CMPWconst x [int64(int16(c))])) + // result: (InvertFlags (CMPWconst x [int16(c)])) for { if v_0.Op != OpAMD64MOVLconst { break } - c := v_0.AuxInt + c := auxIntToInt32(v_0.AuxInt) x := v_1 v.reset(OpAMD64InvertFlags) v0 := b.NewValue0(v.Pos, OpAMD64CMPWconst, types.TypeFlags) - v0.AuxInt = int64(int16(c)) + v0.AuxInt = int16ToAuxInt(int16(c)) v0.AddArg(x) v.AddArg(v0) return true @@ -8374,23 +8359,23 @@ func rewriteValueAMD64_OpAMD64CMPWconstload(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (CMPWconstload [valoff1] {sym} (ADDQconst [off2] base) mem) - // cond: ValAndOff(valoff1).canAdd(off2) - // result: (CMPWconstload [ValAndOff(valoff1).add(off2)] {sym} base mem) + // cond: ValAndOff(valoff1).canAdd32(off2) + // result: (CMPWconstload [ValAndOff(valoff1).addOffset32(off2)] {sym} base mem) for { - valoff1 := v.AuxInt - sym := v.Aux + valoff1 := auxIntToValAndOff(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] mem := v_1 - if !(ValAndOff(valoff1).canAdd(off2)) { + if !(ValAndOff(valoff1).canAdd32(off2)) { break } v.reset(OpAMD64CMPWconstload) - v.AuxInt = ValAndOff(valoff1).add(off2) - v.Aux = sym + v.AuxInt = valAndOffToAuxInt(ValAndOff(valoff1).addOffset32(off2)) + v.Aux = symToAux(sym) v.AddArg2(base, mem) return true } @@ -8423,24 +8408,24 @@ func rewriteValueAMD64_OpAMD64CMPWload(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (CMPWload [off1] {sym} (ADDQconst [off2] base) val mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (CMPWload [off1+off2] {sym} base val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64CMPWload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(base, val, mem) return true } @@ -8582,24 +8567,24 @@ func rewriteValueAMD64_OpAMD64DIVSDload(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (DIVSDload [off1] {sym} val (ADDQconst [off2] base) mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (DIVSDload [off1+off2] {sym} val base mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) val := v_0 if v_1.Op != OpAMD64ADDQconst { break } - off2 := v_1.AuxInt + off2 := auxIntToInt32(v_1.AuxInt) base := v_1.Args[0] mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64DIVSDload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(val, base, mem) return true } @@ -8660,24 +8645,24 @@ func rewriteValueAMD64_OpAMD64DIVSSload(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (DIVSSload [off1] {sym} val (ADDQconst [off2] base) mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (DIVSSload [off1+off2] {sym} val base mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) val := v_0 if v_1.Op != OpAMD64ADDQconst { break } - off2 := v_1.AuxInt + off2 := auxIntToInt32(v_1.AuxInt) base := v_1.Args[0] mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64DIVSSload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(val, base, mem) return true } @@ -8781,22 +8766,22 @@ func rewriteValueAMD64_OpAMD64HMULQU(v *Value) bool { func rewriteValueAMD64_OpAMD64LEAL(v *Value) bool { v_0 := v.Args[0] // match: (LEAL [c] {s} (ADDLconst [d] x)) - // cond: is32Bit(c+d) + // cond: is32Bit(int64(c)+int64(d)) // result: (LEAL [c+d] {s} x) for { - c := v.AuxInt - s := v.Aux + c := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDLconst { break } - d := v_0.AuxInt + d := auxIntToInt32(v_0.AuxInt) x := v_0.Args[0] - if !(is32Bit(c + d)) { + if !(is32Bit(int64(c) + int64(d))) { break } v.reset(OpAMD64LEAL) - v.AuxInt = c + d - v.Aux = s + v.AuxInt = int32ToAuxInt(c + d) + v.Aux = symToAux(s) v.AddArg(x) return true } @@ -8804,8 +8789,8 @@ func rewriteValueAMD64_OpAMD64LEAL(v *Value) bool { // cond: x.Op != OpSB && y.Op != OpSB // result: (LEAL1 [c] {s} x y) for { - c := v.AuxInt - s := v.Aux + c := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDL { break } @@ -8819,8 +8804,8 @@ func rewriteValueAMD64_OpAMD64LEAL(v *Value) bool { continue } v.reset(OpAMD64LEAL1) - v.AuxInt = c - v.Aux = s + v.AuxInt = int32ToAuxInt(c) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } @@ -8832,24 +8817,24 @@ func rewriteValueAMD64_OpAMD64LEAL1(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (LEAL1 [c] {s} (ADDLconst [d] x) y) - // cond: is32Bit(c+d) && x.Op != OpSB + // cond: is32Bit(int64(c)+int64(d)) && x.Op != OpSB // result: (LEAL1 [c+d] {s} x y) for { - c := v.AuxInt - s := v.Aux + c := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { if v_0.Op != OpAMD64ADDLconst { continue } - d := v_0.AuxInt + d := auxIntToInt32(v_0.AuxInt) x := v_0.Args[0] y := v_1 - if !(is32Bit(c+d) && x.Op != OpSB) { + if !(is32Bit(int64(c)+int64(d)) && x.Op != OpSB) { continue } v.reset(OpAMD64LEAL1) - v.AuxInt = c + d - v.Aux = s + v.AuxInt = int32ToAuxInt(c + d) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } @@ -8858,17 +8843,17 @@ func rewriteValueAMD64_OpAMD64LEAL1(v *Value) bool { // match: (LEAL1 [c] {s} x (SHLLconst [1] y)) // result: (LEAL2 [c] {s} x y) for { - c := v.AuxInt - s := v.Aux + c := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { x := v_0 - if v_1.Op != OpAMD64SHLLconst || v_1.AuxInt != 1 { + if v_1.Op != OpAMD64SHLLconst || auxIntToInt8(v_1.AuxInt) != 1 { continue } y := v_1.Args[0] v.reset(OpAMD64LEAL2) - v.AuxInt = c - v.Aux = s + v.AuxInt = int32ToAuxInt(c) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } @@ -8877,17 +8862,17 @@ func rewriteValueAMD64_OpAMD64LEAL1(v *Value) bool { // match: (LEAL1 [c] {s} x (SHLLconst [2] y)) // result: (LEAL4 [c] {s} x y) for { - c := v.AuxInt - s := v.Aux + c := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { x := v_0 - if v_1.Op != OpAMD64SHLLconst || v_1.AuxInt != 2 { + if v_1.Op != OpAMD64SHLLconst || auxIntToInt8(v_1.AuxInt) != 2 { continue } y := v_1.Args[0] v.reset(OpAMD64LEAL4) - v.AuxInt = c - v.Aux = s + v.AuxInt = int32ToAuxInt(c) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } @@ -8896,17 +8881,17 @@ func rewriteValueAMD64_OpAMD64LEAL1(v *Value) bool { // match: (LEAL1 [c] {s} x (SHLLconst [3] y)) // result: (LEAL8 [c] {s} x y) for { - c := v.AuxInt - s := v.Aux + c := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { x := v_0 - if v_1.Op != OpAMD64SHLLconst || v_1.AuxInt != 3 { + if v_1.Op != OpAMD64SHLLconst || auxIntToInt8(v_1.AuxInt) != 3 { continue } y := v_1.Args[0] v.reset(OpAMD64LEAL8) - v.AuxInt = c - v.Aux = s + v.AuxInt = int32ToAuxInt(c) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } @@ -8918,76 +8903,76 @@ func rewriteValueAMD64_OpAMD64LEAL2(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (LEAL2 [c] {s} (ADDLconst [d] x) y) - // cond: is32Bit(c+d) && x.Op != OpSB + // cond: is32Bit(int64(c)+int64(d)) && x.Op != OpSB // result: (LEAL2 [c+d] {s} x y) for { - c := v.AuxInt - s := v.Aux + c := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDLconst { break } - d := v_0.AuxInt + d := auxIntToInt32(v_0.AuxInt) x := v_0.Args[0] y := v_1 - if !(is32Bit(c+d) && x.Op != OpSB) { + if !(is32Bit(int64(c)+int64(d)) && x.Op != OpSB) { break } v.reset(OpAMD64LEAL2) - v.AuxInt = c + d - v.Aux = s + v.AuxInt = int32ToAuxInt(c + d) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } // match: (LEAL2 [c] {s} x (ADDLconst [d] y)) - // cond: is32Bit(c+2*d) && y.Op != OpSB + // cond: is32Bit(int64(c)+2*int64(d)) && y.Op != OpSB // result: (LEAL2 [c+2*d] {s} x y) for { - c := v.AuxInt - s := v.Aux + c := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) x := v_0 if v_1.Op != OpAMD64ADDLconst { break } - d := v_1.AuxInt + d := auxIntToInt32(v_1.AuxInt) y := v_1.Args[0] - if !(is32Bit(c+2*d) && y.Op != OpSB) { + if !(is32Bit(int64(c)+2*int64(d)) && y.Op != OpSB) { break } v.reset(OpAMD64LEAL2) - v.AuxInt = c + 2*d - v.Aux = s + v.AuxInt = int32ToAuxInt(c + 2*d) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } // match: (LEAL2 [c] {s} x (SHLLconst [1] y)) // result: (LEAL4 [c] {s} x y) for { - c := v.AuxInt - s := v.Aux + c := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) x := v_0 - if v_1.Op != OpAMD64SHLLconst || v_1.AuxInt != 1 { + if v_1.Op != OpAMD64SHLLconst || auxIntToInt8(v_1.AuxInt) != 1 { break } y := v_1.Args[0] v.reset(OpAMD64LEAL4) - v.AuxInt = c - v.Aux = s + v.AuxInt = int32ToAuxInt(c) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } // match: (LEAL2 [c] {s} x (SHLLconst [2] y)) // result: (LEAL8 [c] {s} x y) for { - c := v.AuxInt - s := v.Aux + c := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) x := v_0 - if v_1.Op != OpAMD64SHLLconst || v_1.AuxInt != 2 { + if v_1.Op != OpAMD64SHLLconst || auxIntToInt8(v_1.AuxInt) != 2 { break } y := v_1.Args[0] v.reset(OpAMD64LEAL8) - v.AuxInt = c - v.Aux = s + v.AuxInt = int32ToAuxInt(c) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } @@ -8997,60 +8982,60 @@ func rewriteValueAMD64_OpAMD64LEAL4(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (LEAL4 [c] {s} (ADDLconst [d] x) y) - // cond: is32Bit(c+d) && x.Op != OpSB + // cond: is32Bit(int64(c)+int64(d)) && x.Op != OpSB // result: (LEAL4 [c+d] {s} x y) for { - c := v.AuxInt - s := v.Aux + c := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDLconst { break } - d := v_0.AuxInt + d := auxIntToInt32(v_0.AuxInt) x := v_0.Args[0] y := v_1 - if !(is32Bit(c+d) && x.Op != OpSB) { + if !(is32Bit(int64(c)+int64(d)) && x.Op != OpSB) { break } v.reset(OpAMD64LEAL4) - v.AuxInt = c + d - v.Aux = s + v.AuxInt = int32ToAuxInt(c + d) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } // match: (LEAL4 [c] {s} x (ADDLconst [d] y)) - // cond: is32Bit(c+4*d) && y.Op != OpSB + // cond: is32Bit(int64(c)+4*int64(d)) && y.Op != OpSB // result: (LEAL4 [c+4*d] {s} x y) for { - c := v.AuxInt - s := v.Aux + c := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) x := v_0 if v_1.Op != OpAMD64ADDLconst { break } - d := v_1.AuxInt + d := auxIntToInt32(v_1.AuxInt) y := v_1.Args[0] - if !(is32Bit(c+4*d) && y.Op != OpSB) { + if !(is32Bit(int64(c)+4*int64(d)) && y.Op != OpSB) { break } v.reset(OpAMD64LEAL4) - v.AuxInt = c + 4*d - v.Aux = s + v.AuxInt = int32ToAuxInt(c + 4*d) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } // match: (LEAL4 [c] {s} x (SHLLconst [1] y)) // result: (LEAL8 [c] {s} x y) for { - c := v.AuxInt - s := v.Aux + c := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) x := v_0 - if v_1.Op != OpAMD64SHLLconst || v_1.AuxInt != 1 { + if v_1.Op != OpAMD64SHLLconst || auxIntToInt8(v_1.AuxInt) != 1 { break } y := v_1.Args[0] v.reset(OpAMD64LEAL8) - v.AuxInt = c - v.Aux = s + v.AuxInt = int32ToAuxInt(c) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } @@ -9060,44 +9045,44 @@ func rewriteValueAMD64_OpAMD64LEAL8(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (LEAL8 [c] {s} (ADDLconst [d] x) y) - // cond: is32Bit(c+d) && x.Op != OpSB + // cond: is32Bit(int64(c)+int64(d)) && x.Op != OpSB // result: (LEAL8 [c+d] {s} x y) for { - c := v.AuxInt - s := v.Aux + c := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDLconst { break } - d := v_0.AuxInt + d := auxIntToInt32(v_0.AuxInt) x := v_0.Args[0] y := v_1 - if !(is32Bit(c+d) && x.Op != OpSB) { + if !(is32Bit(int64(c)+int64(d)) && x.Op != OpSB) { break } v.reset(OpAMD64LEAL8) - v.AuxInt = c + d - v.Aux = s + v.AuxInt = int32ToAuxInt(c + d) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } // match: (LEAL8 [c] {s} x (ADDLconst [d] y)) - // cond: is32Bit(c+8*d) && y.Op != OpSB + // cond: is32Bit(int64(c)+8*int64(d)) && y.Op != OpSB // result: (LEAL8 [c+8*d] {s} x y) for { - c := v.AuxInt - s := v.Aux + c := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) x := v_0 if v_1.Op != OpAMD64ADDLconst { break } - d := v_1.AuxInt + d := auxIntToInt32(v_1.AuxInt) y := v_1.Args[0] - if !(is32Bit(c+8*d) && y.Op != OpSB) { + if !(is32Bit(int64(c)+8*int64(d)) && y.Op != OpSB) { break } v.reset(OpAMD64LEAL8) - v.AuxInt = c + 8*d - v.Aux = s + v.AuxInt = int32ToAuxInt(c + 8*d) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } @@ -9106,22 +9091,22 @@ func rewriteValueAMD64_OpAMD64LEAL8(v *Value) bool { func rewriteValueAMD64_OpAMD64LEAQ(v *Value) bool { v_0 := v.Args[0] // match: (LEAQ [c] {s} (ADDQconst [d] x)) - // cond: is32Bit(c+d) + // cond: is32Bit(int64(c)+int64(d)) // result: (LEAQ [c+d] {s} x) for { - c := v.AuxInt - s := v.Aux + c := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - d := v_0.AuxInt + d := auxIntToInt32(v_0.AuxInt) x := v_0.Args[0] - if !(is32Bit(c + d)) { + if !(is32Bit(int64(c) + int64(d))) { break } v.reset(OpAMD64LEAQ) - v.AuxInt = c + d - v.Aux = s + v.AuxInt = int32ToAuxInt(c + d) + v.Aux = symToAux(s) v.AddArg(x) return true } @@ -9129,8 +9114,8 @@ func rewriteValueAMD64_OpAMD64LEAQ(v *Value) bool { // cond: x.Op != OpSB && y.Op != OpSB // result: (LEAQ1 [c] {s} x y) for { - c := v.AuxInt - s := v.Aux + c := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQ { break } @@ -9144,8 +9129,8 @@ func rewriteValueAMD64_OpAMD64LEAQ(v *Value) bool { continue } v.reset(OpAMD64LEAQ1) - v.AuxInt = c - v.Aux = s + v.AuxInt = int32ToAuxInt(c) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } @@ -9266,24 +9251,24 @@ func rewriteValueAMD64_OpAMD64LEAQ1(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (LEAQ1 [c] {s} (ADDQconst [d] x) y) - // cond: is32Bit(c+d) && x.Op != OpSB + // cond: is32Bit(int64(c)+int64(d)) && x.Op != OpSB // result: (LEAQ1 [c+d] {s} x y) for { - c := v.AuxInt - s := v.Aux + c := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { if v_0.Op != OpAMD64ADDQconst { continue } - d := v_0.AuxInt + d := auxIntToInt32(v_0.AuxInt) x := v_0.Args[0] y := v_1 - if !(is32Bit(c+d) && x.Op != OpSB) { + if !(is32Bit(int64(c)+int64(d)) && x.Op != OpSB) { continue } v.reset(OpAMD64LEAQ1) - v.AuxInt = c + d - v.Aux = s + v.AuxInt = int32ToAuxInt(c + d) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } @@ -9292,17 +9277,17 @@ func rewriteValueAMD64_OpAMD64LEAQ1(v *Value) bool { // match: (LEAQ1 [c] {s} x (SHLQconst [1] y)) // result: (LEAQ2 [c] {s} x y) for { - c := v.AuxInt - s := v.Aux + c := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { x := v_0 - if v_1.Op != OpAMD64SHLQconst || v_1.AuxInt != 1 { + if v_1.Op != OpAMD64SHLQconst || auxIntToInt8(v_1.AuxInt) != 1 { continue } y := v_1.Args[0] v.reset(OpAMD64LEAQ2) - v.AuxInt = c - v.Aux = s + v.AuxInt = int32ToAuxInt(c) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } @@ -9311,17 +9296,17 @@ func rewriteValueAMD64_OpAMD64LEAQ1(v *Value) bool { // match: (LEAQ1 [c] {s} x (SHLQconst [2] y)) // result: (LEAQ4 [c] {s} x y) for { - c := v.AuxInt - s := v.Aux + c := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { x := v_0 - if v_1.Op != OpAMD64SHLQconst || v_1.AuxInt != 2 { + if v_1.Op != OpAMD64SHLQconst || auxIntToInt8(v_1.AuxInt) != 2 { continue } y := v_1.Args[0] v.reset(OpAMD64LEAQ4) - v.AuxInt = c - v.Aux = s + v.AuxInt = int32ToAuxInt(c) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } @@ -9330,17 +9315,17 @@ func rewriteValueAMD64_OpAMD64LEAQ1(v *Value) bool { // match: (LEAQ1 [c] {s} x (SHLQconst [3] y)) // result: (LEAQ8 [c] {s} x y) for { - c := v.AuxInt - s := v.Aux + c := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { x := v_0 - if v_1.Op != OpAMD64SHLQconst || v_1.AuxInt != 3 { + if v_1.Op != OpAMD64SHLQconst || auxIntToInt8(v_1.AuxInt) != 3 { continue } y := v_1.Args[0] v.reset(OpAMD64LEAQ8) - v.AuxInt = c - v.Aux = s + v.AuxInt = int32ToAuxInt(c) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } @@ -9451,76 +9436,76 @@ func rewriteValueAMD64_OpAMD64LEAQ2(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (LEAQ2 [c] {s} (ADDQconst [d] x) y) - // cond: is32Bit(c+d) && x.Op != OpSB + // cond: is32Bit(int64(c)+int64(d)) && x.Op != OpSB // result: (LEAQ2 [c+d] {s} x y) for { - c := v.AuxInt - s := v.Aux + c := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - d := v_0.AuxInt + d := auxIntToInt32(v_0.AuxInt) x := v_0.Args[0] y := v_1 - if !(is32Bit(c+d) && x.Op != OpSB) { + if !(is32Bit(int64(c)+int64(d)) && x.Op != OpSB) { break } v.reset(OpAMD64LEAQ2) - v.AuxInt = c + d - v.Aux = s + v.AuxInt = int32ToAuxInt(c + d) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } // match: (LEAQ2 [c] {s} x (ADDQconst [d] y)) - // cond: is32Bit(c+2*d) && y.Op != OpSB + // cond: is32Bit(int64(c)+2*int64(d)) && y.Op != OpSB // result: (LEAQ2 [c+2*d] {s} x y) for { - c := v.AuxInt - s := v.Aux + c := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) x := v_0 if v_1.Op != OpAMD64ADDQconst { break } - d := v_1.AuxInt + d := auxIntToInt32(v_1.AuxInt) y := v_1.Args[0] - if !(is32Bit(c+2*d) && y.Op != OpSB) { + if !(is32Bit(int64(c)+2*int64(d)) && y.Op != OpSB) { break } v.reset(OpAMD64LEAQ2) - v.AuxInt = c + 2*d - v.Aux = s + v.AuxInt = int32ToAuxInt(c + 2*d) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } // match: (LEAQ2 [c] {s} x (SHLQconst [1] y)) // result: (LEAQ4 [c] {s} x y) for { - c := v.AuxInt - s := v.Aux + c := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) x := v_0 - if v_1.Op != OpAMD64SHLQconst || v_1.AuxInt != 1 { + if v_1.Op != OpAMD64SHLQconst || auxIntToInt8(v_1.AuxInt) != 1 { break } y := v_1.Args[0] v.reset(OpAMD64LEAQ4) - v.AuxInt = c - v.Aux = s + v.AuxInt = int32ToAuxInt(c) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } // match: (LEAQ2 [c] {s} x (SHLQconst [2] y)) // result: (LEAQ8 [c] {s} x y) for { - c := v.AuxInt - s := v.Aux + c := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) x := v_0 - if v_1.Op != OpAMD64SHLQconst || v_1.AuxInt != 2 { + if v_1.Op != OpAMD64SHLQconst || auxIntToInt8(v_1.AuxInt) != 2 { break } y := v_1.Args[0] v.reset(OpAMD64LEAQ8) - v.AuxInt = c - v.Aux = s + v.AuxInt = int32ToAuxInt(c) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } @@ -9614,60 +9599,60 @@ func rewriteValueAMD64_OpAMD64LEAQ4(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (LEAQ4 [c] {s} (ADDQconst [d] x) y) - // cond: is32Bit(c+d) && x.Op != OpSB + // cond: is32Bit(int64(c)+int64(d)) && x.Op != OpSB // result: (LEAQ4 [c+d] {s} x y) for { - c := v.AuxInt - s := v.Aux + c := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - d := v_0.AuxInt + d := auxIntToInt32(v_0.AuxInt) x := v_0.Args[0] y := v_1 - if !(is32Bit(c+d) && x.Op != OpSB) { + if !(is32Bit(int64(c)+int64(d)) && x.Op != OpSB) { break } v.reset(OpAMD64LEAQ4) - v.AuxInt = c + d - v.Aux = s + v.AuxInt = int32ToAuxInt(c + d) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } // match: (LEAQ4 [c] {s} x (ADDQconst [d] y)) - // cond: is32Bit(c+4*d) && y.Op != OpSB + // cond: is32Bit(int64(c)+4*int64(d)) && y.Op != OpSB // result: (LEAQ4 [c+4*d] {s} x y) for { - c := v.AuxInt - s := v.Aux + c := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) x := v_0 if v_1.Op != OpAMD64ADDQconst { break } - d := v_1.AuxInt + d := auxIntToInt32(v_1.AuxInt) y := v_1.Args[0] - if !(is32Bit(c+4*d) && y.Op != OpSB) { + if !(is32Bit(int64(c)+4*int64(d)) && y.Op != OpSB) { break } v.reset(OpAMD64LEAQ4) - v.AuxInt = c + 4*d - v.Aux = s + v.AuxInt = int32ToAuxInt(c + 4*d) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } // match: (LEAQ4 [c] {s} x (SHLQconst [1] y)) // result: (LEAQ8 [c] {s} x y) for { - c := v.AuxInt - s := v.Aux + c := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) x := v_0 - if v_1.Op != OpAMD64SHLQconst || v_1.AuxInt != 1 { + if v_1.Op != OpAMD64SHLQconst || auxIntToInt8(v_1.AuxInt) != 1 { break } y := v_1.Args[0] v.reset(OpAMD64LEAQ8) - v.AuxInt = c - v.Aux = s + v.AuxInt = int32ToAuxInt(c) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } @@ -9761,44 +9746,44 @@ func rewriteValueAMD64_OpAMD64LEAQ8(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (LEAQ8 [c] {s} (ADDQconst [d] x) y) - // cond: is32Bit(c+d) && x.Op != OpSB + // cond: is32Bit(int64(c)+int64(d)) && x.Op != OpSB // result: (LEAQ8 [c+d] {s} x y) for { - c := v.AuxInt - s := v.Aux + c := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - d := v_0.AuxInt + d := auxIntToInt32(v_0.AuxInt) x := v_0.Args[0] y := v_1 - if !(is32Bit(c+d) && x.Op != OpSB) { + if !(is32Bit(int64(c)+int64(d)) && x.Op != OpSB) { break } v.reset(OpAMD64LEAQ8) - v.AuxInt = c + d - v.Aux = s + v.AuxInt = int32ToAuxInt(c + d) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } // match: (LEAQ8 [c] {s} x (ADDQconst [d] y)) - // cond: is32Bit(c+8*d) && y.Op != OpSB + // cond: is32Bit(int64(c)+8*int64(d)) && y.Op != OpSB // result: (LEAQ8 [c+8*d] {s} x y) for { - c := v.AuxInt - s := v.Aux + c := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) x := v_0 if v_1.Op != OpAMD64ADDQconst { break } - d := v_1.AuxInt + d := auxIntToInt32(v_1.AuxInt) y := v_1.Args[0] - if !(is32Bit(c+8*d) && y.Op != OpSB) { + if !(is32Bit(int64(c)+8*int64(d)) && y.Op != OpSB) { break } v.reset(OpAMD64LEAQ8) - v.AuxInt = c + 8*d - v.Aux = s + v.AuxInt = int32ToAuxInt(c + 8*d) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } @@ -9877,8 +9862,8 @@ func rewriteValueAMD64_OpAMD64MOVBQSX(v *Value) bool { if x.Op != OpAMD64MOVBload { break } - off := x.AuxInt - sym := x.Aux + off := auxIntToInt32(x.AuxInt) + sym := auxToSym(x.Aux) mem := x.Args[1] ptr := x.Args[0] if !(x.Uses == 1 && clobber(x)) { @@ -9887,8 +9872,8 @@ func rewriteValueAMD64_OpAMD64MOVBQSX(v *Value) bool { b = x.Block v0 := b.NewValue0(x.Pos, OpAMD64MOVBQSXload, v.Type) v.copyOf(v0) - v0.AuxInt = off - v0.Aux = sym + v0.AuxInt = int32ToAuxInt(off) + v0.Aux = symToAux(sym) v0.AddArg2(ptr, mem) return true } @@ -9900,8 +9885,8 @@ func rewriteValueAMD64_OpAMD64MOVBQSX(v *Value) bool { if x.Op != OpAMD64MOVWload { break } - off := x.AuxInt - sym := x.Aux + off := auxIntToInt32(x.AuxInt) + sym := auxToSym(x.Aux) mem := x.Args[1] ptr := x.Args[0] if !(x.Uses == 1 && clobber(x)) { @@ -9910,8 +9895,8 @@ func rewriteValueAMD64_OpAMD64MOVBQSX(v *Value) bool { b = x.Block v0 := b.NewValue0(x.Pos, OpAMD64MOVBQSXload, v.Type) v.copyOf(v0) - v0.AuxInt = off - v0.Aux = sym + v0.AuxInt = int32ToAuxInt(off) + v0.Aux = symToAux(sym) v0.AddArg2(ptr, mem) return true } @@ -9923,8 +9908,8 @@ func rewriteValueAMD64_OpAMD64MOVBQSX(v *Value) bool { if x.Op != OpAMD64MOVLload { break } - off := x.AuxInt - sym := x.Aux + off := auxIntToInt32(x.AuxInt) + sym := auxToSym(x.Aux) mem := x.Args[1] ptr := x.Args[0] if !(x.Uses == 1 && clobber(x)) { @@ -9933,8 +9918,8 @@ func rewriteValueAMD64_OpAMD64MOVBQSX(v *Value) bool { b = x.Block v0 := b.NewValue0(x.Pos, OpAMD64MOVBQSXload, v.Type) v.copyOf(v0) - v0.AuxInt = off - v0.Aux = sym + v0.AuxInt = int32ToAuxInt(off) + v0.Aux = symToAux(sym) v0.AddArg2(ptr, mem) return true } @@ -9946,8 +9931,8 @@ func rewriteValueAMD64_OpAMD64MOVBQSX(v *Value) bool { if x.Op != OpAMD64MOVQload { break } - off := x.AuxInt - sym := x.Aux + off := auxIntToInt32(x.AuxInt) + sym := auxToSym(x.Aux) mem := x.Args[1] ptr := x.Args[0] if !(x.Uses == 1 && clobber(x)) { @@ -9956,8 +9941,8 @@ func rewriteValueAMD64_OpAMD64MOVBQSX(v *Value) bool { b = x.Block v0 := b.NewValue0(x.Pos, OpAMD64MOVBQSXload, v.Type) v.copyOf(v0) - v0.AuxInt = off - v0.Aux = sym + v0.AuxInt = int32ToAuxInt(off) + v0.Aux = symToAux(sym) v0.AddArg2(ptr, mem) return true } @@ -9968,13 +9953,13 @@ func rewriteValueAMD64_OpAMD64MOVBQSX(v *Value) bool { if v_0.Op != OpAMD64ANDLconst { break } - c := v_0.AuxInt + c := auxIntToInt32(v_0.AuxInt) x := v_0.Args[0] if !(c&0x80 == 0) { break } v.reset(OpAMD64ANDLconst) - v.AuxInt = c & 0x7f + v.AuxInt = int32ToAuxInt(c & 0x7f) v.AddArg(x) return true } @@ -9998,14 +9983,14 @@ func rewriteValueAMD64_OpAMD64MOVBQSXload(v *Value) bool { // cond: sym == sym2 && off == off2 && isSamePtr(ptr, ptr2) // result: (MOVBQSX x) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64MOVBstore { break } - off2 := v_1.AuxInt - sym2 := v_1.Aux + off2 := auxIntToInt32(v_1.AuxInt) + sym2 := auxToSym(v_1.Aux) x := v_1.Args[1] ptr2 := v_1.Args[0] if !(sym == sym2 && off == off2 && isSamePtr(ptr, ptr2)) { @@ -10050,8 +10035,8 @@ func rewriteValueAMD64_OpAMD64MOVBQZX(v *Value) bool { if x.Op != OpAMD64MOVBload { break } - off := x.AuxInt - sym := x.Aux + off := auxIntToInt32(x.AuxInt) + sym := auxToSym(x.Aux) mem := x.Args[1] ptr := x.Args[0] if !(x.Uses == 1 && clobber(x)) { @@ -10060,8 +10045,8 @@ func rewriteValueAMD64_OpAMD64MOVBQZX(v *Value) bool { b = x.Block v0 := b.NewValue0(x.Pos, OpAMD64MOVBload, v.Type) v.copyOf(v0) - v0.AuxInt = off - v0.Aux = sym + v0.AuxInt = int32ToAuxInt(off) + v0.Aux = symToAux(sym) v0.AddArg2(ptr, mem) return true } @@ -10073,8 +10058,8 @@ func rewriteValueAMD64_OpAMD64MOVBQZX(v *Value) bool { if x.Op != OpAMD64MOVWload { break } - off := x.AuxInt - sym := x.Aux + off := auxIntToInt32(x.AuxInt) + sym := auxToSym(x.Aux) mem := x.Args[1] ptr := x.Args[0] if !(x.Uses == 1 && clobber(x)) { @@ -10083,8 +10068,8 @@ func rewriteValueAMD64_OpAMD64MOVBQZX(v *Value) bool { b = x.Block v0 := b.NewValue0(x.Pos, OpAMD64MOVBload, v.Type) v.copyOf(v0) - v0.AuxInt = off - v0.Aux = sym + v0.AuxInt = int32ToAuxInt(off) + v0.Aux = symToAux(sym) v0.AddArg2(ptr, mem) return true } @@ -10096,8 +10081,8 @@ func rewriteValueAMD64_OpAMD64MOVBQZX(v *Value) bool { if x.Op != OpAMD64MOVLload { break } - off := x.AuxInt - sym := x.Aux + off := auxIntToInt32(x.AuxInt) + sym := auxToSym(x.Aux) mem := x.Args[1] ptr := x.Args[0] if !(x.Uses == 1 && clobber(x)) { @@ -10106,8 +10091,8 @@ func rewriteValueAMD64_OpAMD64MOVBQZX(v *Value) bool { b = x.Block v0 := b.NewValue0(x.Pos, OpAMD64MOVBload, v.Type) v.copyOf(v0) - v0.AuxInt = off - v0.Aux = sym + v0.AuxInt = int32ToAuxInt(off) + v0.Aux = symToAux(sym) v0.AddArg2(ptr, mem) return true } @@ -10119,8 +10104,8 @@ func rewriteValueAMD64_OpAMD64MOVBQZX(v *Value) bool { if x.Op != OpAMD64MOVQload { break } - off := x.AuxInt - sym := x.Aux + off := auxIntToInt32(x.AuxInt) + sym := auxToSym(x.Aux) mem := x.Args[1] ptr := x.Args[0] if !(x.Uses == 1 && clobber(x)) { @@ -10129,8 +10114,8 @@ func rewriteValueAMD64_OpAMD64MOVBQZX(v *Value) bool { b = x.Block v0 := b.NewValue0(x.Pos, OpAMD64MOVBload, v.Type) v.copyOf(v0) - v0.AuxInt = off - v0.Aux = sym + v0.AuxInt = int32ToAuxInt(off) + v0.Aux = symToAux(sym) v0.AddArg2(ptr, mem) return true } @@ -10151,10 +10136,10 @@ func rewriteValueAMD64_OpAMD64MOVBQZX(v *Value) bool { if v_0.Op != OpAMD64ANDLconst { break } - c := v_0.AuxInt + c := auxIntToInt32(v_0.AuxInt) x := v_0.Args[0] v.reset(OpAMD64ANDLconst) - v.AuxInt = c & 0xff + v.AuxInt = int32ToAuxInt(c & 0xff) v.AddArg(x) return true } @@ -10226,14 +10211,14 @@ func rewriteValueAMD64_OpAMD64MOVBload(v *Value) bool { // cond: sym == sym2 && off == off2 && isSamePtr(ptr, ptr2) // result: (MOVBQZX x) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64MOVBstore { break } - off2 := v_1.AuxInt - sym2 := v_1.Aux + off2 := auxIntToInt32(v_1.AuxInt) + sym2 := auxToSym(v_1.Aux) x := v_1.Args[1] ptr2 := v_1.Args[0] if !(sym == sym2 && off == off2 && isSamePtr(ptr, ptr2)) { @@ -10244,23 +10229,23 @@ func rewriteValueAMD64_OpAMD64MOVBload(v *Value) bool { return true } // match: (MOVBload [off1] {sym} (ADDQconst [off2] ptr) mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (MOVBload [off1+off2] {sym} ptr mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) ptr := v_0.Args[0] mem := v_1 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64MOVBload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg2(ptr, mem) return true } @@ -10354,8 +10339,8 @@ func rewriteValueAMD64_OpAMD64MOVBstore(v *Value) bool { // cond: y.Uses == 1 // result: (SETLstore [off] {sym} ptr x mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 y := v_1 if y.Op != OpAMD64SETL { @@ -10367,8 +10352,8 @@ func rewriteValueAMD64_OpAMD64MOVBstore(v *Value) bool { break } v.reset(OpAMD64SETLstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(ptr, x, mem) return true } @@ -10376,8 +10361,8 @@ func rewriteValueAMD64_OpAMD64MOVBstore(v *Value) bool { // cond: y.Uses == 1 // result: (SETLEstore [off] {sym} ptr x mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 y := v_1 if y.Op != OpAMD64SETLE { @@ -10389,8 +10374,8 @@ func rewriteValueAMD64_OpAMD64MOVBstore(v *Value) bool { break } v.reset(OpAMD64SETLEstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(ptr, x, mem) return true } @@ -10398,8 +10383,8 @@ func rewriteValueAMD64_OpAMD64MOVBstore(v *Value) bool { // cond: y.Uses == 1 // result: (SETGstore [off] {sym} ptr x mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 y := v_1 if y.Op != OpAMD64SETG { @@ -10411,8 +10396,8 @@ func rewriteValueAMD64_OpAMD64MOVBstore(v *Value) bool { break } v.reset(OpAMD64SETGstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(ptr, x, mem) return true } @@ -10420,8 +10405,8 @@ func rewriteValueAMD64_OpAMD64MOVBstore(v *Value) bool { // cond: y.Uses == 1 // result: (SETGEstore [off] {sym} ptr x mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 y := v_1 if y.Op != OpAMD64SETGE { @@ -10433,8 +10418,8 @@ func rewriteValueAMD64_OpAMD64MOVBstore(v *Value) bool { break } v.reset(OpAMD64SETGEstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(ptr, x, mem) return true } @@ -10442,8 +10427,8 @@ func rewriteValueAMD64_OpAMD64MOVBstore(v *Value) bool { // cond: y.Uses == 1 // result: (SETEQstore [off] {sym} ptr x mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 y := v_1 if y.Op != OpAMD64SETEQ { @@ -10455,8 +10440,8 @@ func rewriteValueAMD64_OpAMD64MOVBstore(v *Value) bool { break } v.reset(OpAMD64SETEQstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(ptr, x, mem) return true } @@ -10464,8 +10449,8 @@ func rewriteValueAMD64_OpAMD64MOVBstore(v *Value) bool { // cond: y.Uses == 1 // result: (SETNEstore [off] {sym} ptr x mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 y := v_1 if y.Op != OpAMD64SETNE { @@ -10477,8 +10462,8 @@ func rewriteValueAMD64_OpAMD64MOVBstore(v *Value) bool { break } v.reset(OpAMD64SETNEstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(ptr, x, mem) return true } @@ -10486,8 +10471,8 @@ func rewriteValueAMD64_OpAMD64MOVBstore(v *Value) bool { // cond: y.Uses == 1 // result: (SETBstore [off] {sym} ptr x mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 y := v_1 if y.Op != OpAMD64SETB { @@ -10499,8 +10484,8 @@ func rewriteValueAMD64_OpAMD64MOVBstore(v *Value) bool { break } v.reset(OpAMD64SETBstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(ptr, x, mem) return true } @@ -10508,8 +10493,8 @@ func rewriteValueAMD64_OpAMD64MOVBstore(v *Value) bool { // cond: y.Uses == 1 // result: (SETBEstore [off] {sym} ptr x mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 y := v_1 if y.Op != OpAMD64SETBE { @@ -10521,8 +10506,8 @@ func rewriteValueAMD64_OpAMD64MOVBstore(v *Value) bool { break } v.reset(OpAMD64SETBEstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(ptr, x, mem) return true } @@ -10530,8 +10515,8 @@ func rewriteValueAMD64_OpAMD64MOVBstore(v *Value) bool { // cond: y.Uses == 1 // result: (SETAstore [off] {sym} ptr x mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 y := v_1 if y.Op != OpAMD64SETA { @@ -10543,8 +10528,8 @@ func rewriteValueAMD64_OpAMD64MOVBstore(v *Value) bool { break } v.reset(OpAMD64SETAstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(ptr, x, mem) return true } @@ -10552,8 +10537,8 @@ func rewriteValueAMD64_OpAMD64MOVBstore(v *Value) bool { // cond: y.Uses == 1 // result: (SETAEstore [off] {sym} ptr x mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 y := v_1 if y.Op != OpAMD64SETAE { @@ -10565,16 +10550,16 @@ func rewriteValueAMD64_OpAMD64MOVBstore(v *Value) bool { break } v.reset(OpAMD64SETAEstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(ptr, x, mem) return true } // match: (MOVBstore [off] {sym} ptr (MOVBQSX x) mem) // result: (MOVBstore [off] {sym} ptr x mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64MOVBQSX { break @@ -10582,16 +10567,16 @@ func rewriteValueAMD64_OpAMD64MOVBstore(v *Value) bool { x := v_1.Args[0] mem := v_2 v.reset(OpAMD64MOVBstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(ptr, x, mem) return true } // match: (MOVBstore [off] {sym} ptr (MOVBQZX x) mem) // result: (MOVBstore [off] {sym} ptr x mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64MOVBQZX { break @@ -10599,72 +10584,64 @@ func rewriteValueAMD64_OpAMD64MOVBstore(v *Value) bool { x := v_1.Args[0] mem := v_2 v.reset(OpAMD64MOVBstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(ptr, x, mem) return true } // match: (MOVBstore [off1] {sym} (ADDQconst [off2] ptr) val mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (MOVBstore [off1+off2] {sym} ptr val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) ptr := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64MOVBstore) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(ptr, val, mem) return true } // match: (MOVBstore [off] {sym} ptr (MOVLconst [c]) mem) - // cond: validOff(off) - // result: (MOVBstoreconst [makeValAndOff(int64(int8(c)),off)] {sym} ptr mem) + // result: (MOVBstoreconst [makeValAndOff32(int32(int8(c)),off)] {sym} ptr mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64MOVLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) mem := v_2 - if !(validOff(off)) { - break - } v.reset(OpAMD64MOVBstoreconst) - v.AuxInt = makeValAndOff(int64(int8(c)), off) - v.Aux = sym + v.AuxInt = valAndOffToAuxInt(makeValAndOff32(int32(int8(c)), off)) + v.Aux = symToAux(sym) v.AddArg2(ptr, mem) return true } // match: (MOVBstore [off] {sym} ptr (MOVQconst [c]) mem) - // cond: validOff(off) - // result: (MOVBstoreconst [makeValAndOff(int64(int8(c)),off)] {sym} ptr mem) + // result: (MOVBstoreconst [makeValAndOff32(int32(int8(c)),off)] {sym} ptr mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64MOVQconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) mem := v_2 - if !(validOff(off)) { - break - } v.reset(OpAMD64MOVBstoreconst) - v.AuxInt = makeValAndOff(int64(int8(c)), off) - v.Aux = sym + v.AuxInt = valAndOffToAuxInt(makeValAndOff32(int32(int8(c)), off)) + v.Aux = symToAux(sym) v.AddArg2(ptr, mem) return true } @@ -11542,23 +11519,23 @@ func rewriteValueAMD64_OpAMD64MOVBstoreconst(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (MOVBstoreconst [sc] {s} (ADDQconst [off] ptr) mem) - // cond: ValAndOff(sc).canAdd(off) - // result: (MOVBstoreconst [ValAndOff(sc).add(off)] {s} ptr mem) + // cond: ValAndOff(sc).canAdd32(off) + // result: (MOVBstoreconst [ValAndOff(sc).addOffset32(off)] {s} ptr mem) for { - sc := v.AuxInt - s := v.Aux + sc := auxIntToValAndOff(v.AuxInt) + s := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off := v_0.AuxInt + off := auxIntToInt32(v_0.AuxInt) ptr := v_0.Args[0] mem := v_1 - if !(ValAndOff(sc).canAdd(off)) { + if !(ValAndOff(sc).canAdd32(off)) { break } v.reset(OpAMD64MOVBstoreconst) - v.AuxInt = ValAndOff(sc).add(off) - v.Aux = s + v.AuxInt = valAndOffToAuxInt(ValAndOff(sc).addOffset32(off)) + v.Aux = symToAux(s) v.AddArg2(ptr, mem) return true } @@ -11690,8 +11667,8 @@ func rewriteValueAMD64_OpAMD64MOVLQSX(v *Value) bool { if x.Op != OpAMD64MOVLload { break } - off := x.AuxInt - sym := x.Aux + off := auxIntToInt32(x.AuxInt) + sym := auxToSym(x.Aux) mem := x.Args[1] ptr := x.Args[0] if !(x.Uses == 1 && clobber(x)) { @@ -11700,8 +11677,8 @@ func rewriteValueAMD64_OpAMD64MOVLQSX(v *Value) bool { b = x.Block v0 := b.NewValue0(x.Pos, OpAMD64MOVLQSXload, v.Type) v.copyOf(v0) - v0.AuxInt = off - v0.Aux = sym + v0.AuxInt = int32ToAuxInt(off) + v0.Aux = symToAux(sym) v0.AddArg2(ptr, mem) return true } @@ -11713,8 +11690,8 @@ func rewriteValueAMD64_OpAMD64MOVLQSX(v *Value) bool { if x.Op != OpAMD64MOVQload { break } - off := x.AuxInt - sym := x.Aux + off := auxIntToInt32(x.AuxInt) + sym := auxToSym(x.Aux) mem := x.Args[1] ptr := x.Args[0] if !(x.Uses == 1 && clobber(x)) { @@ -11723,25 +11700,25 @@ func rewriteValueAMD64_OpAMD64MOVLQSX(v *Value) bool { b = x.Block v0 := b.NewValue0(x.Pos, OpAMD64MOVLQSXload, v.Type) v.copyOf(v0) - v0.AuxInt = off - v0.Aux = sym + v0.AuxInt = int32ToAuxInt(off) + v0.Aux = symToAux(sym) v0.AddArg2(ptr, mem) return true } // match: (MOVLQSX (ANDLconst [c] x)) - // cond: c & 0x80000000 == 0 + // cond: uint32(c) & 0x80000000 == 0 // result: (ANDLconst [c & 0x7fffffff] x) for { if v_0.Op != OpAMD64ANDLconst { break } - c := v_0.AuxInt + c := auxIntToInt32(v_0.AuxInt) x := v_0.Args[0] - if !(c&0x80000000 == 0) { + if !(uint32(c)&0x80000000 == 0) { break } v.reset(OpAMD64ANDLconst) - v.AuxInt = c & 0x7fffffff + v.AuxInt = int32ToAuxInt(c & 0x7fffffff) v.AddArg(x) return true } @@ -11787,14 +11764,14 @@ func rewriteValueAMD64_OpAMD64MOVLQSXload(v *Value) bool { // cond: sym == sym2 && off == off2 && isSamePtr(ptr, ptr2) // result: (MOVLQSX x) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64MOVLstore { break } - off2 := v_1.AuxInt - sym2 := v_1.Aux + off2 := auxIntToInt32(v_1.AuxInt) + sym2 := auxToSym(v_1.Aux) x := v_1.Args[1] ptr2 := v_1.Args[0] if !(sym == sym2 && off == off2 && isSamePtr(ptr, ptr2)) { @@ -11839,8 +11816,8 @@ func rewriteValueAMD64_OpAMD64MOVLQZX(v *Value) bool { if x.Op != OpAMD64MOVLload { break } - off := x.AuxInt - sym := x.Aux + off := auxIntToInt32(x.AuxInt) + sym := auxToSym(x.Aux) mem := x.Args[1] ptr := x.Args[0] if !(x.Uses == 1 && clobber(x)) { @@ -11849,8 +11826,8 @@ func rewriteValueAMD64_OpAMD64MOVLQZX(v *Value) bool { b = x.Block v0 := b.NewValue0(x.Pos, OpAMD64MOVLload, v.Type) v.copyOf(v0) - v0.AuxInt = off - v0.Aux = sym + v0.AuxInt = int32ToAuxInt(off) + v0.Aux = symToAux(sym) v0.AddArg2(ptr, mem) return true } @@ -11862,8 +11839,8 @@ func rewriteValueAMD64_OpAMD64MOVLQZX(v *Value) bool { if x.Op != OpAMD64MOVQload { break } - off := x.AuxInt - sym := x.Aux + off := auxIntToInt32(x.AuxInt) + sym := auxToSym(x.Aux) mem := x.Args[1] ptr := x.Args[0] if !(x.Uses == 1 && clobber(x)) { @@ -11872,8 +11849,8 @@ func rewriteValueAMD64_OpAMD64MOVLQZX(v *Value) bool { b = x.Block v0 := b.NewValue0(x.Pos, OpAMD64MOVLload, v.Type) v.copyOf(v0) - v0.AuxInt = off - v0.Aux = sym + v0.AuxInt = int32ToAuxInt(off) + v0.Aux = symToAux(sym) v0.AddArg2(ptr, mem) return true } @@ -11894,10 +11871,10 @@ func rewriteValueAMD64_OpAMD64MOVLQZX(v *Value) bool { if v_0.Op != OpAMD64ANDLconst { break } - c := v_0.AuxInt + c := auxIntToInt32(v_0.AuxInt) x := v_0.Args[0] v.reset(OpAMD64ANDLconst) - v.AuxInt = c + v.AuxInt = int32ToAuxInt(c) v.AddArg(x) return true } @@ -12045,14 +12022,14 @@ func rewriteValueAMD64_OpAMD64MOVLload(v *Value) bool { // cond: sym == sym2 && off == off2 && isSamePtr(ptr, ptr2) // result: (MOVLQZX x) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64MOVLstore { break } - off2 := v_1.AuxInt - sym2 := v_1.Aux + off2 := auxIntToInt32(v_1.AuxInt) + sym2 := auxToSym(v_1.Aux) x := v_1.Args[1] ptr2 := v_1.Args[0] if !(sym == sym2 && off == off2 && isSamePtr(ptr, ptr2)) { @@ -12063,23 +12040,23 @@ func rewriteValueAMD64_OpAMD64MOVLload(v *Value) bool { return true } // match: (MOVLload [off1] {sym} (ADDQconst [off2] ptr) mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (MOVLload [off1+off2] {sym} ptr mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) ptr := v_0.Args[0] mem := v_1 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64MOVLload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg2(ptr, mem) return true } @@ -12189,8 +12166,8 @@ func rewriteValueAMD64_OpAMD64MOVLstore(v *Value) bool { // match: (MOVLstore [off] {sym} ptr (MOVLQSX x) mem) // result: (MOVLstore [off] {sym} ptr x mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64MOVLQSX { break @@ -12198,16 +12175,16 @@ func rewriteValueAMD64_OpAMD64MOVLstore(v *Value) bool { x := v_1.Args[0] mem := v_2 v.reset(OpAMD64MOVLstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(ptr, x, mem) return true } // match: (MOVLstore [off] {sym} ptr (MOVLQZX x) mem) // result: (MOVLstore [off] {sym} ptr x mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64MOVLQZX { break @@ -12215,72 +12192,64 @@ func rewriteValueAMD64_OpAMD64MOVLstore(v *Value) bool { x := v_1.Args[0] mem := v_2 v.reset(OpAMD64MOVLstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(ptr, x, mem) return true } // match: (MOVLstore [off1] {sym} (ADDQconst [off2] ptr) val mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (MOVLstore [off1+off2] {sym} ptr val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) ptr := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64MOVLstore) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(ptr, val, mem) return true } // match: (MOVLstore [off] {sym} ptr (MOVLconst [c]) mem) - // cond: validOff(off) - // result: (MOVLstoreconst [makeValAndOff(int64(int32(c)),off)] {sym} ptr mem) + // result: (MOVLstoreconst [makeValAndOff32(int32(c),off)] {sym} ptr mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64MOVLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) mem := v_2 - if !(validOff(off)) { - break - } v.reset(OpAMD64MOVLstoreconst) - v.AuxInt = makeValAndOff(int64(int32(c)), off) - v.Aux = sym + v.AuxInt = valAndOffToAuxInt(makeValAndOff32(int32(c), off)) + v.Aux = symToAux(sym) v.AddArg2(ptr, mem) return true } // match: (MOVLstore [off] {sym} ptr (MOVQconst [c]) mem) - // cond: validOff(off) - // result: (MOVLstoreconst [makeValAndOff(int64(int32(c)),off)] {sym} ptr mem) + // result: (MOVLstoreconst [makeValAndOff32(int32(c),off)] {sym} ptr mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64MOVQconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) mem := v_2 - if !(validOff(off)) { - break - } v.reset(OpAMD64MOVLstoreconst) - v.AuxInt = makeValAndOff(int64(int32(c)), off) - v.Aux = sym + v.AuxInt = valAndOffToAuxInt(makeValAndOff32(int32(c), off)) + v.Aux = symToAux(sym) v.AddArg2(ptr, mem) return true } @@ -13048,23 +13017,23 @@ func rewriteValueAMD64_OpAMD64MOVLstoreconst(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (MOVLstoreconst [sc] {s} (ADDQconst [off] ptr) mem) - // cond: ValAndOff(sc).canAdd(off) - // result: (MOVLstoreconst [ValAndOff(sc).add(off)] {s} ptr mem) + // cond: ValAndOff(sc).canAdd32(off) + // result: (MOVLstoreconst [ValAndOff(sc).addOffset32(off)] {s} ptr mem) for { - sc := v.AuxInt - s := v.Aux + sc := auxIntToValAndOff(v.AuxInt) + s := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off := v_0.AuxInt + off := auxIntToInt32(v_0.AuxInt) ptr := v_0.Args[0] mem := v_1 - if !(ValAndOff(sc).canAdd(off)) { + if !(ValAndOff(sc).canAdd32(off)) { break } v.reset(OpAMD64MOVLstoreconst) - v.AuxInt = ValAndOff(sc).add(off) - v.Aux = s + v.AuxInt = valAndOffToAuxInt(ValAndOff(sc).addOffset32(off)) + v.Aux = symToAux(s) v.AddArg2(ptr, mem) return true } @@ -13193,23 +13162,23 @@ func rewriteValueAMD64_OpAMD64MOVOload(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (MOVOload [off1] {sym} (ADDQconst [off2] ptr) mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (MOVOload [off1+off2] {sym} ptr mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) ptr := v_0.Args[0] mem := v_1 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64MOVOload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg2(ptr, mem) return true } @@ -13245,24 +13214,24 @@ func rewriteValueAMD64_OpAMD64MOVOstore(v *Value) bool { config := b.Func.Config typ := &b.Func.Config.Types // match: (MOVOstore [off1] {sym} (ADDQconst [off2] ptr) val mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (MOVOstore [off1+off2] {sym} ptr val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) ptr := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64MOVOstore) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(ptr, val, mem) return true } @@ -13434,14 +13403,14 @@ func rewriteValueAMD64_OpAMD64MOVQload(v *Value) bool { // cond: sym == sym2 && off == off2 && isSamePtr(ptr, ptr2) // result: x for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64MOVQstore { break } - off2 := v_1.AuxInt - sym2 := v_1.Aux + off2 := auxIntToInt32(v_1.AuxInt) + sym2 := auxToSym(v_1.Aux) x := v_1.Args[1] ptr2 := v_1.Args[0] if !(sym == sym2 && off == off2 && isSamePtr(ptr, ptr2)) { @@ -13451,23 +13420,23 @@ func rewriteValueAMD64_OpAMD64MOVQload(v *Value) bool { return true } // match: (MOVQload [off1] {sym} (ADDQconst [off2] ptr) mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (MOVQload [off1+off2] {sym} ptr mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) ptr := v_0.Args[0] mem := v_1 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64MOVQload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg2(ptr, mem) return true } @@ -13573,45 +13542,45 @@ func rewriteValueAMD64_OpAMD64MOVQstore(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (MOVQstore [off1] {sym} (ADDQconst [off2] ptr) val mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (MOVQstore [off1+off2] {sym} ptr val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) ptr := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64MOVQstore) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(ptr, val, mem) return true } // match: (MOVQstore [off] {sym} ptr (MOVQconst [c]) mem) - // cond: validValAndOff(c,off) - // result: (MOVQstoreconst [makeValAndOff(c,off)] {sym} ptr mem) + // cond: validVal(c) + // result: (MOVQstoreconst [makeValAndOff32(int32(c),off)] {sym} ptr mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64MOVQconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) mem := v_2 - if !(validValAndOff(c, off)) { + if !(validVal(c)) { break } v.reset(OpAMD64MOVQstoreconst) - v.AuxInt = makeValAndOff(c, off) - v.Aux = sym + v.AuxInt = valAndOffToAuxInt(makeValAndOff32(int32(c), off)) + v.Aux = symToAux(sym) v.AddArg2(ptr, mem) return true } @@ -14229,23 +14198,23 @@ func rewriteValueAMD64_OpAMD64MOVQstoreconst(v *Value) bool { b := v.Block config := b.Func.Config // match: (MOVQstoreconst [sc] {s} (ADDQconst [off] ptr) mem) - // cond: ValAndOff(sc).canAdd(off) - // result: (MOVQstoreconst [ValAndOff(sc).add(off)] {s} ptr mem) + // cond: ValAndOff(sc).canAdd32(off) + // result: (MOVQstoreconst [ValAndOff(sc).addOffset32(off)] {s} ptr mem) for { - sc := v.AuxInt - s := v.Aux + sc := auxIntToValAndOff(v.AuxInt) + s := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off := v_0.AuxInt + off := auxIntToInt32(v_0.AuxInt) ptr := v_0.Args[0] mem := v_1 - if !(ValAndOff(sc).canAdd(off)) { + if !(ValAndOff(sc).canAdd32(off)) { break } v.reset(OpAMD64MOVQstoreconst) - v.AuxInt = ValAndOff(sc).add(off) - v.Aux = s + v.AuxInt = valAndOffToAuxInt(ValAndOff(sc).addOffset32(off)) + v.Aux = symToAux(s) v.AddArg2(ptr, mem) return true } @@ -14347,23 +14316,23 @@ func rewriteValueAMD64_OpAMD64MOVSDload(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (MOVSDload [off1] {sym} (ADDQconst [off2] ptr) mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (MOVSDload [off1+off2] {sym} ptr mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) ptr := v_0.Args[0] mem := v_1 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64MOVSDload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg2(ptr, mem) return true } @@ -14413,24 +14382,24 @@ func rewriteValueAMD64_OpAMD64MOVSDstore(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (MOVSDstore [off1] {sym} (ADDQconst [off2] ptr) val mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (MOVSDstore [off1+off2] {sym} ptr val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) ptr := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64MOVSDstore) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(ptr, val, mem) return true } @@ -14480,23 +14449,23 @@ func rewriteValueAMD64_OpAMD64MOVSSload(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (MOVSSload [off1] {sym} (ADDQconst [off2] ptr) mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (MOVSSload [off1+off2] {sym} ptr mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) ptr := v_0.Args[0] mem := v_1 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64MOVSSload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg2(ptr, mem) return true } @@ -14546,24 +14515,24 @@ func rewriteValueAMD64_OpAMD64MOVSSstore(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (MOVSSstore [off1] {sym} (ADDQconst [off2] ptr) val mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (MOVSSstore [off1+off2] {sym} ptr val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) ptr := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64MOVSSstore) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(ptr, val, mem) return true } @@ -14620,8 +14589,8 @@ func rewriteValueAMD64_OpAMD64MOVWQSX(v *Value) bool { if x.Op != OpAMD64MOVWload { break } - off := x.AuxInt - sym := x.Aux + off := auxIntToInt32(x.AuxInt) + sym := auxToSym(x.Aux) mem := x.Args[1] ptr := x.Args[0] if !(x.Uses == 1 && clobber(x)) { @@ -14630,8 +14599,8 @@ func rewriteValueAMD64_OpAMD64MOVWQSX(v *Value) bool { b = x.Block v0 := b.NewValue0(x.Pos, OpAMD64MOVWQSXload, v.Type) v.copyOf(v0) - v0.AuxInt = off - v0.Aux = sym + v0.AuxInt = int32ToAuxInt(off) + v0.Aux = symToAux(sym) v0.AddArg2(ptr, mem) return true } @@ -14643,8 +14612,8 @@ func rewriteValueAMD64_OpAMD64MOVWQSX(v *Value) bool { if x.Op != OpAMD64MOVLload { break } - off := x.AuxInt - sym := x.Aux + off := auxIntToInt32(x.AuxInt) + sym := auxToSym(x.Aux) mem := x.Args[1] ptr := x.Args[0] if !(x.Uses == 1 && clobber(x)) { @@ -14653,8 +14622,8 @@ func rewriteValueAMD64_OpAMD64MOVWQSX(v *Value) bool { b = x.Block v0 := b.NewValue0(x.Pos, OpAMD64MOVWQSXload, v.Type) v.copyOf(v0) - v0.AuxInt = off - v0.Aux = sym + v0.AuxInt = int32ToAuxInt(off) + v0.Aux = symToAux(sym) v0.AddArg2(ptr, mem) return true } @@ -14666,8 +14635,8 @@ func rewriteValueAMD64_OpAMD64MOVWQSX(v *Value) bool { if x.Op != OpAMD64MOVQload { break } - off := x.AuxInt - sym := x.Aux + off := auxIntToInt32(x.AuxInt) + sym := auxToSym(x.Aux) mem := x.Args[1] ptr := x.Args[0] if !(x.Uses == 1 && clobber(x)) { @@ -14676,8 +14645,8 @@ func rewriteValueAMD64_OpAMD64MOVWQSX(v *Value) bool { b = x.Block v0 := b.NewValue0(x.Pos, OpAMD64MOVWQSXload, v.Type) v.copyOf(v0) - v0.AuxInt = off - v0.Aux = sym + v0.AuxInt = int32ToAuxInt(off) + v0.Aux = symToAux(sym) v0.AddArg2(ptr, mem) return true } @@ -14688,13 +14657,13 @@ func rewriteValueAMD64_OpAMD64MOVWQSX(v *Value) bool { if v_0.Op != OpAMD64ANDLconst { break } - c := v_0.AuxInt + c := auxIntToInt32(v_0.AuxInt) x := v_0.Args[0] if !(c&0x8000 == 0) { break } v.reset(OpAMD64ANDLconst) - v.AuxInt = c & 0x7fff + v.AuxInt = int32ToAuxInt(c & 0x7fff) v.AddArg(x) return true } @@ -14729,14 +14698,14 @@ func rewriteValueAMD64_OpAMD64MOVWQSXload(v *Value) bool { // cond: sym == sym2 && off == off2 && isSamePtr(ptr, ptr2) // result: (MOVWQSX x) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64MOVWstore { break } - off2 := v_1.AuxInt - sym2 := v_1.Aux + off2 := auxIntToInt32(v_1.AuxInt) + sym2 := auxToSym(v_1.Aux) x := v_1.Args[1] ptr2 := v_1.Args[0] if !(sym == sym2 && off == off2 && isSamePtr(ptr, ptr2)) { @@ -14781,8 +14750,8 @@ func rewriteValueAMD64_OpAMD64MOVWQZX(v *Value) bool { if x.Op != OpAMD64MOVWload { break } - off := x.AuxInt - sym := x.Aux + off := auxIntToInt32(x.AuxInt) + sym := auxToSym(x.Aux) mem := x.Args[1] ptr := x.Args[0] if !(x.Uses == 1 && clobber(x)) { @@ -14791,8 +14760,8 @@ func rewriteValueAMD64_OpAMD64MOVWQZX(v *Value) bool { b = x.Block v0 := b.NewValue0(x.Pos, OpAMD64MOVWload, v.Type) v.copyOf(v0) - v0.AuxInt = off - v0.Aux = sym + v0.AuxInt = int32ToAuxInt(off) + v0.Aux = symToAux(sym) v0.AddArg2(ptr, mem) return true } @@ -14804,8 +14773,8 @@ func rewriteValueAMD64_OpAMD64MOVWQZX(v *Value) bool { if x.Op != OpAMD64MOVLload { break } - off := x.AuxInt - sym := x.Aux + off := auxIntToInt32(x.AuxInt) + sym := auxToSym(x.Aux) mem := x.Args[1] ptr := x.Args[0] if !(x.Uses == 1 && clobber(x)) { @@ -14814,8 +14783,8 @@ func rewriteValueAMD64_OpAMD64MOVWQZX(v *Value) bool { b = x.Block v0 := b.NewValue0(x.Pos, OpAMD64MOVWload, v.Type) v.copyOf(v0) - v0.AuxInt = off - v0.Aux = sym + v0.AuxInt = int32ToAuxInt(off) + v0.Aux = symToAux(sym) v0.AddArg2(ptr, mem) return true } @@ -14827,8 +14796,8 @@ func rewriteValueAMD64_OpAMD64MOVWQZX(v *Value) bool { if x.Op != OpAMD64MOVQload { break } - off := x.AuxInt - sym := x.Aux + off := auxIntToInt32(x.AuxInt) + sym := auxToSym(x.Aux) mem := x.Args[1] ptr := x.Args[0] if !(x.Uses == 1 && clobber(x)) { @@ -14837,8 +14806,8 @@ func rewriteValueAMD64_OpAMD64MOVWQZX(v *Value) bool { b = x.Block v0 := b.NewValue0(x.Pos, OpAMD64MOVWload, v.Type) v.copyOf(v0) - v0.AuxInt = off - v0.Aux = sym + v0.AuxInt = int32ToAuxInt(off) + v0.Aux = symToAux(sym) v0.AddArg2(ptr, mem) return true } @@ -14859,10 +14828,10 @@ func rewriteValueAMD64_OpAMD64MOVWQZX(v *Value) bool { if v_0.Op != OpAMD64ANDLconst { break } - c := v_0.AuxInt + c := auxIntToInt32(v_0.AuxInt) x := v_0.Args[0] v.reset(OpAMD64ANDLconst) - v.AuxInt = c & 0xffff + v.AuxInt = int32ToAuxInt(c & 0xffff) v.AddArg(x) return true } @@ -14899,14 +14868,14 @@ func rewriteValueAMD64_OpAMD64MOVWload(v *Value) bool { // cond: sym == sym2 && off == off2 && isSamePtr(ptr, ptr2) // result: (MOVWQZX x) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64MOVWstore { break } - off2 := v_1.AuxInt - sym2 := v_1.Aux + off2 := auxIntToInt32(v_1.AuxInt) + sym2 := auxToSym(v_1.Aux) x := v_1.Args[1] ptr2 := v_1.Args[0] if !(sym == sym2 && off == off2 && isSamePtr(ptr, ptr2)) { @@ -14917,23 +14886,23 @@ func rewriteValueAMD64_OpAMD64MOVWload(v *Value) bool { return true } // match: (MOVWload [off1] {sym} (ADDQconst [off2] ptr) mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (MOVWload [off1+off2] {sym} ptr mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) ptr := v_0.Args[0] mem := v_1 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64MOVWload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg2(ptr, mem) return true } @@ -15026,8 +14995,8 @@ func rewriteValueAMD64_OpAMD64MOVWstore(v *Value) bool { // match: (MOVWstore [off] {sym} ptr (MOVWQSX x) mem) // result: (MOVWstore [off] {sym} ptr x mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64MOVWQSX { break @@ -15035,16 +15004,16 @@ func rewriteValueAMD64_OpAMD64MOVWstore(v *Value) bool { x := v_1.Args[0] mem := v_2 v.reset(OpAMD64MOVWstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(ptr, x, mem) return true } // match: (MOVWstore [off] {sym} ptr (MOVWQZX x) mem) // result: (MOVWstore [off] {sym} ptr x mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64MOVWQZX { break @@ -15052,72 +15021,64 @@ func rewriteValueAMD64_OpAMD64MOVWstore(v *Value) bool { x := v_1.Args[0] mem := v_2 v.reset(OpAMD64MOVWstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(ptr, x, mem) return true } // match: (MOVWstore [off1] {sym} (ADDQconst [off2] ptr) val mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (MOVWstore [off1+off2] {sym} ptr val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) ptr := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64MOVWstore) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(ptr, val, mem) return true } // match: (MOVWstore [off] {sym} ptr (MOVLconst [c]) mem) - // cond: validOff(off) - // result: (MOVWstoreconst [makeValAndOff(int64(int16(c)),off)] {sym} ptr mem) + // result: (MOVWstoreconst [makeValAndOff32(int32(int16(c)),off)] {sym} ptr mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64MOVLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) mem := v_2 - if !(validOff(off)) { - break - } v.reset(OpAMD64MOVWstoreconst) - v.AuxInt = makeValAndOff(int64(int16(c)), off) - v.Aux = sym + v.AuxInt = valAndOffToAuxInt(makeValAndOff32(int32(int16(c)), off)) + v.Aux = symToAux(sym) v.AddArg2(ptr, mem) return true } // match: (MOVWstore [off] {sym} ptr (MOVQconst [c]) mem) - // cond: validOff(off) - // result: (MOVWstoreconst [makeValAndOff(int64(int16(c)),off)] {sym} ptr mem) + // result: (MOVWstoreconst [makeValAndOff32(int32(int16(c)),off)] {sym} ptr mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64MOVQconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) mem := v_2 - if !(validOff(off)) { - break - } v.reset(OpAMD64MOVWstoreconst) - v.AuxInt = makeValAndOff(int64(int16(c)), off) - v.Aux = sym + v.AuxInt = valAndOffToAuxInt(makeValAndOff32(int32(int16(c)), off)) + v.Aux = symToAux(sym) v.AddArg2(ptr, mem) return true } @@ -15454,23 +15415,23 @@ func rewriteValueAMD64_OpAMD64MOVWstoreconst(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (MOVWstoreconst [sc] {s} (ADDQconst [off] ptr) mem) - // cond: ValAndOff(sc).canAdd(off) - // result: (MOVWstoreconst [ValAndOff(sc).add(off)] {s} ptr mem) + // cond: ValAndOff(sc).canAdd32(off) + // result: (MOVWstoreconst [ValAndOff(sc).addOffset32(off)] {s} ptr mem) for { - sc := v.AuxInt - s := v.Aux + sc := auxIntToValAndOff(v.AuxInt) + s := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off := v_0.AuxInt + off := auxIntToInt32(v_0.AuxInt) ptr := v_0.Args[0] mem := v_1 - if !(ValAndOff(sc).canAdd(off)) { + if !(ValAndOff(sc).canAdd32(off)) { break } v.reset(OpAMD64MOVWstoreconst) - v.AuxInt = ValAndOff(sc).add(off) - v.Aux = s + v.AuxInt = valAndOffToAuxInt(ValAndOff(sc).addOffset32(off)) + v.Aux = symToAux(s) v.AddArg2(ptr, mem) return true } @@ -15602,9 +15563,9 @@ func rewriteValueAMD64_OpAMD64MULL(v *Value) bool { if v_1.Op != OpAMD64MOVLconst { continue } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) v.reset(OpAMD64MULLconst) - v.AuxInt = c + v.AuxInt = int32ToAuxInt(c) v.AddArg(x) return true } @@ -15616,23 +15577,23 @@ func rewriteValueAMD64_OpAMD64MULLconst(v *Value) bool { v_0 := v.Args[0] b := v.Block // match: (MULLconst [c] (MULLconst [d] x)) - // result: (MULLconst [int64(int32(c * d))] x) + // result: (MULLconst [c * d] x) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) if v_0.Op != OpAMD64MULLconst { break } - d := v_0.AuxInt + d := auxIntToInt32(v_0.AuxInt) x := v_0.Args[0] v.reset(OpAMD64MULLconst) - v.AuxInt = int64(int32(c * d)) + v.AuxInt = int32ToAuxInt(c * d) v.AddArg(x) return true } // match: (MULLconst [-9] x) // result: (NEGL (LEAL8 <v.Type> x x)) for { - if v.AuxInt != -9 { + if auxIntToInt32(v.AuxInt) != -9 { break } x := v_0 @@ -15645,7 +15606,7 @@ func rewriteValueAMD64_OpAMD64MULLconst(v *Value) bool { // match: (MULLconst [-5] x) // result: (NEGL (LEAL4 <v.Type> x x)) for { - if v.AuxInt != -5 { + if auxIntToInt32(v.AuxInt) != -5 { break } x := v_0 @@ -15658,7 +15619,7 @@ func rewriteValueAMD64_OpAMD64MULLconst(v *Value) bool { // match: (MULLconst [-3] x) // result: (NEGL (LEAL2 <v.Type> x x)) for { - if v.AuxInt != -3 { + if auxIntToInt32(v.AuxInt) != -3 { break } x := v_0 @@ -15671,7 +15632,7 @@ func rewriteValueAMD64_OpAMD64MULLconst(v *Value) bool { // match: (MULLconst [-1] x) // result: (NEGL x) for { - if v.AuxInt != -1 { + if auxIntToInt32(v.AuxInt) != -1 { break } x := v_0 @@ -15682,17 +15643,17 @@ func rewriteValueAMD64_OpAMD64MULLconst(v *Value) bool { // match: (MULLconst [ 0] _) // result: (MOVLconst [0]) for { - if v.AuxInt != 0 { + if auxIntToInt32(v.AuxInt) != 0 { break } v.reset(OpAMD64MOVLconst) - v.AuxInt = 0 + v.AuxInt = int32ToAuxInt(0) return true } // match: (MULLconst [ 1] x) // result: x for { - if v.AuxInt != 1 { + if auxIntToInt32(v.AuxInt) != 1 { break } x := v_0 @@ -15702,7 +15663,7 @@ func rewriteValueAMD64_OpAMD64MULLconst(v *Value) bool { // match: (MULLconst [ 3] x) // result: (LEAL2 x x) for { - if v.AuxInt != 3 { + if auxIntToInt32(v.AuxInt) != 3 { break } x := v_0 @@ -15713,7 +15674,7 @@ func rewriteValueAMD64_OpAMD64MULLconst(v *Value) bool { // match: (MULLconst [ 5] x) // result: (LEAL4 x x) for { - if v.AuxInt != 5 { + if auxIntToInt32(v.AuxInt) != 5 { break } x := v_0 @@ -15724,7 +15685,7 @@ func rewriteValueAMD64_OpAMD64MULLconst(v *Value) bool { // match: (MULLconst [ 7] x) // result: (LEAL2 x (LEAL2 <v.Type> x x)) for { - if v.AuxInt != 7 { + if auxIntToInt32(v.AuxInt) != 7 { break } x := v_0 @@ -15737,7 +15698,7 @@ func rewriteValueAMD64_OpAMD64MULLconst(v *Value) bool { // match: (MULLconst [ 9] x) // result: (LEAL8 x x) for { - if v.AuxInt != 9 { + if auxIntToInt32(v.AuxInt) != 9 { break } x := v_0 @@ -15748,7 +15709,7 @@ func rewriteValueAMD64_OpAMD64MULLconst(v *Value) bool { // match: (MULLconst [11] x) // result: (LEAL2 x (LEAL4 <v.Type> x x)) for { - if v.AuxInt != 11 { + if auxIntToInt32(v.AuxInt) != 11 { break } x := v_0 @@ -15761,7 +15722,7 @@ func rewriteValueAMD64_OpAMD64MULLconst(v *Value) bool { // match: (MULLconst [13] x) // result: (LEAL4 x (LEAL2 <v.Type> x x)) for { - if v.AuxInt != 13 { + if auxIntToInt32(v.AuxInt) != 13 { break } x := v_0 @@ -15774,7 +15735,7 @@ func rewriteValueAMD64_OpAMD64MULLconst(v *Value) bool { // match: (MULLconst [19] x) // result: (LEAL2 x (LEAL8 <v.Type> x x)) for { - if v.AuxInt != 19 { + if auxIntToInt32(v.AuxInt) != 19 { break } x := v_0 @@ -15787,7 +15748,7 @@ func rewriteValueAMD64_OpAMD64MULLconst(v *Value) bool { // match: (MULLconst [21] x) // result: (LEAL4 x (LEAL4 <v.Type> x x)) for { - if v.AuxInt != 21 { + if auxIntToInt32(v.AuxInt) != 21 { break } x := v_0 @@ -15800,7 +15761,7 @@ func rewriteValueAMD64_OpAMD64MULLconst(v *Value) bool { // match: (MULLconst [25] x) // result: (LEAL8 x (LEAL2 <v.Type> x x)) for { - if v.AuxInt != 25 { + if auxIntToInt32(v.AuxInt) != 25 { break } x := v_0 @@ -15813,7 +15774,7 @@ func rewriteValueAMD64_OpAMD64MULLconst(v *Value) bool { // match: (MULLconst [27] x) // result: (LEAL8 (LEAL2 <v.Type> x x) (LEAL2 <v.Type> x x)) for { - if v.AuxInt != 27 { + if auxIntToInt32(v.AuxInt) != 27 { break } x := v_0 @@ -15826,7 +15787,7 @@ func rewriteValueAMD64_OpAMD64MULLconst(v *Value) bool { // match: (MULLconst [37] x) // result: (LEAL4 x (LEAL8 <v.Type> x x)) for { - if v.AuxInt != 37 { + if auxIntToInt32(v.AuxInt) != 37 { break } x := v_0 @@ -15839,7 +15800,7 @@ func rewriteValueAMD64_OpAMD64MULLconst(v *Value) bool { // match: (MULLconst [41] x) // result: (LEAL8 x (LEAL4 <v.Type> x x)) for { - if v.AuxInt != 41 { + if auxIntToInt32(v.AuxInt) != 41 { break } x := v_0 @@ -15852,7 +15813,7 @@ func rewriteValueAMD64_OpAMD64MULLconst(v *Value) bool { // match: (MULLconst [45] x) // result: (LEAL8 (LEAL4 <v.Type> x x) (LEAL4 <v.Type> x x)) for { - if v.AuxInt != 45 { + if auxIntToInt32(v.AuxInt) != 45 { break } x := v_0 @@ -15865,7 +15826,7 @@ func rewriteValueAMD64_OpAMD64MULLconst(v *Value) bool { // match: (MULLconst [73] x) // result: (LEAL8 x (LEAL8 <v.Type> x x)) for { - if v.AuxInt != 73 { + if auxIntToInt32(v.AuxInt) != 73 { break } x := v_0 @@ -15878,7 +15839,7 @@ func rewriteValueAMD64_OpAMD64MULLconst(v *Value) bool { // match: (MULLconst [81] x) // result: (LEAL8 (LEAL8 <v.Type> x x) (LEAL8 <v.Type> x x)) for { - if v.AuxInt != 81 { + if auxIntToInt32(v.AuxInt) != 81 { break } x := v_0 @@ -15889,128 +15850,128 @@ func rewriteValueAMD64_OpAMD64MULLconst(v *Value) bool { return true } // match: (MULLconst [c] x) - // cond: isPowerOfTwo(c+1) && c >= 15 - // result: (SUBL (SHLLconst <v.Type> [log2(c+1)] x) x) + // cond: isPowerOfTwo(int64(c)+1) && c >= 15 + // result: (SUBL (SHLLconst <v.Type> [int8(log2(int64(c)+1))] x) x) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) x := v_0 - if !(isPowerOfTwo(c+1) && c >= 15) { + if !(isPowerOfTwo(int64(c)+1) && c >= 15) { break } v.reset(OpAMD64SUBL) v0 := b.NewValue0(v.Pos, OpAMD64SHLLconst, v.Type) - v0.AuxInt = log2(c + 1) + v0.AuxInt = int8ToAuxInt(int8(log2(int64(c) + 1))) v0.AddArg(x) v.AddArg2(v0, x) return true } // match: (MULLconst [c] x) - // cond: isPowerOfTwo(c-1) && c >= 17 - // result: (LEAL1 (SHLLconst <v.Type> [log2(c-1)] x) x) + // cond: isPowerOfTwo32(c-1) && c >= 17 + // result: (LEAL1 (SHLLconst <v.Type> [int8(log32(c-1))] x) x) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) x := v_0 - if !(isPowerOfTwo(c-1) && c >= 17) { + if !(isPowerOfTwo32(c-1) && c >= 17) { break } v.reset(OpAMD64LEAL1) v0 := b.NewValue0(v.Pos, OpAMD64SHLLconst, v.Type) - v0.AuxInt = log2(c - 1) + v0.AuxInt = int8ToAuxInt(int8(log32(c - 1))) v0.AddArg(x) v.AddArg2(v0, x) return true } // match: (MULLconst [c] x) - // cond: isPowerOfTwo(c-2) && c >= 34 - // result: (LEAL2 (SHLLconst <v.Type> [log2(c-2)] x) x) + // cond: isPowerOfTwo32(c-2) && c >= 34 + // result: (LEAL2 (SHLLconst <v.Type> [int8(log32(c-2))] x) x) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) x := v_0 - if !(isPowerOfTwo(c-2) && c >= 34) { + if !(isPowerOfTwo32(c-2) && c >= 34) { break } v.reset(OpAMD64LEAL2) v0 := b.NewValue0(v.Pos, OpAMD64SHLLconst, v.Type) - v0.AuxInt = log2(c - 2) + v0.AuxInt = int8ToAuxInt(int8(log32(c - 2))) v0.AddArg(x) v.AddArg2(v0, x) return true } // match: (MULLconst [c] x) - // cond: isPowerOfTwo(c-4) && c >= 68 - // result: (LEAL4 (SHLLconst <v.Type> [log2(c-4)] x) x) + // cond: isPowerOfTwo32(c-4) && c >= 68 + // result: (LEAL4 (SHLLconst <v.Type> [int8(log32(c-4))] x) x) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) x := v_0 - if !(isPowerOfTwo(c-4) && c >= 68) { + if !(isPowerOfTwo32(c-4) && c >= 68) { break } v.reset(OpAMD64LEAL4) v0 := b.NewValue0(v.Pos, OpAMD64SHLLconst, v.Type) - v0.AuxInt = log2(c - 4) + v0.AuxInt = int8ToAuxInt(int8(log32(c - 4))) v0.AddArg(x) v.AddArg2(v0, x) return true } // match: (MULLconst [c] x) - // cond: isPowerOfTwo(c-8) && c >= 136 - // result: (LEAL8 (SHLLconst <v.Type> [log2(c-8)] x) x) + // cond: isPowerOfTwo32(c-8) && c >= 136 + // result: (LEAL8 (SHLLconst <v.Type> [int8(log32(c-8))] x) x) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) x := v_0 - if !(isPowerOfTwo(c-8) && c >= 136) { + if !(isPowerOfTwo32(c-8) && c >= 136) { break } v.reset(OpAMD64LEAL8) v0 := b.NewValue0(v.Pos, OpAMD64SHLLconst, v.Type) - v0.AuxInt = log2(c - 8) + v0.AuxInt = int8ToAuxInt(int8(log32(c - 8))) v0.AddArg(x) v.AddArg2(v0, x) return true } // match: (MULLconst [c] x) - // cond: c%3 == 0 && isPowerOfTwo(c/3) - // result: (SHLLconst [log2(c/3)] (LEAL2 <v.Type> x x)) + // cond: c%3 == 0 && isPowerOfTwo32(c/3) + // result: (SHLLconst [int8(log32(c/3))] (LEAL2 <v.Type> x x)) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) x := v_0 - if !(c%3 == 0 && isPowerOfTwo(c/3)) { + if !(c%3 == 0 && isPowerOfTwo32(c/3)) { break } v.reset(OpAMD64SHLLconst) - v.AuxInt = log2(c / 3) + v.AuxInt = int8ToAuxInt(int8(log32(c / 3))) v0 := b.NewValue0(v.Pos, OpAMD64LEAL2, v.Type) v0.AddArg2(x, x) v.AddArg(v0) return true } // match: (MULLconst [c] x) - // cond: c%5 == 0 && isPowerOfTwo(c/5) - // result: (SHLLconst [log2(c/5)] (LEAL4 <v.Type> x x)) + // cond: c%5 == 0 && isPowerOfTwo32(c/5) + // result: (SHLLconst [int8(log32(c/5))] (LEAL4 <v.Type> x x)) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) x := v_0 - if !(c%5 == 0 && isPowerOfTwo(c/5)) { + if !(c%5 == 0 && isPowerOfTwo32(c/5)) { break } v.reset(OpAMD64SHLLconst) - v.AuxInt = log2(c / 5) + v.AuxInt = int8ToAuxInt(int8(log32(c / 5))) v0 := b.NewValue0(v.Pos, OpAMD64LEAL4, v.Type) v0.AddArg2(x, x) v.AddArg(v0) return true } // match: (MULLconst [c] x) - // cond: c%9 == 0 && isPowerOfTwo(c/9) - // result: (SHLLconst [log2(c/9)] (LEAL8 <v.Type> x x)) + // cond: c%9 == 0 && isPowerOfTwo32(c/9) + // result: (SHLLconst [int8(log32(c/9))] (LEAL8 <v.Type> x x)) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) x := v_0 - if !(c%9 == 0 && isPowerOfTwo(c/9)) { + if !(c%9 == 0 && isPowerOfTwo32(c/9)) { break } v.reset(OpAMD64SHLLconst) - v.AuxInt = log2(c / 9) + v.AuxInt = int8ToAuxInt(int8(log32(c / 9))) v0 := b.NewValue0(v.Pos, OpAMD64LEAL8, v.Type) v0.AddArg2(x, x) v.AddArg(v0) @@ -16035,19 +15996,19 @@ func rewriteValueAMD64_OpAMD64MULQ(v *Value) bool { v_0 := v.Args[0] // match: (MULQ x (MOVQconst [c])) // cond: is32Bit(c) - // result: (MULQconst [c] x) + // result: (MULQconst [int32(c)] x) for { for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { x := v_0 if v_1.Op != OpAMD64MOVQconst { continue } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) if !(is32Bit(c)) { continue } v.reset(OpAMD64MULQconst) - v.AuxInt = c + v.AuxInt = int32ToAuxInt(int32(c)) v.AddArg(x) return true } @@ -16059,27 +16020,27 @@ func rewriteValueAMD64_OpAMD64MULQconst(v *Value) bool { v_0 := v.Args[0] b := v.Block // match: (MULQconst [c] (MULQconst [d] x)) - // cond: is32Bit(c*d) + // cond: is32Bit(int64(c)*int64(d)) // result: (MULQconst [c * d] x) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) if v_0.Op != OpAMD64MULQconst { break } - d := v_0.AuxInt + d := auxIntToInt32(v_0.AuxInt) x := v_0.Args[0] - if !(is32Bit(c * d)) { + if !(is32Bit(int64(c) * int64(d))) { break } v.reset(OpAMD64MULQconst) - v.AuxInt = c * d + v.AuxInt = int32ToAuxInt(c * d) v.AddArg(x) return true } // match: (MULQconst [-9] x) // result: (NEGQ (LEAQ8 <v.Type> x x)) for { - if v.AuxInt != -9 { + if auxIntToInt32(v.AuxInt) != -9 { break } x := v_0 @@ -16092,7 +16053,7 @@ func rewriteValueAMD64_OpAMD64MULQconst(v *Value) bool { // match: (MULQconst [-5] x) // result: (NEGQ (LEAQ4 <v.Type> x x)) for { - if v.AuxInt != -5 { + if auxIntToInt32(v.AuxInt) != -5 { break } x := v_0 @@ -16105,7 +16066,7 @@ func rewriteValueAMD64_OpAMD64MULQconst(v *Value) bool { // match: (MULQconst [-3] x) // result: (NEGQ (LEAQ2 <v.Type> x x)) for { - if v.AuxInt != -3 { + if auxIntToInt32(v.AuxInt) != -3 { break } x := v_0 @@ -16118,7 +16079,7 @@ func rewriteValueAMD64_OpAMD64MULQconst(v *Value) bool { // match: (MULQconst [-1] x) // result: (NEGQ x) for { - if v.AuxInt != -1 { + if auxIntToInt32(v.AuxInt) != -1 { break } x := v_0 @@ -16129,17 +16090,17 @@ func rewriteValueAMD64_OpAMD64MULQconst(v *Value) bool { // match: (MULQconst [ 0] _) // result: (MOVQconst [0]) for { - if v.AuxInt != 0 { + if auxIntToInt32(v.AuxInt) != 0 { break } v.reset(OpAMD64MOVQconst) - v.AuxInt = 0 + v.AuxInt = int64ToAuxInt(0) return true } // match: (MULQconst [ 1] x) // result: x for { - if v.AuxInt != 1 { + if auxIntToInt32(v.AuxInt) != 1 { break } x := v_0 @@ -16149,7 +16110,7 @@ func rewriteValueAMD64_OpAMD64MULQconst(v *Value) bool { // match: (MULQconst [ 3] x) // result: (LEAQ2 x x) for { - if v.AuxInt != 3 { + if auxIntToInt32(v.AuxInt) != 3 { break } x := v_0 @@ -16160,7 +16121,7 @@ func rewriteValueAMD64_OpAMD64MULQconst(v *Value) bool { // match: (MULQconst [ 5] x) // result: (LEAQ4 x x) for { - if v.AuxInt != 5 { + if auxIntToInt32(v.AuxInt) != 5 { break } x := v_0 @@ -16171,7 +16132,7 @@ func rewriteValueAMD64_OpAMD64MULQconst(v *Value) bool { // match: (MULQconst [ 7] x) // result: (LEAQ2 x (LEAQ2 <v.Type> x x)) for { - if v.AuxInt != 7 { + if auxIntToInt32(v.AuxInt) != 7 { break } x := v_0 @@ -16184,7 +16145,7 @@ func rewriteValueAMD64_OpAMD64MULQconst(v *Value) bool { // match: (MULQconst [ 9] x) // result: (LEAQ8 x x) for { - if v.AuxInt != 9 { + if auxIntToInt32(v.AuxInt) != 9 { break } x := v_0 @@ -16195,7 +16156,7 @@ func rewriteValueAMD64_OpAMD64MULQconst(v *Value) bool { // match: (MULQconst [11] x) // result: (LEAQ2 x (LEAQ4 <v.Type> x x)) for { - if v.AuxInt != 11 { + if auxIntToInt32(v.AuxInt) != 11 { break } x := v_0 @@ -16208,7 +16169,7 @@ func rewriteValueAMD64_OpAMD64MULQconst(v *Value) bool { // match: (MULQconst [13] x) // result: (LEAQ4 x (LEAQ2 <v.Type> x x)) for { - if v.AuxInt != 13 { + if auxIntToInt32(v.AuxInt) != 13 { break } x := v_0 @@ -16221,7 +16182,7 @@ func rewriteValueAMD64_OpAMD64MULQconst(v *Value) bool { // match: (MULQconst [19] x) // result: (LEAQ2 x (LEAQ8 <v.Type> x x)) for { - if v.AuxInt != 19 { + if auxIntToInt32(v.AuxInt) != 19 { break } x := v_0 @@ -16234,7 +16195,7 @@ func rewriteValueAMD64_OpAMD64MULQconst(v *Value) bool { // match: (MULQconst [21] x) // result: (LEAQ4 x (LEAQ4 <v.Type> x x)) for { - if v.AuxInt != 21 { + if auxIntToInt32(v.AuxInt) != 21 { break } x := v_0 @@ -16247,7 +16208,7 @@ func rewriteValueAMD64_OpAMD64MULQconst(v *Value) bool { // match: (MULQconst [25] x) // result: (LEAQ8 x (LEAQ2 <v.Type> x x)) for { - if v.AuxInt != 25 { + if auxIntToInt32(v.AuxInt) != 25 { break } x := v_0 @@ -16260,7 +16221,7 @@ func rewriteValueAMD64_OpAMD64MULQconst(v *Value) bool { // match: (MULQconst [27] x) // result: (LEAQ8 (LEAQ2 <v.Type> x x) (LEAQ2 <v.Type> x x)) for { - if v.AuxInt != 27 { + if auxIntToInt32(v.AuxInt) != 27 { break } x := v_0 @@ -16273,7 +16234,7 @@ func rewriteValueAMD64_OpAMD64MULQconst(v *Value) bool { // match: (MULQconst [37] x) // result: (LEAQ4 x (LEAQ8 <v.Type> x x)) for { - if v.AuxInt != 37 { + if auxIntToInt32(v.AuxInt) != 37 { break } x := v_0 @@ -16286,7 +16247,7 @@ func rewriteValueAMD64_OpAMD64MULQconst(v *Value) bool { // match: (MULQconst [41] x) // result: (LEAQ8 x (LEAQ4 <v.Type> x x)) for { - if v.AuxInt != 41 { + if auxIntToInt32(v.AuxInt) != 41 { break } x := v_0 @@ -16299,7 +16260,7 @@ func rewriteValueAMD64_OpAMD64MULQconst(v *Value) bool { // match: (MULQconst [45] x) // result: (LEAQ8 (LEAQ4 <v.Type> x x) (LEAQ4 <v.Type> x x)) for { - if v.AuxInt != 45 { + if auxIntToInt32(v.AuxInt) != 45 { break } x := v_0 @@ -16312,7 +16273,7 @@ func rewriteValueAMD64_OpAMD64MULQconst(v *Value) bool { // match: (MULQconst [73] x) // result: (LEAQ8 x (LEAQ8 <v.Type> x x)) for { - if v.AuxInt != 73 { + if auxIntToInt32(v.AuxInt) != 73 { break } x := v_0 @@ -16325,7 +16286,7 @@ func rewriteValueAMD64_OpAMD64MULQconst(v *Value) bool { // match: (MULQconst [81] x) // result: (LEAQ8 (LEAQ8 <v.Type> x x) (LEAQ8 <v.Type> x x)) for { - if v.AuxInt != 81 { + if auxIntToInt32(v.AuxInt) != 81 { break } x := v_0 @@ -16336,128 +16297,128 @@ func rewriteValueAMD64_OpAMD64MULQconst(v *Value) bool { return true } // match: (MULQconst [c] x) - // cond: isPowerOfTwo(c+1) && c >= 15 - // result: (SUBQ (SHLQconst <v.Type> [log2(c+1)] x) x) + // cond: isPowerOfTwo(int64(c)+1) && c >= 15 + // result: (SUBQ (SHLQconst <v.Type> [int8(log2(int64(c)+1))] x) x) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) x := v_0 - if !(isPowerOfTwo(c+1) && c >= 15) { + if !(isPowerOfTwo(int64(c)+1) && c >= 15) { break } v.reset(OpAMD64SUBQ) v0 := b.NewValue0(v.Pos, OpAMD64SHLQconst, v.Type) - v0.AuxInt = log2(c + 1) + v0.AuxInt = int8ToAuxInt(int8(log2(int64(c) + 1))) v0.AddArg(x) v.AddArg2(v0, x) return true } // match: (MULQconst [c] x) - // cond: isPowerOfTwo(c-1) && c >= 17 - // result: (LEAQ1 (SHLQconst <v.Type> [log2(c-1)] x) x) + // cond: isPowerOfTwo32(c-1) && c >= 17 + // result: (LEAQ1 (SHLQconst <v.Type> [int8(log32(c-1))] x) x) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) x := v_0 - if !(isPowerOfTwo(c-1) && c >= 17) { + if !(isPowerOfTwo32(c-1) && c >= 17) { break } v.reset(OpAMD64LEAQ1) v0 := b.NewValue0(v.Pos, OpAMD64SHLQconst, v.Type) - v0.AuxInt = log2(c - 1) + v0.AuxInt = int8ToAuxInt(int8(log32(c - 1))) v0.AddArg(x) v.AddArg2(v0, x) return true } // match: (MULQconst [c] x) - // cond: isPowerOfTwo(c-2) && c >= 34 - // result: (LEAQ2 (SHLQconst <v.Type> [log2(c-2)] x) x) + // cond: isPowerOfTwo32(c-2) && c >= 34 + // result: (LEAQ2 (SHLQconst <v.Type> [int8(log32(c-2))] x) x) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) x := v_0 - if !(isPowerOfTwo(c-2) && c >= 34) { + if !(isPowerOfTwo32(c-2) && c >= 34) { break } v.reset(OpAMD64LEAQ2) v0 := b.NewValue0(v.Pos, OpAMD64SHLQconst, v.Type) - v0.AuxInt = log2(c - 2) + v0.AuxInt = int8ToAuxInt(int8(log32(c - 2))) v0.AddArg(x) v.AddArg2(v0, x) return true } // match: (MULQconst [c] x) - // cond: isPowerOfTwo(c-4) && c >= 68 - // result: (LEAQ4 (SHLQconst <v.Type> [log2(c-4)] x) x) + // cond: isPowerOfTwo32(c-4) && c >= 68 + // result: (LEAQ4 (SHLQconst <v.Type> [int8(log32(c-4))] x) x) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) x := v_0 - if !(isPowerOfTwo(c-4) && c >= 68) { + if !(isPowerOfTwo32(c-4) && c >= 68) { break } v.reset(OpAMD64LEAQ4) v0 := b.NewValue0(v.Pos, OpAMD64SHLQconst, v.Type) - v0.AuxInt = log2(c - 4) + v0.AuxInt = int8ToAuxInt(int8(log32(c - 4))) v0.AddArg(x) v.AddArg2(v0, x) return true } // match: (MULQconst [c] x) - // cond: isPowerOfTwo(c-8) && c >= 136 - // result: (LEAQ8 (SHLQconst <v.Type> [log2(c-8)] x) x) + // cond: isPowerOfTwo32(c-8) && c >= 136 + // result: (LEAQ8 (SHLQconst <v.Type> [int8(log32(c-8))] x) x) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) x := v_0 - if !(isPowerOfTwo(c-8) && c >= 136) { + if !(isPowerOfTwo32(c-8) && c >= 136) { break } v.reset(OpAMD64LEAQ8) v0 := b.NewValue0(v.Pos, OpAMD64SHLQconst, v.Type) - v0.AuxInt = log2(c - 8) + v0.AuxInt = int8ToAuxInt(int8(log32(c - 8))) v0.AddArg(x) v.AddArg2(v0, x) return true } // match: (MULQconst [c] x) - // cond: c%3 == 0 && isPowerOfTwo(c/3) - // result: (SHLQconst [log2(c/3)] (LEAQ2 <v.Type> x x)) + // cond: c%3 == 0 && isPowerOfTwo32(c/3) + // result: (SHLQconst [int8(log32(c/3))] (LEAQ2 <v.Type> x x)) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) x := v_0 - if !(c%3 == 0 && isPowerOfTwo(c/3)) { + if !(c%3 == 0 && isPowerOfTwo32(c/3)) { break } v.reset(OpAMD64SHLQconst) - v.AuxInt = log2(c / 3) + v.AuxInt = int8ToAuxInt(int8(log32(c / 3))) v0 := b.NewValue0(v.Pos, OpAMD64LEAQ2, v.Type) v0.AddArg2(x, x) v.AddArg(v0) return true } // match: (MULQconst [c] x) - // cond: c%5 == 0 && isPowerOfTwo(c/5) - // result: (SHLQconst [log2(c/5)] (LEAQ4 <v.Type> x x)) + // cond: c%5 == 0 && isPowerOfTwo32(c/5) + // result: (SHLQconst [int8(log32(c/5))] (LEAQ4 <v.Type> x x)) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) x := v_0 - if !(c%5 == 0 && isPowerOfTwo(c/5)) { + if !(c%5 == 0 && isPowerOfTwo32(c/5)) { break } v.reset(OpAMD64SHLQconst) - v.AuxInt = log2(c / 5) + v.AuxInt = int8ToAuxInt(int8(log32(c / 5))) v0 := b.NewValue0(v.Pos, OpAMD64LEAQ4, v.Type) v0.AddArg2(x, x) v.AddArg(v0) return true } // match: (MULQconst [c] x) - // cond: c%9 == 0 && isPowerOfTwo(c/9) - // result: (SHLQconst [log2(c/9)] (LEAQ8 <v.Type> x x)) + // cond: c%9 == 0 && isPowerOfTwo32(c/9) + // result: (SHLQconst [int8(log32(c/9))] (LEAQ8 <v.Type> x x)) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) x := v_0 - if !(c%9 == 0 && isPowerOfTwo(c/9)) { + if !(c%9 == 0 && isPowerOfTwo32(c/9)) { break } v.reset(OpAMD64SHLQconst) - v.AuxInt = log2(c / 9) + v.AuxInt = int8ToAuxInt(int8(log32(c / 9))) v0 := b.NewValue0(v.Pos, OpAMD64LEAQ8, v.Type) v0.AddArg2(x, x) v.AddArg(v0) @@ -16531,24 +16492,24 @@ func rewriteValueAMD64_OpAMD64MULSDload(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (MULSDload [off1] {sym} val (ADDQconst [off2] base) mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (MULSDload [off1+off2] {sym} val base mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) val := v_0 if v_1.Op != OpAMD64ADDQconst { break } - off2 := v_1.AuxInt + off2 := auxIntToInt32(v_1.AuxInt) base := v_1.Args[0] mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64MULSDload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(val, base, mem) return true } @@ -16634,24 +16595,24 @@ func rewriteValueAMD64_OpAMD64MULSSload(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (MULSSload [off1] {sym} val (ADDQconst [off2] base) mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (MULSSload [off1+off2] {sym} val base mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) val := v_0 if v_1.Op != OpAMD64ADDQconst { break } - off2 := v_1.AuxInt + off2 := auxIntToInt32(v_1.AuxInt) base := v_1.Args[0] mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64MULSSload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(val, base, mem) return true } @@ -16849,7 +16810,7 @@ func rewriteValueAMD64_OpAMD64ORL(v *Value) bool { } y := v_0.Args[1] v_0_0 := v_0.Args[0] - if v_0_0.Op != OpAMD64MOVLconst || v_0_0.AuxInt != 1 { + if v_0_0.Op != OpAMD64MOVLconst || auxIntToInt32(v_0_0.AuxInt) != 1 { continue } x := v_1 @@ -16860,20 +16821,20 @@ func rewriteValueAMD64_OpAMD64ORL(v *Value) bool { break } // match: (ORL (MOVLconst [c]) x) - // cond: isUint32PowerOfTwo(c) && uint64(c) >= 128 - // result: (BTSLconst [log2uint32(c)] x) + // cond: isUint32PowerOfTwo(int64(c)) && uint64(c) >= 128 + // result: (BTSLconst [int8(log32(c))] x) for { for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { if v_0.Op != OpAMD64MOVLconst { continue } - c := v_0.AuxInt + c := auxIntToInt32(v_0.AuxInt) x := v_1 - if !(isUint32PowerOfTwo(c) && uint64(c) >= 128) { + if !(isUint32PowerOfTwo(int64(c)) && uint64(c) >= 128) { continue } v.reset(OpAMD64BTSLconst) - v.AuxInt = log2uint32(c) + v.AuxInt = int8ToAuxInt(int8(log32(c))) v.AddArg(x) return true } @@ -16887,9 +16848,9 @@ func rewriteValueAMD64_OpAMD64ORL(v *Value) bool { if v_1.Op != OpAMD64MOVLconst { continue } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) v.reset(OpAMD64ORLconst) - v.AuxInt = c + v.AuxInt = int32ToAuxInt(c) v.AddArg(x) return true } @@ -16903,17 +16864,17 @@ func rewriteValueAMD64_OpAMD64ORL(v *Value) bool { if v_0.Op != OpAMD64SHLLconst { continue } - c := v_0.AuxInt + c := auxIntToInt8(v_0.AuxInt) x := v_0.Args[0] if v_1.Op != OpAMD64SHRLconst { continue } - d := v_1.AuxInt + d := auxIntToInt8(v_1.AuxInt) if x != v_1.Args[0] || !(d == 32-c) { continue } v.reset(OpAMD64ROLLconst) - v.AuxInt = c + v.AuxInt = int8ToAuxInt(c) v.AddArg(x) return true } @@ -16928,17 +16889,17 @@ func rewriteValueAMD64_OpAMD64ORL(v *Value) bool { if v_0.Op != OpAMD64SHLLconst { continue } - c := v_0.AuxInt + c := auxIntToInt8(v_0.AuxInt) x := v_0.Args[0] if v_1.Op != OpAMD64SHRWconst { continue } - d := v_1.AuxInt + d := auxIntToInt8(v_1.AuxInt) if x != v_1.Args[0] || !(d == 16-c && c < 16 && t.Size() == 2) { continue } v.reset(OpAMD64ROLWconst) - v.AuxInt = c + v.AuxInt = int8ToAuxInt(c) v.AddArg(x) return true } @@ -16953,17 +16914,17 @@ func rewriteValueAMD64_OpAMD64ORL(v *Value) bool { if v_0.Op != OpAMD64SHLLconst { continue } - c := v_0.AuxInt + c := auxIntToInt8(v_0.AuxInt) x := v_0.Args[0] if v_1.Op != OpAMD64SHRBconst { continue } - d := v_1.AuxInt + d := auxIntToInt8(v_1.AuxInt) if x != v_1.Args[0] || !(d == 8-c && c < 8 && t.Size() == 1) { continue } v.reset(OpAMD64ROLBconst) - v.AuxInt = c + v.AuxInt = int8ToAuxInt(c) v.AddArg(x) return true } @@ -16997,7 +16958,7 @@ func rewriteValueAMD64_OpAMD64ORL(v *Value) bool { continue } v_1_1_0 := v_1_1.Args[0] - if v_1_1_0.Op != OpAMD64CMPQconst || v_1_1_0.AuxInt != 32 { + if v_1_1_0.Op != OpAMD64CMPQconst || auxIntToInt32(v_1_1_0.AuxInt) != 32 { continue } v_1_1_0_0 := v_1_1_0.Args[0] @@ -17005,11 +16966,11 @@ func rewriteValueAMD64_OpAMD64ORL(v *Value) bool { continue } v_1_1_0_0_0 := v_1_1_0_0.Args[0] - if v_1_1_0_0_0.Op != OpAMD64ADDQconst || v_1_1_0_0_0.AuxInt != -32 { + if v_1_1_0_0_0.Op != OpAMD64ADDQconst || auxIntToInt32(v_1_1_0_0_0.AuxInt) != -32 { continue } v_1_1_0_0_0_0 := v_1_1_0_0_0.Args[0] - if v_1_1_0_0_0_0.Op != OpAMD64ANDQconst || v_1_1_0_0_0_0.AuxInt != 31 || y != v_1_1_0_0_0_0.Args[0] { + if v_1_1_0_0_0_0.Op != OpAMD64ANDQconst || auxIntToInt32(v_1_1_0_0_0_0.AuxInt) != 31 || y != v_1_1_0_0_0_0.Args[0] { continue } v.reset(OpAMD64ROLL) @@ -17047,7 +17008,7 @@ func rewriteValueAMD64_OpAMD64ORL(v *Value) bool { continue } v_1_1_0 := v_1_1.Args[0] - if v_1_1_0.Op != OpAMD64CMPLconst || v_1_1_0.AuxInt != 32 { + if v_1_1_0.Op != OpAMD64CMPLconst || auxIntToInt32(v_1_1_0.AuxInt) != 32 { continue } v_1_1_0_0 := v_1_1_0.Args[0] @@ -17055,11 +17016,11 @@ func rewriteValueAMD64_OpAMD64ORL(v *Value) bool { continue } v_1_1_0_0_0 := v_1_1_0_0.Args[0] - if v_1_1_0_0_0.Op != OpAMD64ADDLconst || v_1_1_0_0_0.AuxInt != -32 { + if v_1_1_0_0_0.Op != OpAMD64ADDLconst || auxIntToInt32(v_1_1_0_0_0.AuxInt) != -32 { continue } v_1_1_0_0_0_0 := v_1_1_0_0_0.Args[0] - if v_1_1_0_0_0_0.Op != OpAMD64ANDLconst || v_1_1_0_0_0_0.AuxInt != 31 || y != v_1_1_0_0_0_0.Args[0] { + if v_1_1_0_0_0_0.Op != OpAMD64ANDLconst || auxIntToInt32(v_1_1_0_0_0_0.AuxInt) != 31 || y != v_1_1_0_0_0_0.Args[0] { continue } v.reset(OpAMD64ROLL) @@ -17097,7 +17058,7 @@ func rewriteValueAMD64_OpAMD64ORL(v *Value) bool { continue } v_1_1_0 := v_1_1.Args[0] - if v_1_1_0.Op != OpAMD64CMPQconst || v_1_1_0.AuxInt != 32 { + if v_1_1_0.Op != OpAMD64CMPQconst || auxIntToInt32(v_1_1_0.AuxInt) != 32 { continue } v_1_1_0_0 := v_1_1_0.Args[0] @@ -17105,11 +17066,11 @@ func rewriteValueAMD64_OpAMD64ORL(v *Value) bool { continue } v_1_1_0_0_0 := v_1_1_0_0.Args[0] - if v_1_1_0_0_0.Op != OpAMD64ADDQconst || v_1_1_0_0_0.AuxInt != -32 { + if v_1_1_0_0_0.Op != OpAMD64ADDQconst || auxIntToInt32(v_1_1_0_0_0.AuxInt) != -32 { continue } v_1_1_0_0_0_0 := v_1_1_0_0_0.Args[0] - if v_1_1_0_0_0_0.Op != OpAMD64ANDQconst || v_1_1_0_0_0_0.AuxInt != 31 || y != v_1_1_0_0_0_0.Args[0] { + if v_1_1_0_0_0_0.Op != OpAMD64ANDQconst || auxIntToInt32(v_1_1_0_0_0_0.AuxInt) != 31 || y != v_1_1_0_0_0_0.Args[0] { continue } v.reset(OpAMD64RORL) @@ -17147,7 +17108,7 @@ func rewriteValueAMD64_OpAMD64ORL(v *Value) bool { continue } v_1_1_0 := v_1_1.Args[0] - if v_1_1_0.Op != OpAMD64CMPLconst || v_1_1_0.AuxInt != 32 { + if v_1_1_0.Op != OpAMD64CMPLconst || auxIntToInt32(v_1_1_0.AuxInt) != 32 { continue } v_1_1_0_0 := v_1_1_0.Args[0] @@ -17155,11 +17116,11 @@ func rewriteValueAMD64_OpAMD64ORL(v *Value) bool { continue } v_1_1_0_0_0 := v_1_1_0_0.Args[0] - if v_1_1_0_0_0.Op != OpAMD64ADDLconst || v_1_1_0_0_0.AuxInt != -32 { + if v_1_1_0_0_0.Op != OpAMD64ADDLconst || auxIntToInt32(v_1_1_0_0_0.AuxInt) != -32 { continue } v_1_1_0_0_0_0 := v_1_1_0_0_0.Args[0] - if v_1_1_0_0_0_0.Op != OpAMD64ANDLconst || v_1_1_0_0_0_0.AuxInt != 31 || y != v_1_1_0_0_0_0.Args[0] { + if v_1_1_0_0_0_0.Op != OpAMD64ANDLconst || auxIntToInt32(v_1_1_0_0_0_0.AuxInt) != 31 || y != v_1_1_0_0_0_0.Args[0] { continue } v.reset(OpAMD64RORL) @@ -17308,7 +17269,7 @@ func rewriteValueAMD64_OpAMD64ORL(v *Value) bool { _ = v_0.Args[1] x := v_0.Args[0] v_0_1 := v_0.Args[1] - if v_0_1.Op != OpAMD64ANDQconst || v_0_1.AuxInt != 15 { + if v_0_1.Op != OpAMD64ANDQconst || auxIntToInt32(v_0_1.AuxInt) != 15 { continue } y := v_0_1.Args[0] @@ -17324,11 +17285,11 @@ func rewriteValueAMD64_OpAMD64ORL(v *Value) bool { continue } v_1_1_0 := v_1_1.Args[0] - if v_1_1_0.Op != OpAMD64ADDQconst || v_1_1_0.AuxInt != -16 { + if v_1_1_0.Op != OpAMD64ADDQconst || auxIntToInt32(v_1_1_0.AuxInt) != -16 { continue } v_1_1_0_0 := v_1_1_0.Args[0] - if v_1_1_0_0.Op != OpAMD64ANDQconst || v_1_1_0_0.AuxInt != 15 || y != v_1_1_0_0.Args[0] || !(v.Type.Size() == 2) { + if v_1_1_0_0.Op != OpAMD64ANDQconst || auxIntToInt32(v_1_1_0_0.AuxInt) != 15 || y != v_1_1_0_0.Args[0] || !(v.Type.Size() == 2) { continue } v.reset(OpAMD64RORW) @@ -17348,7 +17309,7 @@ func rewriteValueAMD64_OpAMD64ORL(v *Value) bool { _ = v_0.Args[1] x := v_0.Args[0] v_0_1 := v_0.Args[1] - if v_0_1.Op != OpAMD64ANDLconst || v_0_1.AuxInt != 15 { + if v_0_1.Op != OpAMD64ANDLconst || auxIntToInt32(v_0_1.AuxInt) != 15 { continue } y := v_0_1.Args[0] @@ -17364,11 +17325,11 @@ func rewriteValueAMD64_OpAMD64ORL(v *Value) bool { continue } v_1_1_0 := v_1_1.Args[0] - if v_1_1_0.Op != OpAMD64ADDLconst || v_1_1_0.AuxInt != -16 { + if v_1_1_0.Op != OpAMD64ADDLconst || auxIntToInt32(v_1_1_0.AuxInt) != -16 { continue } v_1_1_0_0 := v_1_1_0.Args[0] - if v_1_1_0_0.Op != OpAMD64ANDLconst || v_1_1_0_0.AuxInt != 15 || y != v_1_1_0_0.Args[0] || !(v.Type.Size() == 2) { + if v_1_1_0_0.Op != OpAMD64ANDLconst || auxIntToInt32(v_1_1_0_0.AuxInt) != 15 || y != v_1_1_0_0.Args[0] || !(v.Type.Size() == 2) { continue } v.reset(OpAMD64RORW) @@ -17388,7 +17349,7 @@ func rewriteValueAMD64_OpAMD64ORL(v *Value) bool { _ = v_0.Args[1] x := v_0.Args[0] v_0_1 := v_0.Args[1] - if v_0_1.Op != OpAMD64ANDQconst || v_0_1.AuxInt != 7 { + if v_0_1.Op != OpAMD64ANDQconst || auxIntToInt32(v_0_1.AuxInt) != 7 { continue } y := v_0_1.Args[0] @@ -17411,15 +17372,15 @@ func rewriteValueAMD64_OpAMD64ORL(v *Value) bool { continue } v_1_0_1_0 := v_1_0_1.Args[0] - if v_1_0_1_0.Op != OpAMD64ADDQconst || v_1_0_1_0.AuxInt != -8 { + if v_1_0_1_0.Op != OpAMD64ADDQconst || auxIntToInt32(v_1_0_1_0.AuxInt) != -8 { continue } v_1_0_1_0_0 := v_1_0_1_0.Args[0] - if v_1_0_1_0_0.Op != OpAMD64ANDQconst || v_1_0_1_0_0.AuxInt != 7 || y != v_1_0_1_0_0.Args[0] || v_1_1.Op != OpAMD64SBBLcarrymask { + if v_1_0_1_0_0.Op != OpAMD64ANDQconst || auxIntToInt32(v_1_0_1_0_0.AuxInt) != 7 || y != v_1_0_1_0_0.Args[0] || v_1_1.Op != OpAMD64SBBLcarrymask { continue } v_1_1_0 := v_1_1.Args[0] - if v_1_1_0.Op != OpAMD64CMPQconst || v_1_1_0.AuxInt != 8 { + if v_1_1_0.Op != OpAMD64CMPQconst || auxIntToInt32(v_1_1_0.AuxInt) != 8 { continue } v_1_1_0_0 := v_1_1_0.Args[0] @@ -17427,11 +17388,11 @@ func rewriteValueAMD64_OpAMD64ORL(v *Value) bool { continue } v_1_1_0_0_0 := v_1_1_0_0.Args[0] - if v_1_1_0_0_0.Op != OpAMD64ADDQconst || v_1_1_0_0_0.AuxInt != -8 { + if v_1_1_0_0_0.Op != OpAMD64ADDQconst || auxIntToInt32(v_1_1_0_0_0.AuxInt) != -8 { continue } v_1_1_0_0_0_0 := v_1_1_0_0_0.Args[0] - if v_1_1_0_0_0_0.Op != OpAMD64ANDQconst || v_1_1_0_0_0_0.AuxInt != 7 || y != v_1_1_0_0_0_0.Args[0] || !(v.Type.Size() == 1) { + if v_1_1_0_0_0_0.Op != OpAMD64ANDQconst || auxIntToInt32(v_1_1_0_0_0_0.AuxInt) != 7 || y != v_1_1_0_0_0_0.Args[0] || !(v.Type.Size() == 1) { continue } v.reset(OpAMD64ROLB) @@ -17452,7 +17413,7 @@ func rewriteValueAMD64_OpAMD64ORL(v *Value) bool { _ = v_0.Args[1] x := v_0.Args[0] v_0_1 := v_0.Args[1] - if v_0_1.Op != OpAMD64ANDLconst || v_0_1.AuxInt != 7 { + if v_0_1.Op != OpAMD64ANDLconst || auxIntToInt32(v_0_1.AuxInt) != 7 { continue } y := v_0_1.Args[0] @@ -17475,15 +17436,15 @@ func rewriteValueAMD64_OpAMD64ORL(v *Value) bool { continue } v_1_0_1_0 := v_1_0_1.Args[0] - if v_1_0_1_0.Op != OpAMD64ADDLconst || v_1_0_1_0.AuxInt != -8 { + if v_1_0_1_0.Op != OpAMD64ADDLconst || auxIntToInt32(v_1_0_1_0.AuxInt) != -8 { continue } v_1_0_1_0_0 := v_1_0_1_0.Args[0] - if v_1_0_1_0_0.Op != OpAMD64ANDLconst || v_1_0_1_0_0.AuxInt != 7 || y != v_1_0_1_0_0.Args[0] || v_1_1.Op != OpAMD64SBBLcarrymask { + if v_1_0_1_0_0.Op != OpAMD64ANDLconst || auxIntToInt32(v_1_0_1_0_0.AuxInt) != 7 || y != v_1_0_1_0_0.Args[0] || v_1_1.Op != OpAMD64SBBLcarrymask { continue } v_1_1_0 := v_1_1.Args[0] - if v_1_1_0.Op != OpAMD64CMPLconst || v_1_1_0.AuxInt != 8 { + if v_1_1_0.Op != OpAMD64CMPLconst || auxIntToInt32(v_1_1_0.AuxInt) != 8 { continue } v_1_1_0_0 := v_1_1_0.Args[0] @@ -17491,11 +17452,11 @@ func rewriteValueAMD64_OpAMD64ORL(v *Value) bool { continue } v_1_1_0_0_0 := v_1_1_0_0.Args[0] - if v_1_1_0_0_0.Op != OpAMD64ADDLconst || v_1_1_0_0_0.AuxInt != -8 { + if v_1_1_0_0_0.Op != OpAMD64ADDLconst || auxIntToInt32(v_1_1_0_0_0.AuxInt) != -8 { continue } v_1_1_0_0_0_0 := v_1_1_0_0_0.Args[0] - if v_1_1_0_0_0_0.Op != OpAMD64ANDLconst || v_1_1_0_0_0_0.AuxInt != 7 || y != v_1_1_0_0_0_0.Args[0] || !(v.Type.Size() == 1) { + if v_1_1_0_0_0_0.Op != OpAMD64ANDLconst || auxIntToInt32(v_1_1_0_0_0_0.AuxInt) != 7 || y != v_1_1_0_0_0_0.Args[0] || !(v.Type.Size() == 1) { continue } v.reset(OpAMD64ROLB) @@ -17516,7 +17477,7 @@ func rewriteValueAMD64_OpAMD64ORL(v *Value) bool { _ = v_0.Args[1] x := v_0.Args[0] v_0_1 := v_0.Args[1] - if v_0_1.Op != OpAMD64ANDQconst || v_0_1.AuxInt != 7 { + if v_0_1.Op != OpAMD64ANDQconst || auxIntToInt32(v_0_1.AuxInt) != 7 { continue } y := v_0_1.Args[0] @@ -17532,11 +17493,11 @@ func rewriteValueAMD64_OpAMD64ORL(v *Value) bool { continue } v_1_1_0 := v_1_1.Args[0] - if v_1_1_0.Op != OpAMD64ADDQconst || v_1_1_0.AuxInt != -8 { + if v_1_1_0.Op != OpAMD64ADDQconst || auxIntToInt32(v_1_1_0.AuxInt) != -8 { continue } v_1_1_0_0 := v_1_1_0.Args[0] - if v_1_1_0_0.Op != OpAMD64ANDQconst || v_1_1_0_0.AuxInt != 7 || y != v_1_1_0_0.Args[0] || !(v.Type.Size() == 1) { + if v_1_1_0_0.Op != OpAMD64ANDQconst || auxIntToInt32(v_1_1_0_0.AuxInt) != 7 || y != v_1_1_0_0.Args[0] || !(v.Type.Size() == 1) { continue } v.reset(OpAMD64RORB) @@ -17556,7 +17517,7 @@ func rewriteValueAMD64_OpAMD64ORL(v *Value) bool { _ = v_0.Args[1] x := v_0.Args[0] v_0_1 := v_0.Args[1] - if v_0_1.Op != OpAMD64ANDLconst || v_0_1.AuxInt != 7 { + if v_0_1.Op != OpAMD64ANDLconst || auxIntToInt32(v_0_1.AuxInt) != 7 { continue } y := v_0_1.Args[0] @@ -17572,11 +17533,11 @@ func rewriteValueAMD64_OpAMD64ORL(v *Value) bool { continue } v_1_1_0 := v_1_1.Args[0] - if v_1_1_0.Op != OpAMD64ADDLconst || v_1_1_0.AuxInt != -8 { + if v_1_1_0.Op != OpAMD64ADDLconst || auxIntToInt32(v_1_1_0.AuxInt) != -8 { continue } v_1_1_0_0 := v_1_1_0.Args[0] - if v_1_1_0_0.Op != OpAMD64ANDLconst || v_1_1_0_0.AuxInt != 7 || y != v_1_1_0_0.Args[0] || !(v.Type.Size() == 1) { + if v_1_1_0_0.Op != OpAMD64ANDLconst || auxIntToInt32(v_1_1_0_0.AuxInt) != 7 || y != v_1_1_0_0.Args[0] || !(v.Type.Size() == 1) { continue } v.reset(OpAMD64RORB) @@ -18203,16 +18164,16 @@ func rewriteValueAMD64_OpAMD64ORL(v *Value) bool { func rewriteValueAMD64_OpAMD64ORLconst(v *Value) bool { v_0 := v.Args[0] // match: (ORLconst [c] x) - // cond: isUint32PowerOfTwo(c) && uint64(c) >= 128 - // result: (BTSLconst [log2uint32(c)] x) + // cond: isUint32PowerOfTwo(int64(c)) && uint64(c) >= 128 + // result: (BTSLconst [int8(log32(c))] x) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) x := v_0 - if !(isUint32PowerOfTwo(c) && uint64(c) >= 128) { + if !(isUint32PowerOfTwo(int64(c)) && uint64(c) >= 128) { break } v.reset(OpAMD64BTSLconst) - v.AuxInt = log2uint32(c) + v.AuxInt = int8ToAuxInt(int8(log32(c))) v.AddArg(x) return true } @@ -18286,23 +18247,23 @@ func rewriteValueAMD64_OpAMD64ORLconstmodify(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (ORLconstmodify [valoff1] {sym} (ADDQconst [off2] base) mem) - // cond: ValAndOff(valoff1).canAdd(off2) - // result: (ORLconstmodify [ValAndOff(valoff1).add(off2)] {sym} base mem) + // cond: ValAndOff(valoff1).canAdd32(off2) + // result: (ORLconstmodify [ValAndOff(valoff1).addOffset32(off2)] {sym} base mem) for { - valoff1 := v.AuxInt - sym := v.Aux + valoff1 := auxIntToValAndOff(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] mem := v_1 - if !(ValAndOff(valoff1).canAdd(off2)) { + if !(ValAndOff(valoff1).canAdd32(off2)) { break } v.reset(OpAMD64ORLconstmodify) - v.AuxInt = ValAndOff(valoff1).add(off2) - v.Aux = sym + v.AuxInt = valAndOffToAuxInt(ValAndOff(valoff1).addOffset32(off2)) + v.Aux = symToAux(sym) v.AddArg2(base, mem) return true } @@ -18337,24 +18298,24 @@ func rewriteValueAMD64_OpAMD64ORLload(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (ORLload [off1] {sym} val (ADDQconst [off2] base) mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (ORLload [off1+off2] {sym} val base mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) val := v_0 if v_1.Op != OpAMD64ADDQconst { break } - off2 := v_1.AuxInt + off2 := auxIntToInt32(v_1.AuxInt) base := v_1.Args[0] mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64ORLload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(val, base, mem) return true } @@ -18408,24 +18369,24 @@ func rewriteValueAMD64_OpAMD64ORLmodify(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (ORLmodify [off1] {sym} (ADDQconst [off2] base) val mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (ORLmodify [off1+off2] {sym} base val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64ORLmodify) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(base, val, mem) return true } @@ -18468,7 +18429,7 @@ func rewriteValueAMD64_OpAMD64ORQ(v *Value) bool { } y := v_0.Args[1] v_0_0 := v_0.Args[0] - if v_0_0.Op != OpAMD64MOVQconst || v_0_0.AuxInt != 1 { + if v_0_0.Op != OpAMD64MOVQconst || auxIntToInt64(v_0_0.AuxInt) != 1 { continue } x := v_1 @@ -18480,19 +18441,19 @@ func rewriteValueAMD64_OpAMD64ORQ(v *Value) bool { } // match: (ORQ (MOVQconst [c]) x) // cond: isUint64PowerOfTwo(c) && uint64(c) >= 128 - // result: (BTSQconst [log2(c)] x) + // result: (BTSQconst [int8(log2(c))] x) for { for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { if v_0.Op != OpAMD64MOVQconst { continue } - c := v_0.AuxInt + c := auxIntToInt64(v_0.AuxInt) x := v_1 if !(isUint64PowerOfTwo(c) && uint64(c) >= 128) { continue } v.reset(OpAMD64BTSQconst) - v.AuxInt = log2(c) + v.AuxInt = int8ToAuxInt(int8(log2(c))) v.AddArg(x) return true } @@ -18500,19 +18461,19 @@ func rewriteValueAMD64_OpAMD64ORQ(v *Value) bool { } // match: (ORQ x (MOVQconst [c])) // cond: is32Bit(c) - // result: (ORQconst [c] x) + // result: (ORQconst [int32(c)] x) for { for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { x := v_0 if v_1.Op != OpAMD64MOVQconst { continue } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) if !(is32Bit(c)) { continue } v.reset(OpAMD64ORQconst) - v.AuxInt = c + v.AuxInt = int32ToAuxInt(int32(c)) v.AddArg(x) return true } @@ -18526,9 +18487,9 @@ func rewriteValueAMD64_OpAMD64ORQ(v *Value) bool { if v_1.Op != OpAMD64MOVLconst { continue } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) v.reset(OpAMD64ORQconst) - v.AuxInt = c + v.AuxInt = int32ToAuxInt(c) v.AddArg(x) return true } @@ -18542,17 +18503,17 @@ func rewriteValueAMD64_OpAMD64ORQ(v *Value) bool { if v_0.Op != OpAMD64SHLQconst { continue } - c := v_0.AuxInt + c := auxIntToInt8(v_0.AuxInt) x := v_0.Args[0] if v_1.Op != OpAMD64SHRQconst { continue } - d := v_1.AuxInt + d := auxIntToInt8(v_1.AuxInt) if x != v_1.Args[0] || !(d == 64-c) { continue } v.reset(OpAMD64ROLQconst) - v.AuxInt = c + v.AuxInt = int8ToAuxInt(c) v.AddArg(x) return true } @@ -18586,7 +18547,7 @@ func rewriteValueAMD64_OpAMD64ORQ(v *Value) bool { continue } v_1_1_0 := v_1_1.Args[0] - if v_1_1_0.Op != OpAMD64CMPQconst || v_1_1_0.AuxInt != 64 { + if v_1_1_0.Op != OpAMD64CMPQconst || auxIntToInt32(v_1_1_0.AuxInt) != 64 { continue } v_1_1_0_0 := v_1_1_0.Args[0] @@ -18594,11 +18555,11 @@ func rewriteValueAMD64_OpAMD64ORQ(v *Value) bool { continue } v_1_1_0_0_0 := v_1_1_0_0.Args[0] - if v_1_1_0_0_0.Op != OpAMD64ADDQconst || v_1_1_0_0_0.AuxInt != -64 { + if v_1_1_0_0_0.Op != OpAMD64ADDQconst || auxIntToInt32(v_1_1_0_0_0.AuxInt) != -64 { continue } v_1_1_0_0_0_0 := v_1_1_0_0_0.Args[0] - if v_1_1_0_0_0_0.Op != OpAMD64ANDQconst || v_1_1_0_0_0_0.AuxInt != 63 || y != v_1_1_0_0_0_0.Args[0] { + if v_1_1_0_0_0_0.Op != OpAMD64ANDQconst || auxIntToInt32(v_1_1_0_0_0_0.AuxInt) != 63 || y != v_1_1_0_0_0_0.Args[0] { continue } v.reset(OpAMD64ROLQ) @@ -18636,7 +18597,7 @@ func rewriteValueAMD64_OpAMD64ORQ(v *Value) bool { continue } v_1_1_0 := v_1_1.Args[0] - if v_1_1_0.Op != OpAMD64CMPLconst || v_1_1_0.AuxInt != 64 { + if v_1_1_0.Op != OpAMD64CMPLconst || auxIntToInt32(v_1_1_0.AuxInt) != 64 { continue } v_1_1_0_0 := v_1_1_0.Args[0] @@ -18644,11 +18605,11 @@ func rewriteValueAMD64_OpAMD64ORQ(v *Value) bool { continue } v_1_1_0_0_0 := v_1_1_0_0.Args[0] - if v_1_1_0_0_0.Op != OpAMD64ADDLconst || v_1_1_0_0_0.AuxInt != -64 { + if v_1_1_0_0_0.Op != OpAMD64ADDLconst || auxIntToInt32(v_1_1_0_0_0.AuxInt) != -64 { continue } v_1_1_0_0_0_0 := v_1_1_0_0_0.Args[0] - if v_1_1_0_0_0_0.Op != OpAMD64ANDLconst || v_1_1_0_0_0_0.AuxInt != 63 || y != v_1_1_0_0_0_0.Args[0] { + if v_1_1_0_0_0_0.Op != OpAMD64ANDLconst || auxIntToInt32(v_1_1_0_0_0_0.AuxInt) != 63 || y != v_1_1_0_0_0_0.Args[0] { continue } v.reset(OpAMD64ROLQ) @@ -18686,7 +18647,7 @@ func rewriteValueAMD64_OpAMD64ORQ(v *Value) bool { continue } v_1_1_0 := v_1_1.Args[0] - if v_1_1_0.Op != OpAMD64CMPQconst || v_1_1_0.AuxInt != 64 { + if v_1_1_0.Op != OpAMD64CMPQconst || auxIntToInt32(v_1_1_0.AuxInt) != 64 { continue } v_1_1_0_0 := v_1_1_0.Args[0] @@ -18694,11 +18655,11 @@ func rewriteValueAMD64_OpAMD64ORQ(v *Value) bool { continue } v_1_1_0_0_0 := v_1_1_0_0.Args[0] - if v_1_1_0_0_0.Op != OpAMD64ADDQconst || v_1_1_0_0_0.AuxInt != -64 { + if v_1_1_0_0_0.Op != OpAMD64ADDQconst || auxIntToInt32(v_1_1_0_0_0.AuxInt) != -64 { continue } v_1_1_0_0_0_0 := v_1_1_0_0_0.Args[0] - if v_1_1_0_0_0_0.Op != OpAMD64ANDQconst || v_1_1_0_0_0_0.AuxInt != 63 || y != v_1_1_0_0_0_0.Args[0] { + if v_1_1_0_0_0_0.Op != OpAMD64ANDQconst || auxIntToInt32(v_1_1_0_0_0_0.AuxInt) != 63 || y != v_1_1_0_0_0_0.Args[0] { continue } v.reset(OpAMD64RORQ) @@ -18736,7 +18697,7 @@ func rewriteValueAMD64_OpAMD64ORQ(v *Value) bool { continue } v_1_1_0 := v_1_1.Args[0] - if v_1_1_0.Op != OpAMD64CMPLconst || v_1_1_0.AuxInt != 64 { + if v_1_1_0.Op != OpAMD64CMPLconst || auxIntToInt32(v_1_1_0.AuxInt) != 64 { continue } v_1_1_0_0 := v_1_1_0.Args[0] @@ -18744,11 +18705,11 @@ func rewriteValueAMD64_OpAMD64ORQ(v *Value) bool { continue } v_1_1_0_0_0 := v_1_1_0_0.Args[0] - if v_1_1_0_0_0.Op != OpAMD64ADDLconst || v_1_1_0_0_0.AuxInt != -64 { + if v_1_1_0_0_0.Op != OpAMD64ADDLconst || auxIntToInt32(v_1_1_0_0_0.AuxInt) != -64 { continue } v_1_1_0_0_0_0 := v_1_1_0_0_0.Args[0] - if v_1_1_0_0_0_0.Op != OpAMD64ANDLconst || v_1_1_0_0_0_0.AuxInt != 63 || y != v_1_1_0_0_0_0.Args[0] { + if v_1_1_0_0_0_0.Op != OpAMD64ANDLconst || auxIntToInt32(v_1_1_0_0_0_0.AuxInt) != 63 || y != v_1_1_0_0_0_0.Args[0] { continue } v.reset(OpAMD64RORQ) @@ -19830,16 +19791,16 @@ func rewriteValueAMD64_OpAMD64ORQ(v *Value) bool { func rewriteValueAMD64_OpAMD64ORQconst(v *Value) bool { v_0 := v.Args[0] // match: (ORQconst [c] x) - // cond: isUint64PowerOfTwo(c) && uint64(c) >= 128 - // result: (BTSQconst [log2(c)] x) + // cond: isUint64PowerOfTwo(int64(c)) && uint64(c) >= 128 + // result: (BTSQconst [int8(log32(c))] x) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) x := v_0 - if !(isUint64PowerOfTwo(c) && uint64(c) >= 128) { + if !(isUint64PowerOfTwo(int64(c)) && uint64(c) >= 128) { break } v.reset(OpAMD64BTSQconst) - v.AuxInt = log2(c) + v.AuxInt = int8ToAuxInt(int8(log32(c))) v.AddArg(x) return true } @@ -19913,23 +19874,23 @@ func rewriteValueAMD64_OpAMD64ORQconstmodify(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (ORQconstmodify [valoff1] {sym} (ADDQconst [off2] base) mem) - // cond: ValAndOff(valoff1).canAdd(off2) - // result: (ORQconstmodify [ValAndOff(valoff1).add(off2)] {sym} base mem) + // cond: ValAndOff(valoff1).canAdd32(off2) + // result: (ORQconstmodify [ValAndOff(valoff1).addOffset32(off2)] {sym} base mem) for { - valoff1 := v.AuxInt - sym := v.Aux + valoff1 := auxIntToValAndOff(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] mem := v_1 - if !(ValAndOff(valoff1).canAdd(off2)) { + if !(ValAndOff(valoff1).canAdd32(off2)) { break } v.reset(OpAMD64ORQconstmodify) - v.AuxInt = ValAndOff(valoff1).add(off2) - v.Aux = sym + v.AuxInt = valAndOffToAuxInt(ValAndOff(valoff1).addOffset32(off2)) + v.Aux = symToAux(sym) v.AddArg2(base, mem) return true } @@ -19964,24 +19925,24 @@ func rewriteValueAMD64_OpAMD64ORQload(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (ORQload [off1] {sym} val (ADDQconst [off2] base) mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (ORQload [off1+off2] {sym} val base mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) val := v_0 if v_1.Op != OpAMD64ADDQconst { break } - off2 := v_1.AuxInt + off2 := auxIntToInt32(v_1.AuxInt) base := v_1.Args[0] mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64ORQload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(val, base, mem) return true } @@ -20035,24 +19996,24 @@ func rewriteValueAMD64_OpAMD64ORQmodify(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (ORQmodify [off1] {sym} (ADDQconst [off2] base) val mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (ORQmodify [off1+off2] {sym} base val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64ORQmodify) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(base, val, mem) return true } @@ -20109,28 +20070,28 @@ func rewriteValueAMD64_OpAMD64ROLB(v *Value) bool { return true } // match: (ROLB x (MOVQconst [c])) - // result: (ROLBconst [c&7 ] x) + // result: (ROLBconst [int8(c&7) ] x) for { x := v_0 if v_1.Op != OpAMD64MOVQconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) v.reset(OpAMD64ROLBconst) - v.AuxInt = c & 7 + v.AuxInt = int8ToAuxInt(int8(c & 7)) v.AddArg(x) return true } // match: (ROLB x (MOVLconst [c])) - // result: (ROLBconst [c&7 ] x) + // result: (ROLBconst [int8(c&7) ] x) for { x := v_0 if v_1.Op != OpAMD64MOVLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) v.reset(OpAMD64ROLBconst) - v.AuxInt = c & 7 + v.AuxInt = int8ToAuxInt(int8(c & 7)) v.AddArg(x) return true } @@ -20141,21 +20102,21 @@ func rewriteValueAMD64_OpAMD64ROLBconst(v *Value) bool { // match: (ROLBconst [c] (ROLBconst [d] x)) // result: (ROLBconst [(c+d)& 7] x) for { - c := v.AuxInt + c := auxIntToInt8(v.AuxInt) if v_0.Op != OpAMD64ROLBconst { break } - d := v_0.AuxInt + d := auxIntToInt8(v_0.AuxInt) x := v_0.Args[0] v.reset(OpAMD64ROLBconst) - v.AuxInt = (c + d) & 7 + v.AuxInt = int8ToAuxInt((c + d) & 7) v.AddArg(x) return true } // match: (ROLBconst x [0]) // result: x for { - if v.AuxInt != 0 { + if auxIntToInt8(v.AuxInt) != 0 { break } x := v_0 @@ -20192,28 +20153,28 @@ func rewriteValueAMD64_OpAMD64ROLL(v *Value) bool { return true } // match: (ROLL x (MOVQconst [c])) - // result: (ROLLconst [c&31] x) + // result: (ROLLconst [int8(c&31)] x) for { x := v_0 if v_1.Op != OpAMD64MOVQconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) v.reset(OpAMD64ROLLconst) - v.AuxInt = c & 31 + v.AuxInt = int8ToAuxInt(int8(c & 31)) v.AddArg(x) return true } // match: (ROLL x (MOVLconst [c])) - // result: (ROLLconst [c&31] x) + // result: (ROLLconst [int8(c&31)] x) for { x := v_0 if v_1.Op != OpAMD64MOVLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) v.reset(OpAMD64ROLLconst) - v.AuxInt = c & 31 + v.AuxInt = int8ToAuxInt(int8(c & 31)) v.AddArg(x) return true } @@ -20224,21 +20185,21 @@ func rewriteValueAMD64_OpAMD64ROLLconst(v *Value) bool { // match: (ROLLconst [c] (ROLLconst [d] x)) // result: (ROLLconst [(c+d)&31] x) for { - c := v.AuxInt + c := auxIntToInt8(v.AuxInt) if v_0.Op != OpAMD64ROLLconst { break } - d := v_0.AuxInt + d := auxIntToInt8(v_0.AuxInt) x := v_0.Args[0] v.reset(OpAMD64ROLLconst) - v.AuxInt = (c + d) & 31 + v.AuxInt = int8ToAuxInt((c + d) & 31) v.AddArg(x) return true } // match: (ROLLconst x [0]) // result: x for { - if v.AuxInt != 0 { + if auxIntToInt8(v.AuxInt) != 0 { break } x := v_0 @@ -20275,28 +20236,28 @@ func rewriteValueAMD64_OpAMD64ROLQ(v *Value) bool { return true } // match: (ROLQ x (MOVQconst [c])) - // result: (ROLQconst [c&63] x) + // result: (ROLQconst [int8(c&63)] x) for { x := v_0 if v_1.Op != OpAMD64MOVQconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) v.reset(OpAMD64ROLQconst) - v.AuxInt = c & 63 + v.AuxInt = int8ToAuxInt(int8(c & 63)) v.AddArg(x) return true } // match: (ROLQ x (MOVLconst [c])) - // result: (ROLQconst [c&63] x) + // result: (ROLQconst [int8(c&63)] x) for { x := v_0 if v_1.Op != OpAMD64MOVLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) v.reset(OpAMD64ROLQconst) - v.AuxInt = c & 63 + v.AuxInt = int8ToAuxInt(int8(c & 63)) v.AddArg(x) return true } @@ -20307,21 +20268,21 @@ func rewriteValueAMD64_OpAMD64ROLQconst(v *Value) bool { // match: (ROLQconst [c] (ROLQconst [d] x)) // result: (ROLQconst [(c+d)&63] x) for { - c := v.AuxInt + c := auxIntToInt8(v.AuxInt) if v_0.Op != OpAMD64ROLQconst { break } - d := v_0.AuxInt + d := auxIntToInt8(v_0.AuxInt) x := v_0.Args[0] v.reset(OpAMD64ROLQconst) - v.AuxInt = (c + d) & 63 + v.AuxInt = int8ToAuxInt((c + d) & 63) v.AddArg(x) return true } // match: (ROLQconst x [0]) // result: x for { - if v.AuxInt != 0 { + if auxIntToInt8(v.AuxInt) != 0 { break } x := v_0 @@ -20358,28 +20319,28 @@ func rewriteValueAMD64_OpAMD64ROLW(v *Value) bool { return true } // match: (ROLW x (MOVQconst [c])) - // result: (ROLWconst [c&15] x) + // result: (ROLWconst [int8(c&15)] x) for { x := v_0 if v_1.Op != OpAMD64MOVQconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) v.reset(OpAMD64ROLWconst) - v.AuxInt = c & 15 + v.AuxInt = int8ToAuxInt(int8(c & 15)) v.AddArg(x) return true } // match: (ROLW x (MOVLconst [c])) - // result: (ROLWconst [c&15] x) + // result: (ROLWconst [int8(c&15)] x) for { x := v_0 if v_1.Op != OpAMD64MOVLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) v.reset(OpAMD64ROLWconst) - v.AuxInt = c & 15 + v.AuxInt = int8ToAuxInt(int8(c & 15)) v.AddArg(x) return true } @@ -20390,21 +20351,21 @@ func rewriteValueAMD64_OpAMD64ROLWconst(v *Value) bool { // match: (ROLWconst [c] (ROLWconst [d] x)) // result: (ROLWconst [(c+d)&15] x) for { - c := v.AuxInt + c := auxIntToInt8(v.AuxInt) if v_0.Op != OpAMD64ROLWconst { break } - d := v_0.AuxInt + d := auxIntToInt8(v_0.AuxInt) x := v_0.Args[0] v.reset(OpAMD64ROLWconst) - v.AuxInt = (c + d) & 15 + v.AuxInt = int8ToAuxInt((c + d) & 15) v.AddArg(x) return true } // match: (ROLWconst x [0]) // result: x for { - if v.AuxInt != 0 { + if auxIntToInt8(v.AuxInt) != 0 { break } x := v_0 @@ -20441,28 +20402,28 @@ func rewriteValueAMD64_OpAMD64RORB(v *Value) bool { return true } // match: (RORB x (MOVQconst [c])) - // result: (ROLBconst [(-c)&7 ] x) + // result: (ROLBconst [int8((-c)&7) ] x) for { x := v_0 if v_1.Op != OpAMD64MOVQconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) v.reset(OpAMD64ROLBconst) - v.AuxInt = (-c) & 7 + v.AuxInt = int8ToAuxInt(int8((-c) & 7)) v.AddArg(x) return true } // match: (RORB x (MOVLconst [c])) - // result: (ROLBconst [(-c)&7 ] x) + // result: (ROLBconst [int8((-c)&7) ] x) for { x := v_0 if v_1.Op != OpAMD64MOVLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) v.reset(OpAMD64ROLBconst) - v.AuxInt = (-c) & 7 + v.AuxInt = int8ToAuxInt(int8((-c) & 7)) v.AddArg(x) return true } @@ -20496,28 +20457,28 @@ func rewriteValueAMD64_OpAMD64RORL(v *Value) bool { return true } // match: (RORL x (MOVQconst [c])) - // result: (ROLLconst [(-c)&31] x) + // result: (ROLLconst [int8((-c)&31)] x) for { x := v_0 if v_1.Op != OpAMD64MOVQconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) v.reset(OpAMD64ROLLconst) - v.AuxInt = (-c) & 31 + v.AuxInt = int8ToAuxInt(int8((-c) & 31)) v.AddArg(x) return true } // match: (RORL x (MOVLconst [c])) - // result: (ROLLconst [(-c)&31] x) + // result: (ROLLconst [int8((-c)&31)] x) for { x := v_0 if v_1.Op != OpAMD64MOVLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) v.reset(OpAMD64ROLLconst) - v.AuxInt = (-c) & 31 + v.AuxInt = int8ToAuxInt(int8((-c) & 31)) v.AddArg(x) return true } @@ -20551,28 +20512,28 @@ func rewriteValueAMD64_OpAMD64RORQ(v *Value) bool { return true } // match: (RORQ x (MOVQconst [c])) - // result: (ROLQconst [(-c)&63] x) + // result: (ROLQconst [int8((-c)&63)] x) for { x := v_0 if v_1.Op != OpAMD64MOVQconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) v.reset(OpAMD64ROLQconst) - v.AuxInt = (-c) & 63 + v.AuxInt = int8ToAuxInt(int8((-c) & 63)) v.AddArg(x) return true } // match: (RORQ x (MOVLconst [c])) - // result: (ROLQconst [(-c)&63] x) + // result: (ROLQconst [int8((-c)&63)] x) for { x := v_0 if v_1.Op != OpAMD64MOVLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) v.reset(OpAMD64ROLQconst) - v.AuxInt = (-c) & 63 + v.AuxInt = int8ToAuxInt(int8((-c) & 63)) v.AddArg(x) return true } @@ -20606,28 +20567,28 @@ func rewriteValueAMD64_OpAMD64RORW(v *Value) bool { return true } // match: (RORW x (MOVQconst [c])) - // result: (ROLWconst [(-c)&15] x) + // result: (ROLWconst [int8((-c)&15)] x) for { x := v_0 if v_1.Op != OpAMD64MOVQconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) v.reset(OpAMD64ROLWconst) - v.AuxInt = (-c) & 15 + v.AuxInt = int8ToAuxInt(int8((-c) & 15)) v.AddArg(x) return true } // match: (RORW x (MOVLconst [c])) - // result: (ROLWconst [(-c)&15] x) + // result: (ROLWconst [int8((-c)&15)] x) for { x := v_0 if v_1.Op != OpAMD64MOVLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) v.reset(OpAMD64ROLWconst) - v.AuxInt = (-c) & 15 + v.AuxInt = int8ToAuxInt(int8((-c) & 15)) v.AddArg(x) return true } @@ -20637,28 +20598,28 @@ func rewriteValueAMD64_OpAMD64SARB(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (SARB x (MOVQconst [c])) - // result: (SARBconst [min(c&31,7)] x) + // result: (SARBconst [int8(min(int64(c)&31,7))] x) for { x := v_0 if v_1.Op != OpAMD64MOVQconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) v.reset(OpAMD64SARBconst) - v.AuxInt = min(c&31, 7) + v.AuxInt = int8ToAuxInt(int8(min(int64(c)&31, 7))) v.AddArg(x) return true } // match: (SARB x (MOVLconst [c])) - // result: (SARBconst [min(c&31,7)] x) + // result: (SARBconst [int8(min(int64(c)&31,7))] x) for { x := v_0 if v_1.Op != OpAMD64MOVLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) v.reset(OpAMD64SARBconst) - v.AuxInt = min(c&31, 7) + v.AuxInt = int8ToAuxInt(int8(min(int64(c)&31, 7))) v.AddArg(x) return true } @@ -20669,7 +20630,7 @@ func rewriteValueAMD64_OpAMD64SARBconst(v *Value) bool { // match: (SARBconst x [0]) // result: x for { - if v.AuxInt != 0 { + if auxIntToInt8(v.AuxInt) != 0 { break } x := v_0 @@ -20695,28 +20656,28 @@ func rewriteValueAMD64_OpAMD64SARL(v *Value) bool { v_0 := v.Args[0] b := v.Block // match: (SARL x (MOVQconst [c])) - // result: (SARLconst [c&31] x) + // result: (SARLconst [int8(c&31)] x) for { x := v_0 if v_1.Op != OpAMD64MOVQconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) v.reset(OpAMD64SARLconst) - v.AuxInt = c & 31 + v.AuxInt = int8ToAuxInt(int8(c & 31)) v.AddArg(x) return true } // match: (SARL x (MOVLconst [c])) - // result: (SARLconst [c&31] x) + // result: (SARLconst [int8(c&31)] x) for { x := v_0 if v_1.Op != OpAMD64MOVLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) v.reset(OpAMD64SARLconst) - v.AuxInt = c & 31 + v.AuxInt = int8ToAuxInt(int8(c & 31)) v.AddArg(x) return true } @@ -20728,7 +20689,7 @@ func rewriteValueAMD64_OpAMD64SARL(v *Value) bool { if v_1.Op != OpAMD64ADDQconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) y := v_1.Args[0] if !(c&31 == 0) { break @@ -20750,7 +20711,7 @@ func rewriteValueAMD64_OpAMD64SARL(v *Value) bool { if v_1_0.Op != OpAMD64ADDQconst { break } - c := v_1_0.AuxInt + c := auxIntToInt32(v_1_0.AuxInt) y := v_1_0.Args[0] if !(c&31 == 0) { break @@ -20769,7 +20730,7 @@ func rewriteValueAMD64_OpAMD64SARL(v *Value) bool { if v_1.Op != OpAMD64ANDQconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) y := v_1.Args[0] if !(c&31 == 31) { break @@ -20791,7 +20752,7 @@ func rewriteValueAMD64_OpAMD64SARL(v *Value) bool { if v_1_0.Op != OpAMD64ANDQconst { break } - c := v_1_0.AuxInt + c := auxIntToInt32(v_1_0.AuxInt) y := v_1_0.Args[0] if !(c&31 == 31) { break @@ -20810,7 +20771,7 @@ func rewriteValueAMD64_OpAMD64SARL(v *Value) bool { if v_1.Op != OpAMD64ADDLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) y := v_1.Args[0] if !(c&31 == 0) { break @@ -20832,7 +20793,7 @@ func rewriteValueAMD64_OpAMD64SARL(v *Value) bool { if v_1_0.Op != OpAMD64ADDLconst { break } - c := v_1_0.AuxInt + c := auxIntToInt32(v_1_0.AuxInt) y := v_1_0.Args[0] if !(c&31 == 0) { break @@ -20851,7 +20812,7 @@ func rewriteValueAMD64_OpAMD64SARL(v *Value) bool { if v_1.Op != OpAMD64ANDLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) y := v_1.Args[0] if !(c&31 == 31) { break @@ -20873,7 +20834,7 @@ func rewriteValueAMD64_OpAMD64SARL(v *Value) bool { if v_1_0.Op != OpAMD64ANDLconst { break } - c := v_1_0.AuxInt + c := auxIntToInt32(v_1_0.AuxInt) y := v_1_0.Args[0] if !(c&31 == 31) { break @@ -20891,7 +20852,7 @@ func rewriteValueAMD64_OpAMD64SARLconst(v *Value) bool { // match: (SARLconst x [0]) // result: x for { - if v.AuxInt != 0 { + if auxIntToInt8(v.AuxInt) != 0 { break } x := v_0 @@ -20917,28 +20878,28 @@ func rewriteValueAMD64_OpAMD64SARQ(v *Value) bool { v_0 := v.Args[0] b := v.Block // match: (SARQ x (MOVQconst [c])) - // result: (SARQconst [c&63] x) + // result: (SARQconst [int8(c&63)] x) for { x := v_0 if v_1.Op != OpAMD64MOVQconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) v.reset(OpAMD64SARQconst) - v.AuxInt = c & 63 + v.AuxInt = int8ToAuxInt(int8(c & 63)) v.AddArg(x) return true } // match: (SARQ x (MOVLconst [c])) - // result: (SARQconst [c&63] x) + // result: (SARQconst [int8(c&63)] x) for { x := v_0 if v_1.Op != OpAMD64MOVLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) v.reset(OpAMD64SARQconst) - v.AuxInt = c & 63 + v.AuxInt = int8ToAuxInt(int8(c & 63)) v.AddArg(x) return true } @@ -20950,7 +20911,7 @@ func rewriteValueAMD64_OpAMD64SARQ(v *Value) bool { if v_1.Op != OpAMD64ADDQconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) y := v_1.Args[0] if !(c&63 == 0) { break @@ -20972,7 +20933,7 @@ func rewriteValueAMD64_OpAMD64SARQ(v *Value) bool { if v_1_0.Op != OpAMD64ADDQconst { break } - c := v_1_0.AuxInt + c := auxIntToInt32(v_1_0.AuxInt) y := v_1_0.Args[0] if !(c&63 == 0) { break @@ -20991,7 +20952,7 @@ func rewriteValueAMD64_OpAMD64SARQ(v *Value) bool { if v_1.Op != OpAMD64ANDQconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) y := v_1.Args[0] if !(c&63 == 63) { break @@ -21013,7 +20974,7 @@ func rewriteValueAMD64_OpAMD64SARQ(v *Value) bool { if v_1_0.Op != OpAMD64ANDQconst { break } - c := v_1_0.AuxInt + c := auxIntToInt32(v_1_0.AuxInt) y := v_1_0.Args[0] if !(c&63 == 63) { break @@ -21032,7 +20993,7 @@ func rewriteValueAMD64_OpAMD64SARQ(v *Value) bool { if v_1.Op != OpAMD64ADDLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) y := v_1.Args[0] if !(c&63 == 0) { break @@ -21054,7 +21015,7 @@ func rewriteValueAMD64_OpAMD64SARQ(v *Value) bool { if v_1_0.Op != OpAMD64ADDLconst { break } - c := v_1_0.AuxInt + c := auxIntToInt32(v_1_0.AuxInt) y := v_1_0.Args[0] if !(c&63 == 0) { break @@ -21073,7 +21034,7 @@ func rewriteValueAMD64_OpAMD64SARQ(v *Value) bool { if v_1.Op != OpAMD64ANDLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) y := v_1.Args[0] if !(c&63 == 63) { break @@ -21095,7 +21056,7 @@ func rewriteValueAMD64_OpAMD64SARQ(v *Value) bool { if v_1_0.Op != OpAMD64ANDLconst { break } - c := v_1_0.AuxInt + c := auxIntToInt32(v_1_0.AuxInt) y := v_1_0.Args[0] if !(c&63 == 63) { break @@ -21113,7 +21074,7 @@ func rewriteValueAMD64_OpAMD64SARQconst(v *Value) bool { // match: (SARQconst x [0]) // result: x for { - if v.AuxInt != 0 { + if auxIntToInt8(v.AuxInt) != 0 { break } x := v_0 @@ -21138,28 +21099,28 @@ func rewriteValueAMD64_OpAMD64SARW(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (SARW x (MOVQconst [c])) - // result: (SARWconst [min(c&31,15)] x) + // result: (SARWconst [int8(min(int64(c)&31,15))] x) for { x := v_0 if v_1.Op != OpAMD64MOVQconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) v.reset(OpAMD64SARWconst) - v.AuxInt = min(c&31, 15) + v.AuxInt = int8ToAuxInt(int8(min(int64(c)&31, 15))) v.AddArg(x) return true } // match: (SARW x (MOVLconst [c])) - // result: (SARWconst [min(c&31,15)] x) + // result: (SARWconst [int8(min(int64(c)&31,15))] x) for { x := v_0 if v_1.Op != OpAMD64MOVLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) v.reset(OpAMD64SARWconst) - v.AuxInt = min(c&31, 15) + v.AuxInt = int8ToAuxInt(int8(min(int64(c)&31, 15))) v.AddArg(x) return true } @@ -21170,7 +21131,7 @@ func rewriteValueAMD64_OpAMD64SARWconst(v *Value) bool { // match: (SARWconst x [0]) // result: x for { - if v.AuxInt != 0 { + if auxIntToInt8(v.AuxInt) != 0 { break } x := v_0 @@ -21421,7 +21382,7 @@ func rewriteValueAMD64_OpAMD64SETA(v *Value) bool { func rewriteValueAMD64_OpAMD64SETAE(v *Value) bool { v_0 := v.Args[0] // match: (SETAE (TESTQ x x)) - // result: (ConstBool [1]) + // result: (ConstBool [true]) for { if v_0.Op != OpAMD64TESTQ { break @@ -21431,11 +21392,11 @@ func rewriteValueAMD64_OpAMD64SETAE(v *Value) bool { break } v.reset(OpConstBool) - v.AuxInt = 1 + v.AuxInt = boolToAuxInt(true) return true } // match: (SETAE (TESTL x x)) - // result: (ConstBool [1]) + // result: (ConstBool [true]) for { if v_0.Op != OpAMD64TESTL { break @@ -21445,11 +21406,11 @@ func rewriteValueAMD64_OpAMD64SETAE(v *Value) bool { break } v.reset(OpConstBool) - v.AuxInt = 1 + v.AuxInt = boolToAuxInt(true) return true } // match: (SETAE (TESTW x x)) - // result: (ConstBool [1]) + // result: (ConstBool [true]) for { if v_0.Op != OpAMD64TESTW { break @@ -21459,11 +21420,11 @@ func rewriteValueAMD64_OpAMD64SETAE(v *Value) bool { break } v.reset(OpConstBool) - v.AuxInt = 1 + v.AuxInt = boolToAuxInt(true) return true } // match: (SETAE (TESTB x x)) - // result: (ConstBool [1]) + // result: (ConstBool [true]) for { if v_0.Op != OpAMD64TESTB { break @@ -21473,7 +21434,7 @@ func rewriteValueAMD64_OpAMD64SETAE(v *Value) bool { break } v.reset(OpConstBool) - v.AuxInt = 1 + v.AuxInt = boolToAuxInt(true) return true } // match: (SETAE (InvertFlags x)) @@ -21548,8 +21509,8 @@ func rewriteValueAMD64_OpAMD64SETAEstore(v *Value) bool { // match: (SETAEstore [off] {sym} ptr (InvertFlags x) mem) // result: (SETBEstore [off] {sym} ptr x mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64InvertFlags { break @@ -21557,30 +21518,30 @@ func rewriteValueAMD64_OpAMD64SETAEstore(v *Value) bool { x := v_1.Args[0] mem := v_2 v.reset(OpAMD64SETBEstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(ptr, x, mem) return true } // match: (SETAEstore [off1] {sym} (ADDQconst [off2] base) val mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (SETAEstore [off1+off2] {sym} base val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64SETAEstore) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(base, val, mem) return true } @@ -21708,8 +21669,8 @@ func rewriteValueAMD64_OpAMD64SETAstore(v *Value) bool { // match: (SETAstore [off] {sym} ptr (InvertFlags x) mem) // result: (SETBstore [off] {sym} ptr x mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64InvertFlags { break @@ -21717,30 +21678,30 @@ func rewriteValueAMD64_OpAMD64SETAstore(v *Value) bool { x := v_1.Args[0] mem := v_2 v.reset(OpAMD64SETBstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(ptr, x, mem) return true } // match: (SETAstore [off1] {sym} (ADDQconst [off2] base) val mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (SETAstore [off1+off2] {sym} base val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64SETAstore) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(base, val, mem) return true } @@ -21862,7 +21823,7 @@ func rewriteValueAMD64_OpAMD64SETAstore(v *Value) bool { func rewriteValueAMD64_OpAMD64SETB(v *Value) bool { v_0 := v.Args[0] // match: (SETB (TESTQ x x)) - // result: (ConstBool [0]) + // result: (ConstBool [false]) for { if v_0.Op != OpAMD64TESTQ { break @@ -21872,11 +21833,11 @@ func rewriteValueAMD64_OpAMD64SETB(v *Value) bool { break } v.reset(OpConstBool) - v.AuxInt = 0 + v.AuxInt = boolToAuxInt(false) return true } // match: (SETB (TESTL x x)) - // result: (ConstBool [0]) + // result: (ConstBool [false]) for { if v_0.Op != OpAMD64TESTL { break @@ -21886,11 +21847,11 @@ func rewriteValueAMD64_OpAMD64SETB(v *Value) bool { break } v.reset(OpConstBool) - v.AuxInt = 0 + v.AuxInt = boolToAuxInt(false) return true } // match: (SETB (TESTW x x)) - // result: (ConstBool [0]) + // result: (ConstBool [false]) for { if v_0.Op != OpAMD64TESTW { break @@ -21900,11 +21861,11 @@ func rewriteValueAMD64_OpAMD64SETB(v *Value) bool { break } v.reset(OpConstBool) - v.AuxInt = 0 + v.AuxInt = boolToAuxInt(false) return true } // match: (SETB (TESTB x x)) - // result: (ConstBool [0]) + // result: (ConstBool [false]) for { if v_0.Op != OpAMD64TESTB { break @@ -21914,7 +21875,7 @@ func rewriteValueAMD64_OpAMD64SETB(v *Value) bool { break } v.reset(OpConstBool) - v.AuxInt = 0 + v.AuxInt = boolToAuxInt(false) return true } // match: (SETB (BTLconst [0] x)) @@ -22078,8 +22039,8 @@ func rewriteValueAMD64_OpAMD64SETBEstore(v *Value) bool { // match: (SETBEstore [off] {sym} ptr (InvertFlags x) mem) // result: (SETAEstore [off] {sym} ptr x mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64InvertFlags { break @@ -22087,30 +22048,30 @@ func rewriteValueAMD64_OpAMD64SETBEstore(v *Value) bool { x := v_1.Args[0] mem := v_2 v.reset(OpAMD64SETAEstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(ptr, x, mem) return true } // match: (SETBEstore [off1] {sym} (ADDQconst [off2] base) val mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (SETBEstore [off1+off2] {sym} base val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64SETBEstore) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(base, val, mem) return true } @@ -22238,8 +22199,8 @@ func rewriteValueAMD64_OpAMD64SETBstore(v *Value) bool { // match: (SETBstore [off] {sym} ptr (InvertFlags x) mem) // result: (SETAstore [off] {sym} ptr x mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64InvertFlags { break @@ -22247,30 +22208,30 @@ func rewriteValueAMD64_OpAMD64SETBstore(v *Value) bool { x := v_1.Args[0] mem := v_2 v.reset(OpAMD64SETAstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(ptr, x, mem) return true } // match: (SETBstore [off1] {sym} (ADDQconst [off2] base) val mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (SETBstore [off1+off2] {sym} base val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64SETBstore) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(base, val, mem) return true } @@ -22407,7 +22368,7 @@ func rewriteValueAMD64_OpAMD64SETEQ(v *Value) bool { } x := v_0_0.Args[1] v_0_0_0 := v_0_0.Args[0] - if v_0_0_0.Op != OpAMD64MOVLconst || v_0_0_0.AuxInt != 1 { + if v_0_0_0.Op != OpAMD64MOVLconst || auxIntToInt32(v_0_0_0.AuxInt) != 1 { continue } y := v_0_1 @@ -22434,7 +22395,7 @@ func rewriteValueAMD64_OpAMD64SETEQ(v *Value) bool { } x := v_0_0.Args[1] v_0_0_0 := v_0_0.Args[0] - if v_0_0_0.Op != OpAMD64MOVQconst || v_0_0_0.AuxInt != 1 { + if v_0_0_0.Op != OpAMD64MOVQconst || auxIntToInt64(v_0_0_0.AuxInt) != 1 { continue } y := v_0_1 @@ -22447,46 +22408,46 @@ func rewriteValueAMD64_OpAMD64SETEQ(v *Value) bool { break } // match: (SETEQ (TESTLconst [c] x)) - // cond: isUint32PowerOfTwo(c) - // result: (SETAE (BTLconst [log2uint32(c)] x)) + // cond: isUint32PowerOfTwo(int64(c)) + // result: (SETAE (BTLconst [int8(log32(c))] x)) for { if v_0.Op != OpAMD64TESTLconst { break } - c := v_0.AuxInt + c := auxIntToInt32(v_0.AuxInt) x := v_0.Args[0] - if !(isUint32PowerOfTwo(c)) { + if !(isUint32PowerOfTwo(int64(c))) { break } v.reset(OpAMD64SETAE) v0 := b.NewValue0(v.Pos, OpAMD64BTLconst, types.TypeFlags) - v0.AuxInt = log2uint32(c) + v0.AuxInt = int8ToAuxInt(int8(log32(c))) v0.AddArg(x) v.AddArg(v0) return true } // match: (SETEQ (TESTQconst [c] x)) - // cond: isUint64PowerOfTwo(c) - // result: (SETAE (BTQconst [log2(c)] x)) + // cond: isUint64PowerOfTwo(int64(c)) + // result: (SETAE (BTQconst [int8(log32(c))] x)) for { if v_0.Op != OpAMD64TESTQconst { break } - c := v_0.AuxInt + c := auxIntToInt32(v_0.AuxInt) x := v_0.Args[0] - if !(isUint64PowerOfTwo(c)) { + if !(isUint64PowerOfTwo(int64(c))) { break } v.reset(OpAMD64SETAE) v0 := b.NewValue0(v.Pos, OpAMD64BTQconst, types.TypeFlags) - v0.AuxInt = log2(c) + v0.AuxInt = int8ToAuxInt(int8(log32(c))) v0.AddArg(x) v.AddArg(v0) return true } // match: (SETEQ (TESTQ (MOVQconst [c]) x)) // cond: isUint64PowerOfTwo(c) - // result: (SETAE (BTQconst [log2(c)] x)) + // result: (SETAE (BTQconst [int8(log2(c))] x)) for { if v_0.Op != OpAMD64TESTQ { break @@ -22498,14 +22459,14 @@ func rewriteValueAMD64_OpAMD64SETEQ(v *Value) bool { if v_0_0.Op != OpAMD64MOVQconst { continue } - c := v_0_0.AuxInt + c := auxIntToInt64(v_0_0.AuxInt) x := v_0_1 if !(isUint64PowerOfTwo(c)) { continue } v.reset(OpAMD64SETAE) v0 := b.NewValue0(v.Pos, OpAMD64BTQconst, types.TypeFlags) - v0.AuxInt = log2(c) + v0.AuxInt = int8ToAuxInt(int8(log2(c))) v0.AddArg(x) v.AddArg(v0) return true @@ -22515,16 +22476,16 @@ func rewriteValueAMD64_OpAMD64SETEQ(v *Value) bool { // match: (SETEQ (CMPLconst [1] s:(ANDLconst [1] _))) // result: (SETNE (CMPLconst [0] s)) for { - if v_0.Op != OpAMD64CMPLconst || v_0.AuxInt != 1 { + if v_0.Op != OpAMD64CMPLconst || auxIntToInt32(v_0.AuxInt) != 1 { break } s := v_0.Args[0] - if s.Op != OpAMD64ANDLconst || s.AuxInt != 1 { + if s.Op != OpAMD64ANDLconst || auxIntToInt32(s.AuxInt) != 1 { break } v.reset(OpAMD64SETNE) v0 := b.NewValue0(v.Pos, OpAMD64CMPLconst, types.TypeFlags) - v0.AuxInt = 0 + v0.AuxInt = int32ToAuxInt(0) v0.AddArg(s) v.AddArg(v0) return true @@ -22532,16 +22493,16 @@ func rewriteValueAMD64_OpAMD64SETEQ(v *Value) bool { // match: (SETEQ (CMPQconst [1] s:(ANDQconst [1] _))) // result: (SETNE (CMPQconst [0] s)) for { - if v_0.Op != OpAMD64CMPQconst || v_0.AuxInt != 1 { + if v_0.Op != OpAMD64CMPQconst || auxIntToInt32(v_0.AuxInt) != 1 { break } s := v_0.Args[0] - if s.Op != OpAMD64ANDQconst || s.AuxInt != 1 { + if s.Op != OpAMD64ANDQconst || auxIntToInt32(s.AuxInt) != 1 { break } v.reset(OpAMD64SETNE) v0 := b.NewValue0(v.Pos, OpAMD64CMPQconst, types.TypeFlags) - v0.AuxInt = 0 + v0.AuxInt = int32ToAuxInt(0) v0.AddArg(s) v.AddArg(v0) return true @@ -22558,11 +22519,11 @@ func rewriteValueAMD64_OpAMD64SETEQ(v *Value) bool { v_0_1 := v_0.Args[1] for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { z1 := v_0_0 - if z1.Op != OpAMD64SHLQconst || z1.AuxInt != 63 { + if z1.Op != OpAMD64SHLQconst || auxIntToInt8(z1.AuxInt) != 63 { continue } z1_0 := z1.Args[0] - if z1_0.Op != OpAMD64SHRQconst || z1_0.AuxInt != 63 { + if z1_0.Op != OpAMD64SHRQconst || auxIntToInt8(z1_0.AuxInt) != 63 { continue } x := z1_0.Args[0] @@ -22572,7 +22533,7 @@ func rewriteValueAMD64_OpAMD64SETEQ(v *Value) bool { } v.reset(OpAMD64SETAE) v0 := b.NewValue0(v.Pos, OpAMD64BTQconst, types.TypeFlags) - v0.AuxInt = 63 + v0.AuxInt = int8ToAuxInt(63) v0.AddArg(x) v.AddArg(v0) return true @@ -22591,11 +22552,11 @@ func rewriteValueAMD64_OpAMD64SETEQ(v *Value) bool { v_0_1 := v_0.Args[1] for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { z1 := v_0_0 - if z1.Op != OpAMD64SHLLconst || z1.AuxInt != 31 { + if z1.Op != OpAMD64SHLLconst || auxIntToInt8(z1.AuxInt) != 31 { continue } z1_0 := z1.Args[0] - if z1_0.Op != OpAMD64SHRQconst || z1_0.AuxInt != 31 { + if z1_0.Op != OpAMD64SHRQconst || auxIntToInt8(z1_0.AuxInt) != 31 { continue } x := z1_0.Args[0] @@ -22605,7 +22566,7 @@ func rewriteValueAMD64_OpAMD64SETEQ(v *Value) bool { } v.reset(OpAMD64SETAE) v0 := b.NewValue0(v.Pos, OpAMD64BTQconst, types.TypeFlags) - v0.AuxInt = 31 + v0.AuxInt = int8ToAuxInt(31) v0.AddArg(x) v.AddArg(v0) return true @@ -22624,11 +22585,11 @@ func rewriteValueAMD64_OpAMD64SETEQ(v *Value) bool { v_0_1 := v_0.Args[1] for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { z1 := v_0_0 - if z1.Op != OpAMD64SHRQconst || z1.AuxInt != 63 { + if z1.Op != OpAMD64SHRQconst || auxIntToInt8(z1.AuxInt) != 63 { continue } z1_0 := z1.Args[0] - if z1_0.Op != OpAMD64SHLQconst || z1_0.AuxInt != 63 { + if z1_0.Op != OpAMD64SHLQconst || auxIntToInt8(z1_0.AuxInt) != 63 { continue } x := z1_0.Args[0] @@ -22638,7 +22599,7 @@ func rewriteValueAMD64_OpAMD64SETEQ(v *Value) bool { } v.reset(OpAMD64SETAE) v0 := b.NewValue0(v.Pos, OpAMD64BTQconst, types.TypeFlags) - v0.AuxInt = 0 + v0.AuxInt = int8ToAuxInt(0) v0.AddArg(x) v.AddArg(v0) return true @@ -22657,11 +22618,11 @@ func rewriteValueAMD64_OpAMD64SETEQ(v *Value) bool { v_0_1 := v_0.Args[1] for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { z1 := v_0_0 - if z1.Op != OpAMD64SHRLconst || z1.AuxInt != 31 { + if z1.Op != OpAMD64SHRLconst || auxIntToInt8(z1.AuxInt) != 31 { continue } z1_0 := z1.Args[0] - if z1_0.Op != OpAMD64SHLLconst || z1_0.AuxInt != 31 { + if z1_0.Op != OpAMD64SHLLconst || auxIntToInt8(z1_0.AuxInt) != 31 { continue } x := z1_0.Args[0] @@ -22671,7 +22632,7 @@ func rewriteValueAMD64_OpAMD64SETEQ(v *Value) bool { } v.reset(OpAMD64SETAE) v0 := b.NewValue0(v.Pos, OpAMD64BTLconst, types.TypeFlags) - v0.AuxInt = 0 + v0.AuxInt = int8ToAuxInt(0) v0.AddArg(x) v.AddArg(v0) return true @@ -22690,7 +22651,7 @@ func rewriteValueAMD64_OpAMD64SETEQ(v *Value) bool { v_0_1 := v_0.Args[1] for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { z1 := v_0_0 - if z1.Op != OpAMD64SHRQconst || z1.AuxInt != 63 { + if z1.Op != OpAMD64SHRQconst || auxIntToInt8(z1.AuxInt) != 63 { continue } x := z1.Args[0] @@ -22700,7 +22661,7 @@ func rewriteValueAMD64_OpAMD64SETEQ(v *Value) bool { } v.reset(OpAMD64SETAE) v0 := b.NewValue0(v.Pos, OpAMD64BTQconst, types.TypeFlags) - v0.AuxInt = 63 + v0.AuxInt = int8ToAuxInt(63) v0.AddArg(x) v.AddArg(v0) return true @@ -22719,7 +22680,7 @@ func rewriteValueAMD64_OpAMD64SETEQ(v *Value) bool { v_0_1 := v_0.Args[1] for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { z1 := v_0_0 - if z1.Op != OpAMD64SHRLconst || z1.AuxInt != 31 { + if z1.Op != OpAMD64SHRLconst || auxIntToInt8(z1.AuxInt) != 31 { continue } x := z1.Args[0] @@ -22729,7 +22690,7 @@ func rewriteValueAMD64_OpAMD64SETEQ(v *Value) bool { } v.reset(OpAMD64SETAE) v0 := b.NewValue0(v.Pos, OpAMD64BTLconst, types.TypeFlags) - v0.AuxInt = 31 + v0.AuxInt = int8ToAuxInt(31) v0.AddArg(x) v.AddArg(v0) return true @@ -22808,8 +22769,8 @@ func rewriteValueAMD64_OpAMD64SETEQstore(v *Value) bool { // match: (SETEQstore [off] {sym} ptr (TESTL (SHLL (MOVLconst [1]) x) y) mem) // result: (SETAEstore [off] {sym} ptr (BTL x y) mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64TESTL { break @@ -22823,14 +22784,14 @@ func rewriteValueAMD64_OpAMD64SETEQstore(v *Value) bool { } x := v_1_0.Args[1] v_1_0_0 := v_1_0.Args[0] - if v_1_0_0.Op != OpAMD64MOVLconst || v_1_0_0.AuxInt != 1 { + if v_1_0_0.Op != OpAMD64MOVLconst || auxIntToInt32(v_1_0_0.AuxInt) != 1 { continue } y := v_1_1 mem := v_2 v.reset(OpAMD64SETAEstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v0 := b.NewValue0(v.Pos, OpAMD64BTL, types.TypeFlags) v0.AddArg2(x, y) v.AddArg3(ptr, v0, mem) @@ -22841,8 +22802,8 @@ func rewriteValueAMD64_OpAMD64SETEQstore(v *Value) bool { // match: (SETEQstore [off] {sym} ptr (TESTQ (SHLQ (MOVQconst [1]) x) y) mem) // result: (SETAEstore [off] {sym} ptr (BTQ x y) mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64TESTQ { break @@ -22856,14 +22817,14 @@ func rewriteValueAMD64_OpAMD64SETEQstore(v *Value) bool { } x := v_1_0.Args[1] v_1_0_0 := v_1_0.Args[0] - if v_1_0_0.Op != OpAMD64MOVQconst || v_1_0_0.AuxInt != 1 { + if v_1_0_0.Op != OpAMD64MOVQconst || auxIntToInt64(v_1_0_0.AuxInt) != 1 { continue } y := v_1_1 mem := v_2 v.reset(OpAMD64SETAEstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v0 := b.NewValue0(v.Pos, OpAMD64BTQ, types.TypeFlags) v0.AddArg2(x, y) v.AddArg3(ptr, v0, mem) @@ -22872,61 +22833,61 @@ func rewriteValueAMD64_OpAMD64SETEQstore(v *Value) bool { break } // match: (SETEQstore [off] {sym} ptr (TESTLconst [c] x) mem) - // cond: isUint32PowerOfTwo(c) - // result: (SETAEstore [off] {sym} ptr (BTLconst [log2uint32(c)] x) mem) + // cond: isUint32PowerOfTwo(int64(c)) + // result: (SETAEstore [off] {sym} ptr (BTLconst [int8(log32(c))] x) mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64TESTLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) x := v_1.Args[0] mem := v_2 - if !(isUint32PowerOfTwo(c)) { + if !(isUint32PowerOfTwo(int64(c))) { break } v.reset(OpAMD64SETAEstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v0 := b.NewValue0(v.Pos, OpAMD64BTLconst, types.TypeFlags) - v0.AuxInt = log2uint32(c) + v0.AuxInt = int8ToAuxInt(int8(log32(c))) v0.AddArg(x) v.AddArg3(ptr, v0, mem) return true } // match: (SETEQstore [off] {sym} ptr (TESTQconst [c] x) mem) - // cond: isUint64PowerOfTwo(c) - // result: (SETAEstore [off] {sym} ptr (BTQconst [log2(c)] x) mem) + // cond: isUint64PowerOfTwo(int64(c)) + // result: (SETAEstore [off] {sym} ptr (BTQconst [int8(log32(c))] x) mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64TESTQconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) x := v_1.Args[0] mem := v_2 - if !(isUint64PowerOfTwo(c)) { + if !(isUint64PowerOfTwo(int64(c))) { break } v.reset(OpAMD64SETAEstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v0 := b.NewValue0(v.Pos, OpAMD64BTQconst, types.TypeFlags) - v0.AuxInt = log2(c) + v0.AuxInt = int8ToAuxInt(int8(log32(c))) v0.AddArg(x) v.AddArg3(ptr, v0, mem) return true } // match: (SETEQstore [off] {sym} ptr (TESTQ (MOVQconst [c]) x) mem) // cond: isUint64PowerOfTwo(c) - // result: (SETAEstore [off] {sym} ptr (BTQconst [log2(c)] x) mem) + // result: (SETAEstore [off] {sym} ptr (BTQconst [int8(log2(c))] x) mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64TESTQ { break @@ -22938,17 +22899,17 @@ func rewriteValueAMD64_OpAMD64SETEQstore(v *Value) bool { if v_1_0.Op != OpAMD64MOVQconst { continue } - c := v_1_0.AuxInt + c := auxIntToInt64(v_1_0.AuxInt) x := v_1_1 mem := v_2 if !(isUint64PowerOfTwo(c)) { continue } v.reset(OpAMD64SETAEstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v0 := b.NewValue0(v.Pos, OpAMD64BTQconst, types.TypeFlags) - v0.AuxInt = log2(c) + v0.AuxInt = int8ToAuxInt(int8(log2(c))) v0.AddArg(x) v.AddArg3(ptr, v0, mem) return true @@ -22958,22 +22919,22 @@ func rewriteValueAMD64_OpAMD64SETEQstore(v *Value) bool { // match: (SETEQstore [off] {sym} ptr (CMPLconst [1] s:(ANDLconst [1] _)) mem) // result: (SETNEstore [off] {sym} ptr (CMPLconst [0] s) mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 - if v_1.Op != OpAMD64CMPLconst || v_1.AuxInt != 1 { + if v_1.Op != OpAMD64CMPLconst || auxIntToInt32(v_1.AuxInt) != 1 { break } s := v_1.Args[0] - if s.Op != OpAMD64ANDLconst || s.AuxInt != 1 { + if s.Op != OpAMD64ANDLconst || auxIntToInt32(s.AuxInt) != 1 { break } mem := v_2 v.reset(OpAMD64SETNEstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v0 := b.NewValue0(v.Pos, OpAMD64CMPLconst, types.TypeFlags) - v0.AuxInt = 0 + v0.AuxInt = int32ToAuxInt(0) v0.AddArg(s) v.AddArg3(ptr, v0, mem) return true @@ -22981,22 +22942,22 @@ func rewriteValueAMD64_OpAMD64SETEQstore(v *Value) bool { // match: (SETEQstore [off] {sym} ptr (CMPQconst [1] s:(ANDQconst [1] _)) mem) // result: (SETNEstore [off] {sym} ptr (CMPQconst [0] s) mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 - if v_1.Op != OpAMD64CMPQconst || v_1.AuxInt != 1 { + if v_1.Op != OpAMD64CMPQconst || auxIntToInt32(v_1.AuxInt) != 1 { break } s := v_1.Args[0] - if s.Op != OpAMD64ANDQconst || s.AuxInt != 1 { + if s.Op != OpAMD64ANDQconst || auxIntToInt32(s.AuxInt) != 1 { break } mem := v_2 v.reset(OpAMD64SETNEstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v0 := b.NewValue0(v.Pos, OpAMD64CMPQconst, types.TypeFlags) - v0.AuxInt = 0 + v0.AuxInt = int32ToAuxInt(0) v0.AddArg(s) v.AddArg3(ptr, v0, mem) return true @@ -23005,8 +22966,8 @@ func rewriteValueAMD64_OpAMD64SETEQstore(v *Value) bool { // cond: z1==z2 // result: (SETAEstore [off] {sym} ptr (BTQconst [63] x) mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64TESTQ { break @@ -23016,11 +22977,11 @@ func rewriteValueAMD64_OpAMD64SETEQstore(v *Value) bool { v_1_1 := v_1.Args[1] for _i0 := 0; _i0 <= 1; _i0, v_1_0, v_1_1 = _i0+1, v_1_1, v_1_0 { z1 := v_1_0 - if z1.Op != OpAMD64SHLQconst || z1.AuxInt != 63 { + if z1.Op != OpAMD64SHLQconst || auxIntToInt8(z1.AuxInt) != 63 { continue } z1_0 := z1.Args[0] - if z1_0.Op != OpAMD64SHRQconst || z1_0.AuxInt != 63 { + if z1_0.Op != OpAMD64SHRQconst || auxIntToInt8(z1_0.AuxInt) != 63 { continue } x := z1_0.Args[0] @@ -23030,10 +22991,10 @@ func rewriteValueAMD64_OpAMD64SETEQstore(v *Value) bool { continue } v.reset(OpAMD64SETAEstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v0 := b.NewValue0(v.Pos, OpAMD64BTQconst, types.TypeFlags) - v0.AuxInt = 63 + v0.AuxInt = int8ToAuxInt(63) v0.AddArg(x) v.AddArg3(ptr, v0, mem) return true @@ -23044,8 +23005,8 @@ func rewriteValueAMD64_OpAMD64SETEQstore(v *Value) bool { // cond: z1==z2 // result: (SETAEstore [off] {sym} ptr (BTLconst [31] x) mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64TESTL { break @@ -23055,11 +23016,11 @@ func rewriteValueAMD64_OpAMD64SETEQstore(v *Value) bool { v_1_1 := v_1.Args[1] for _i0 := 0; _i0 <= 1; _i0, v_1_0, v_1_1 = _i0+1, v_1_1, v_1_0 { z1 := v_1_0 - if z1.Op != OpAMD64SHLLconst || z1.AuxInt != 31 { + if z1.Op != OpAMD64SHLLconst || auxIntToInt8(z1.AuxInt) != 31 { continue } z1_0 := z1.Args[0] - if z1_0.Op != OpAMD64SHRLconst || z1_0.AuxInt != 31 { + if z1_0.Op != OpAMD64SHRLconst || auxIntToInt8(z1_0.AuxInt) != 31 { continue } x := z1_0.Args[0] @@ -23069,10 +23030,10 @@ func rewriteValueAMD64_OpAMD64SETEQstore(v *Value) bool { continue } v.reset(OpAMD64SETAEstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v0 := b.NewValue0(v.Pos, OpAMD64BTLconst, types.TypeFlags) - v0.AuxInt = 31 + v0.AuxInt = int8ToAuxInt(31) v0.AddArg(x) v.AddArg3(ptr, v0, mem) return true @@ -23083,8 +23044,8 @@ func rewriteValueAMD64_OpAMD64SETEQstore(v *Value) bool { // cond: z1==z2 // result: (SETAEstore [off] {sym} ptr (BTQconst [0] x) mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64TESTQ { break @@ -23094,11 +23055,11 @@ func rewriteValueAMD64_OpAMD64SETEQstore(v *Value) bool { v_1_1 := v_1.Args[1] for _i0 := 0; _i0 <= 1; _i0, v_1_0, v_1_1 = _i0+1, v_1_1, v_1_0 { z1 := v_1_0 - if z1.Op != OpAMD64SHRQconst || z1.AuxInt != 63 { + if z1.Op != OpAMD64SHRQconst || auxIntToInt8(z1.AuxInt) != 63 { continue } z1_0 := z1.Args[0] - if z1_0.Op != OpAMD64SHLQconst || z1_0.AuxInt != 63 { + if z1_0.Op != OpAMD64SHLQconst || auxIntToInt8(z1_0.AuxInt) != 63 { continue } x := z1_0.Args[0] @@ -23108,10 +23069,10 @@ func rewriteValueAMD64_OpAMD64SETEQstore(v *Value) bool { continue } v.reset(OpAMD64SETAEstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v0 := b.NewValue0(v.Pos, OpAMD64BTQconst, types.TypeFlags) - v0.AuxInt = 0 + v0.AuxInt = int8ToAuxInt(0) v0.AddArg(x) v.AddArg3(ptr, v0, mem) return true @@ -23122,8 +23083,8 @@ func rewriteValueAMD64_OpAMD64SETEQstore(v *Value) bool { // cond: z1==z2 // result: (SETAEstore [off] {sym} ptr (BTLconst [0] x) mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64TESTL { break @@ -23133,11 +23094,11 @@ func rewriteValueAMD64_OpAMD64SETEQstore(v *Value) bool { v_1_1 := v_1.Args[1] for _i0 := 0; _i0 <= 1; _i0, v_1_0, v_1_1 = _i0+1, v_1_1, v_1_0 { z1 := v_1_0 - if z1.Op != OpAMD64SHRLconst || z1.AuxInt != 31 { + if z1.Op != OpAMD64SHRLconst || auxIntToInt8(z1.AuxInt) != 31 { continue } z1_0 := z1.Args[0] - if z1_0.Op != OpAMD64SHLLconst || z1_0.AuxInt != 31 { + if z1_0.Op != OpAMD64SHLLconst || auxIntToInt8(z1_0.AuxInt) != 31 { continue } x := z1_0.Args[0] @@ -23147,10 +23108,10 @@ func rewriteValueAMD64_OpAMD64SETEQstore(v *Value) bool { continue } v.reset(OpAMD64SETAEstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v0 := b.NewValue0(v.Pos, OpAMD64BTLconst, types.TypeFlags) - v0.AuxInt = 0 + v0.AuxInt = int8ToAuxInt(0) v0.AddArg(x) v.AddArg3(ptr, v0, mem) return true @@ -23161,8 +23122,8 @@ func rewriteValueAMD64_OpAMD64SETEQstore(v *Value) bool { // cond: z1==z2 // result: (SETAEstore [off] {sym} ptr (BTQconst [63] x) mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64TESTQ { break @@ -23172,7 +23133,7 @@ func rewriteValueAMD64_OpAMD64SETEQstore(v *Value) bool { v_1_1 := v_1.Args[1] for _i0 := 0; _i0 <= 1; _i0, v_1_0, v_1_1 = _i0+1, v_1_1, v_1_0 { z1 := v_1_0 - if z1.Op != OpAMD64SHRQconst || z1.AuxInt != 63 { + if z1.Op != OpAMD64SHRQconst || auxIntToInt8(z1.AuxInt) != 63 { continue } x := z1.Args[0] @@ -23182,10 +23143,10 @@ func rewriteValueAMD64_OpAMD64SETEQstore(v *Value) bool { continue } v.reset(OpAMD64SETAEstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v0 := b.NewValue0(v.Pos, OpAMD64BTQconst, types.TypeFlags) - v0.AuxInt = 63 + v0.AuxInt = int8ToAuxInt(63) v0.AddArg(x) v.AddArg3(ptr, v0, mem) return true @@ -23196,8 +23157,8 @@ func rewriteValueAMD64_OpAMD64SETEQstore(v *Value) bool { // cond: z1==z2 // result: (SETAEstore [off] {sym} ptr (BTLconst [31] x) mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64TESTL { break @@ -23207,7 +23168,7 @@ func rewriteValueAMD64_OpAMD64SETEQstore(v *Value) bool { v_1_1 := v_1.Args[1] for _i0 := 0; _i0 <= 1; _i0, v_1_0, v_1_1 = _i0+1, v_1_1, v_1_0 { z1 := v_1_0 - if z1.Op != OpAMD64SHRLconst || z1.AuxInt != 31 { + if z1.Op != OpAMD64SHRLconst || auxIntToInt8(z1.AuxInt) != 31 { continue } x := z1.Args[0] @@ -23217,10 +23178,10 @@ func rewriteValueAMD64_OpAMD64SETEQstore(v *Value) bool { continue } v.reset(OpAMD64SETAEstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v0 := b.NewValue0(v.Pos, OpAMD64BTLconst, types.TypeFlags) - v0.AuxInt = 31 + v0.AuxInt = int8ToAuxInt(31) v0.AddArg(x) v.AddArg3(ptr, v0, mem) return true @@ -23230,8 +23191,8 @@ func rewriteValueAMD64_OpAMD64SETEQstore(v *Value) bool { // match: (SETEQstore [off] {sym} ptr (InvertFlags x) mem) // result: (SETEQstore [off] {sym} ptr x mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64InvertFlags { break @@ -23239,30 +23200,30 @@ func rewriteValueAMD64_OpAMD64SETEQstore(v *Value) bool { x := v_1.Args[0] mem := v_2 v.reset(OpAMD64SETEQstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(ptr, x, mem) return true } // match: (SETEQstore [off1] {sym} (ADDQconst [off2] base) val mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (SETEQstore [off1+off2] {sym} base val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64SETEQstore) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(base, val, mem) return true } @@ -23520,8 +23481,8 @@ func rewriteValueAMD64_OpAMD64SETGEstore(v *Value) bool { // match: (SETGEstore [off] {sym} ptr (InvertFlags x) mem) // result: (SETLEstore [off] {sym} ptr x mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64InvertFlags { break @@ -23529,30 +23490,30 @@ func rewriteValueAMD64_OpAMD64SETGEstore(v *Value) bool { x := v_1.Args[0] mem := v_2 v.reset(OpAMD64SETLEstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(ptr, x, mem) return true } // match: (SETGEstore [off1] {sym} (ADDQconst [off2] base) val mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (SETGEstore [off1+off2] {sym} base val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64SETGEstore) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(base, val, mem) return true } @@ -23680,8 +23641,8 @@ func rewriteValueAMD64_OpAMD64SETGstore(v *Value) bool { // match: (SETGstore [off] {sym} ptr (InvertFlags x) mem) // result: (SETLstore [off] {sym} ptr x mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64InvertFlags { break @@ -23689,30 +23650,30 @@ func rewriteValueAMD64_OpAMD64SETGstore(v *Value) bool { x := v_1.Args[0] mem := v_2 v.reset(OpAMD64SETLstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(ptr, x, mem) return true } // match: (SETGstore [off1] {sym} (ADDQconst [off2] base) val mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (SETGstore [off1+off2] {sym} base val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64SETGstore) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(base, val, mem) return true } @@ -23970,8 +23931,8 @@ func rewriteValueAMD64_OpAMD64SETLEstore(v *Value) bool { // match: (SETLEstore [off] {sym} ptr (InvertFlags x) mem) // result: (SETGEstore [off] {sym} ptr x mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64InvertFlags { break @@ -23979,30 +23940,30 @@ func rewriteValueAMD64_OpAMD64SETLEstore(v *Value) bool { x := v_1.Args[0] mem := v_2 v.reset(OpAMD64SETGEstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(ptr, x, mem) return true } // match: (SETLEstore [off1] {sym} (ADDQconst [off2] base) val mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (SETLEstore [off1+off2] {sym} base val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64SETLEstore) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(base, val, mem) return true } @@ -24130,8 +24091,8 @@ func rewriteValueAMD64_OpAMD64SETLstore(v *Value) bool { // match: (SETLstore [off] {sym} ptr (InvertFlags x) mem) // result: (SETGstore [off] {sym} ptr x mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64InvertFlags { break @@ -24139,30 +24100,30 @@ func rewriteValueAMD64_OpAMD64SETLstore(v *Value) bool { x := v_1.Args[0] mem := v_2 v.reset(OpAMD64SETGstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(ptr, x, mem) return true } // match: (SETLstore [off1] {sym} (ADDQconst [off2] base) val mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (SETLstore [off1+off2] {sym} base val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64SETLstore) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(base, val, mem) return true } @@ -24323,7 +24284,7 @@ func rewriteValueAMD64_OpAMD64SETNE(v *Value) bool { } x := v_0_0.Args[1] v_0_0_0 := v_0_0.Args[0] - if v_0_0_0.Op != OpAMD64MOVLconst || v_0_0_0.AuxInt != 1 { + if v_0_0_0.Op != OpAMD64MOVLconst || auxIntToInt32(v_0_0_0.AuxInt) != 1 { continue } y := v_0_1 @@ -24350,7 +24311,7 @@ func rewriteValueAMD64_OpAMD64SETNE(v *Value) bool { } x := v_0_0.Args[1] v_0_0_0 := v_0_0.Args[0] - if v_0_0_0.Op != OpAMD64MOVQconst || v_0_0_0.AuxInt != 1 { + if v_0_0_0.Op != OpAMD64MOVQconst || auxIntToInt64(v_0_0_0.AuxInt) != 1 { continue } y := v_0_1 @@ -24363,46 +24324,46 @@ func rewriteValueAMD64_OpAMD64SETNE(v *Value) bool { break } // match: (SETNE (TESTLconst [c] x)) - // cond: isUint32PowerOfTwo(c) - // result: (SETB (BTLconst [log2uint32(c)] x)) + // cond: isUint32PowerOfTwo(int64(c)) + // result: (SETB (BTLconst [int8(log32(c))] x)) for { if v_0.Op != OpAMD64TESTLconst { break } - c := v_0.AuxInt + c := auxIntToInt32(v_0.AuxInt) x := v_0.Args[0] - if !(isUint32PowerOfTwo(c)) { + if !(isUint32PowerOfTwo(int64(c))) { break } v.reset(OpAMD64SETB) v0 := b.NewValue0(v.Pos, OpAMD64BTLconst, types.TypeFlags) - v0.AuxInt = log2uint32(c) + v0.AuxInt = int8ToAuxInt(int8(log32(c))) v0.AddArg(x) v.AddArg(v0) return true } // match: (SETNE (TESTQconst [c] x)) - // cond: isUint64PowerOfTwo(c) - // result: (SETB (BTQconst [log2(c)] x)) + // cond: isUint64PowerOfTwo(int64(c)) + // result: (SETB (BTQconst [int8(log32(c))] x)) for { if v_0.Op != OpAMD64TESTQconst { break } - c := v_0.AuxInt + c := auxIntToInt32(v_0.AuxInt) x := v_0.Args[0] - if !(isUint64PowerOfTwo(c)) { + if !(isUint64PowerOfTwo(int64(c))) { break } v.reset(OpAMD64SETB) v0 := b.NewValue0(v.Pos, OpAMD64BTQconst, types.TypeFlags) - v0.AuxInt = log2(c) + v0.AuxInt = int8ToAuxInt(int8(log32(c))) v0.AddArg(x) v.AddArg(v0) return true } // match: (SETNE (TESTQ (MOVQconst [c]) x)) // cond: isUint64PowerOfTwo(c) - // result: (SETB (BTQconst [log2(c)] x)) + // result: (SETB (BTQconst [int8(log2(c))] x)) for { if v_0.Op != OpAMD64TESTQ { break @@ -24414,14 +24375,14 @@ func rewriteValueAMD64_OpAMD64SETNE(v *Value) bool { if v_0_0.Op != OpAMD64MOVQconst { continue } - c := v_0_0.AuxInt + c := auxIntToInt64(v_0_0.AuxInt) x := v_0_1 if !(isUint64PowerOfTwo(c)) { continue } v.reset(OpAMD64SETB) v0 := b.NewValue0(v.Pos, OpAMD64BTQconst, types.TypeFlags) - v0.AuxInt = log2(c) + v0.AuxInt = int8ToAuxInt(int8(log2(c))) v0.AddArg(x) v.AddArg(v0) return true @@ -24431,16 +24392,16 @@ func rewriteValueAMD64_OpAMD64SETNE(v *Value) bool { // match: (SETNE (CMPLconst [1] s:(ANDLconst [1] _))) // result: (SETEQ (CMPLconst [0] s)) for { - if v_0.Op != OpAMD64CMPLconst || v_0.AuxInt != 1 { + if v_0.Op != OpAMD64CMPLconst || auxIntToInt32(v_0.AuxInt) != 1 { break } s := v_0.Args[0] - if s.Op != OpAMD64ANDLconst || s.AuxInt != 1 { + if s.Op != OpAMD64ANDLconst || auxIntToInt32(s.AuxInt) != 1 { break } v.reset(OpAMD64SETEQ) v0 := b.NewValue0(v.Pos, OpAMD64CMPLconst, types.TypeFlags) - v0.AuxInt = 0 + v0.AuxInt = int32ToAuxInt(0) v0.AddArg(s) v.AddArg(v0) return true @@ -24448,16 +24409,16 @@ func rewriteValueAMD64_OpAMD64SETNE(v *Value) bool { // match: (SETNE (CMPQconst [1] s:(ANDQconst [1] _))) // result: (SETEQ (CMPQconst [0] s)) for { - if v_0.Op != OpAMD64CMPQconst || v_0.AuxInt != 1 { + if v_0.Op != OpAMD64CMPQconst || auxIntToInt32(v_0.AuxInt) != 1 { break } s := v_0.Args[0] - if s.Op != OpAMD64ANDQconst || s.AuxInt != 1 { + if s.Op != OpAMD64ANDQconst || auxIntToInt32(s.AuxInt) != 1 { break } v.reset(OpAMD64SETEQ) v0 := b.NewValue0(v.Pos, OpAMD64CMPQconst, types.TypeFlags) - v0.AuxInt = 0 + v0.AuxInt = int32ToAuxInt(0) v0.AddArg(s) v.AddArg(v0) return true @@ -24474,11 +24435,11 @@ func rewriteValueAMD64_OpAMD64SETNE(v *Value) bool { v_0_1 := v_0.Args[1] for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { z1 := v_0_0 - if z1.Op != OpAMD64SHLQconst || z1.AuxInt != 63 { + if z1.Op != OpAMD64SHLQconst || auxIntToInt8(z1.AuxInt) != 63 { continue } z1_0 := z1.Args[0] - if z1_0.Op != OpAMD64SHRQconst || z1_0.AuxInt != 63 { + if z1_0.Op != OpAMD64SHRQconst || auxIntToInt8(z1_0.AuxInt) != 63 { continue } x := z1_0.Args[0] @@ -24488,7 +24449,7 @@ func rewriteValueAMD64_OpAMD64SETNE(v *Value) bool { } v.reset(OpAMD64SETB) v0 := b.NewValue0(v.Pos, OpAMD64BTQconst, types.TypeFlags) - v0.AuxInt = 63 + v0.AuxInt = int8ToAuxInt(63) v0.AddArg(x) v.AddArg(v0) return true @@ -24507,11 +24468,11 @@ func rewriteValueAMD64_OpAMD64SETNE(v *Value) bool { v_0_1 := v_0.Args[1] for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { z1 := v_0_0 - if z1.Op != OpAMD64SHLLconst || z1.AuxInt != 31 { + if z1.Op != OpAMD64SHLLconst || auxIntToInt8(z1.AuxInt) != 31 { continue } z1_0 := z1.Args[0] - if z1_0.Op != OpAMD64SHRQconst || z1_0.AuxInt != 31 { + if z1_0.Op != OpAMD64SHRQconst || auxIntToInt8(z1_0.AuxInt) != 31 { continue } x := z1_0.Args[0] @@ -24521,7 +24482,7 @@ func rewriteValueAMD64_OpAMD64SETNE(v *Value) bool { } v.reset(OpAMD64SETB) v0 := b.NewValue0(v.Pos, OpAMD64BTQconst, types.TypeFlags) - v0.AuxInt = 31 + v0.AuxInt = int8ToAuxInt(31) v0.AddArg(x) v.AddArg(v0) return true @@ -24540,11 +24501,11 @@ func rewriteValueAMD64_OpAMD64SETNE(v *Value) bool { v_0_1 := v_0.Args[1] for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { z1 := v_0_0 - if z1.Op != OpAMD64SHRQconst || z1.AuxInt != 63 { + if z1.Op != OpAMD64SHRQconst || auxIntToInt8(z1.AuxInt) != 63 { continue } z1_0 := z1.Args[0] - if z1_0.Op != OpAMD64SHLQconst || z1_0.AuxInt != 63 { + if z1_0.Op != OpAMD64SHLQconst || auxIntToInt8(z1_0.AuxInt) != 63 { continue } x := z1_0.Args[0] @@ -24554,7 +24515,7 @@ func rewriteValueAMD64_OpAMD64SETNE(v *Value) bool { } v.reset(OpAMD64SETB) v0 := b.NewValue0(v.Pos, OpAMD64BTQconst, types.TypeFlags) - v0.AuxInt = 0 + v0.AuxInt = int8ToAuxInt(0) v0.AddArg(x) v.AddArg(v0) return true @@ -24573,11 +24534,11 @@ func rewriteValueAMD64_OpAMD64SETNE(v *Value) bool { v_0_1 := v_0.Args[1] for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { z1 := v_0_0 - if z1.Op != OpAMD64SHRLconst || z1.AuxInt != 31 { + if z1.Op != OpAMD64SHRLconst || auxIntToInt8(z1.AuxInt) != 31 { continue } z1_0 := z1.Args[0] - if z1_0.Op != OpAMD64SHLLconst || z1_0.AuxInt != 31 { + if z1_0.Op != OpAMD64SHLLconst || auxIntToInt8(z1_0.AuxInt) != 31 { continue } x := z1_0.Args[0] @@ -24587,7 +24548,7 @@ func rewriteValueAMD64_OpAMD64SETNE(v *Value) bool { } v.reset(OpAMD64SETB) v0 := b.NewValue0(v.Pos, OpAMD64BTLconst, types.TypeFlags) - v0.AuxInt = 0 + v0.AuxInt = int8ToAuxInt(0) v0.AddArg(x) v.AddArg(v0) return true @@ -24606,7 +24567,7 @@ func rewriteValueAMD64_OpAMD64SETNE(v *Value) bool { v_0_1 := v_0.Args[1] for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { z1 := v_0_0 - if z1.Op != OpAMD64SHRQconst || z1.AuxInt != 63 { + if z1.Op != OpAMD64SHRQconst || auxIntToInt8(z1.AuxInt) != 63 { continue } x := z1.Args[0] @@ -24616,7 +24577,7 @@ func rewriteValueAMD64_OpAMD64SETNE(v *Value) bool { } v.reset(OpAMD64SETB) v0 := b.NewValue0(v.Pos, OpAMD64BTQconst, types.TypeFlags) - v0.AuxInt = 63 + v0.AuxInt = int8ToAuxInt(63) v0.AddArg(x) v.AddArg(v0) return true @@ -24635,7 +24596,7 @@ func rewriteValueAMD64_OpAMD64SETNE(v *Value) bool { v_0_1 := v_0.Args[1] for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { z1 := v_0_0 - if z1.Op != OpAMD64SHRLconst || z1.AuxInt != 31 { + if z1.Op != OpAMD64SHRLconst || auxIntToInt8(z1.AuxInt) != 31 { continue } x := z1.Args[0] @@ -24645,7 +24606,7 @@ func rewriteValueAMD64_OpAMD64SETNE(v *Value) bool { } v.reset(OpAMD64SETB) v0 := b.NewValue0(v.Pos, OpAMD64BTLconst, types.TypeFlags) - v0.AuxInt = 31 + v0.AuxInt = int8ToAuxInt(31) v0.AddArg(x) v.AddArg(v0) return true @@ -24724,8 +24685,8 @@ func rewriteValueAMD64_OpAMD64SETNEstore(v *Value) bool { // match: (SETNEstore [off] {sym} ptr (TESTL (SHLL (MOVLconst [1]) x) y) mem) // result: (SETBstore [off] {sym} ptr (BTL x y) mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64TESTL { break @@ -24739,14 +24700,14 @@ func rewriteValueAMD64_OpAMD64SETNEstore(v *Value) bool { } x := v_1_0.Args[1] v_1_0_0 := v_1_0.Args[0] - if v_1_0_0.Op != OpAMD64MOVLconst || v_1_0_0.AuxInt != 1 { + if v_1_0_0.Op != OpAMD64MOVLconst || auxIntToInt32(v_1_0_0.AuxInt) != 1 { continue } y := v_1_1 mem := v_2 v.reset(OpAMD64SETBstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v0 := b.NewValue0(v.Pos, OpAMD64BTL, types.TypeFlags) v0.AddArg2(x, y) v.AddArg3(ptr, v0, mem) @@ -24757,8 +24718,8 @@ func rewriteValueAMD64_OpAMD64SETNEstore(v *Value) bool { // match: (SETNEstore [off] {sym} ptr (TESTQ (SHLQ (MOVQconst [1]) x) y) mem) // result: (SETBstore [off] {sym} ptr (BTQ x y) mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64TESTQ { break @@ -24772,14 +24733,14 @@ func rewriteValueAMD64_OpAMD64SETNEstore(v *Value) bool { } x := v_1_0.Args[1] v_1_0_0 := v_1_0.Args[0] - if v_1_0_0.Op != OpAMD64MOVQconst || v_1_0_0.AuxInt != 1 { + if v_1_0_0.Op != OpAMD64MOVQconst || auxIntToInt64(v_1_0_0.AuxInt) != 1 { continue } y := v_1_1 mem := v_2 v.reset(OpAMD64SETBstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v0 := b.NewValue0(v.Pos, OpAMD64BTQ, types.TypeFlags) v0.AddArg2(x, y) v.AddArg3(ptr, v0, mem) @@ -24788,61 +24749,61 @@ func rewriteValueAMD64_OpAMD64SETNEstore(v *Value) bool { break } // match: (SETNEstore [off] {sym} ptr (TESTLconst [c] x) mem) - // cond: isUint32PowerOfTwo(c) - // result: (SETBstore [off] {sym} ptr (BTLconst [log2uint32(c)] x) mem) + // cond: isUint32PowerOfTwo(int64(c)) + // result: (SETBstore [off] {sym} ptr (BTLconst [int8(log32(c))] x) mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64TESTLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) x := v_1.Args[0] mem := v_2 - if !(isUint32PowerOfTwo(c)) { + if !(isUint32PowerOfTwo(int64(c))) { break } v.reset(OpAMD64SETBstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v0 := b.NewValue0(v.Pos, OpAMD64BTLconst, types.TypeFlags) - v0.AuxInt = log2uint32(c) + v0.AuxInt = int8ToAuxInt(int8(log32(c))) v0.AddArg(x) v.AddArg3(ptr, v0, mem) return true } // match: (SETNEstore [off] {sym} ptr (TESTQconst [c] x) mem) - // cond: isUint64PowerOfTwo(c) - // result: (SETBstore [off] {sym} ptr (BTQconst [log2(c)] x) mem) + // cond: isUint64PowerOfTwo(int64(c)) + // result: (SETBstore [off] {sym} ptr (BTQconst [int8(log32(c))] x) mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64TESTQconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) x := v_1.Args[0] mem := v_2 - if !(isUint64PowerOfTwo(c)) { + if !(isUint64PowerOfTwo(int64(c))) { break } v.reset(OpAMD64SETBstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v0 := b.NewValue0(v.Pos, OpAMD64BTQconst, types.TypeFlags) - v0.AuxInt = log2(c) + v0.AuxInt = int8ToAuxInt(int8(log32(c))) v0.AddArg(x) v.AddArg3(ptr, v0, mem) return true } // match: (SETNEstore [off] {sym} ptr (TESTQ (MOVQconst [c]) x) mem) // cond: isUint64PowerOfTwo(c) - // result: (SETBstore [off] {sym} ptr (BTQconst [log2(c)] x) mem) + // result: (SETBstore [off] {sym} ptr (BTQconst [int8(log2(c))] x) mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64TESTQ { break @@ -24854,17 +24815,17 @@ func rewriteValueAMD64_OpAMD64SETNEstore(v *Value) bool { if v_1_0.Op != OpAMD64MOVQconst { continue } - c := v_1_0.AuxInt + c := auxIntToInt64(v_1_0.AuxInt) x := v_1_1 mem := v_2 if !(isUint64PowerOfTwo(c)) { continue } v.reset(OpAMD64SETBstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v0 := b.NewValue0(v.Pos, OpAMD64BTQconst, types.TypeFlags) - v0.AuxInt = log2(c) + v0.AuxInt = int8ToAuxInt(int8(log2(c))) v0.AddArg(x) v.AddArg3(ptr, v0, mem) return true @@ -24874,22 +24835,22 @@ func rewriteValueAMD64_OpAMD64SETNEstore(v *Value) bool { // match: (SETNEstore [off] {sym} ptr (CMPLconst [1] s:(ANDLconst [1] _)) mem) // result: (SETEQstore [off] {sym} ptr (CMPLconst [0] s) mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 - if v_1.Op != OpAMD64CMPLconst || v_1.AuxInt != 1 { + if v_1.Op != OpAMD64CMPLconst || auxIntToInt32(v_1.AuxInt) != 1 { break } s := v_1.Args[0] - if s.Op != OpAMD64ANDLconst || s.AuxInt != 1 { + if s.Op != OpAMD64ANDLconst || auxIntToInt32(s.AuxInt) != 1 { break } mem := v_2 v.reset(OpAMD64SETEQstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v0 := b.NewValue0(v.Pos, OpAMD64CMPLconst, types.TypeFlags) - v0.AuxInt = 0 + v0.AuxInt = int32ToAuxInt(0) v0.AddArg(s) v.AddArg3(ptr, v0, mem) return true @@ -24897,22 +24858,22 @@ func rewriteValueAMD64_OpAMD64SETNEstore(v *Value) bool { // match: (SETNEstore [off] {sym} ptr (CMPQconst [1] s:(ANDQconst [1] _)) mem) // result: (SETEQstore [off] {sym} ptr (CMPQconst [0] s) mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 - if v_1.Op != OpAMD64CMPQconst || v_1.AuxInt != 1 { + if v_1.Op != OpAMD64CMPQconst || auxIntToInt32(v_1.AuxInt) != 1 { break } s := v_1.Args[0] - if s.Op != OpAMD64ANDQconst || s.AuxInt != 1 { + if s.Op != OpAMD64ANDQconst || auxIntToInt32(s.AuxInt) != 1 { break } mem := v_2 v.reset(OpAMD64SETEQstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v0 := b.NewValue0(v.Pos, OpAMD64CMPQconst, types.TypeFlags) - v0.AuxInt = 0 + v0.AuxInt = int32ToAuxInt(0) v0.AddArg(s) v.AddArg3(ptr, v0, mem) return true @@ -24921,8 +24882,8 @@ func rewriteValueAMD64_OpAMD64SETNEstore(v *Value) bool { // cond: z1==z2 // result: (SETBstore [off] {sym} ptr (BTQconst [63] x) mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64TESTQ { break @@ -24932,11 +24893,11 @@ func rewriteValueAMD64_OpAMD64SETNEstore(v *Value) bool { v_1_1 := v_1.Args[1] for _i0 := 0; _i0 <= 1; _i0, v_1_0, v_1_1 = _i0+1, v_1_1, v_1_0 { z1 := v_1_0 - if z1.Op != OpAMD64SHLQconst || z1.AuxInt != 63 { + if z1.Op != OpAMD64SHLQconst || auxIntToInt8(z1.AuxInt) != 63 { continue } z1_0 := z1.Args[0] - if z1_0.Op != OpAMD64SHRQconst || z1_0.AuxInt != 63 { + if z1_0.Op != OpAMD64SHRQconst || auxIntToInt8(z1_0.AuxInt) != 63 { continue } x := z1_0.Args[0] @@ -24946,10 +24907,10 @@ func rewriteValueAMD64_OpAMD64SETNEstore(v *Value) bool { continue } v.reset(OpAMD64SETBstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v0 := b.NewValue0(v.Pos, OpAMD64BTQconst, types.TypeFlags) - v0.AuxInt = 63 + v0.AuxInt = int8ToAuxInt(63) v0.AddArg(x) v.AddArg3(ptr, v0, mem) return true @@ -24960,8 +24921,8 @@ func rewriteValueAMD64_OpAMD64SETNEstore(v *Value) bool { // cond: z1==z2 // result: (SETBstore [off] {sym} ptr (BTLconst [31] x) mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64TESTL { break @@ -24971,11 +24932,11 @@ func rewriteValueAMD64_OpAMD64SETNEstore(v *Value) bool { v_1_1 := v_1.Args[1] for _i0 := 0; _i0 <= 1; _i0, v_1_0, v_1_1 = _i0+1, v_1_1, v_1_0 { z1 := v_1_0 - if z1.Op != OpAMD64SHLLconst || z1.AuxInt != 31 { + if z1.Op != OpAMD64SHLLconst || auxIntToInt8(z1.AuxInt) != 31 { continue } z1_0 := z1.Args[0] - if z1_0.Op != OpAMD64SHRLconst || z1_0.AuxInt != 31 { + if z1_0.Op != OpAMD64SHRLconst || auxIntToInt8(z1_0.AuxInt) != 31 { continue } x := z1_0.Args[0] @@ -24985,10 +24946,10 @@ func rewriteValueAMD64_OpAMD64SETNEstore(v *Value) bool { continue } v.reset(OpAMD64SETBstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v0 := b.NewValue0(v.Pos, OpAMD64BTLconst, types.TypeFlags) - v0.AuxInt = 31 + v0.AuxInt = int8ToAuxInt(31) v0.AddArg(x) v.AddArg3(ptr, v0, mem) return true @@ -24999,8 +24960,8 @@ func rewriteValueAMD64_OpAMD64SETNEstore(v *Value) bool { // cond: z1==z2 // result: (SETBstore [off] {sym} ptr (BTQconst [0] x) mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64TESTQ { break @@ -25010,11 +24971,11 @@ func rewriteValueAMD64_OpAMD64SETNEstore(v *Value) bool { v_1_1 := v_1.Args[1] for _i0 := 0; _i0 <= 1; _i0, v_1_0, v_1_1 = _i0+1, v_1_1, v_1_0 { z1 := v_1_0 - if z1.Op != OpAMD64SHRQconst || z1.AuxInt != 63 { + if z1.Op != OpAMD64SHRQconst || auxIntToInt8(z1.AuxInt) != 63 { continue } z1_0 := z1.Args[0] - if z1_0.Op != OpAMD64SHLQconst || z1_0.AuxInt != 63 { + if z1_0.Op != OpAMD64SHLQconst || auxIntToInt8(z1_0.AuxInt) != 63 { continue } x := z1_0.Args[0] @@ -25024,10 +24985,10 @@ func rewriteValueAMD64_OpAMD64SETNEstore(v *Value) bool { continue } v.reset(OpAMD64SETBstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v0 := b.NewValue0(v.Pos, OpAMD64BTQconst, types.TypeFlags) - v0.AuxInt = 0 + v0.AuxInt = int8ToAuxInt(0) v0.AddArg(x) v.AddArg3(ptr, v0, mem) return true @@ -25038,8 +24999,8 @@ func rewriteValueAMD64_OpAMD64SETNEstore(v *Value) bool { // cond: z1==z2 // result: (SETBstore [off] {sym} ptr (BTLconst [0] x) mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64TESTL { break @@ -25049,11 +25010,11 @@ func rewriteValueAMD64_OpAMD64SETNEstore(v *Value) bool { v_1_1 := v_1.Args[1] for _i0 := 0; _i0 <= 1; _i0, v_1_0, v_1_1 = _i0+1, v_1_1, v_1_0 { z1 := v_1_0 - if z1.Op != OpAMD64SHRLconst || z1.AuxInt != 31 { + if z1.Op != OpAMD64SHRLconst || auxIntToInt8(z1.AuxInt) != 31 { continue } z1_0 := z1.Args[0] - if z1_0.Op != OpAMD64SHLLconst || z1_0.AuxInt != 31 { + if z1_0.Op != OpAMD64SHLLconst || auxIntToInt8(z1_0.AuxInt) != 31 { continue } x := z1_0.Args[0] @@ -25063,10 +25024,10 @@ func rewriteValueAMD64_OpAMD64SETNEstore(v *Value) bool { continue } v.reset(OpAMD64SETBstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v0 := b.NewValue0(v.Pos, OpAMD64BTLconst, types.TypeFlags) - v0.AuxInt = 0 + v0.AuxInt = int8ToAuxInt(0) v0.AddArg(x) v.AddArg3(ptr, v0, mem) return true @@ -25077,8 +25038,8 @@ func rewriteValueAMD64_OpAMD64SETNEstore(v *Value) bool { // cond: z1==z2 // result: (SETBstore [off] {sym} ptr (BTQconst [63] x) mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64TESTQ { break @@ -25088,7 +25049,7 @@ func rewriteValueAMD64_OpAMD64SETNEstore(v *Value) bool { v_1_1 := v_1.Args[1] for _i0 := 0; _i0 <= 1; _i0, v_1_0, v_1_1 = _i0+1, v_1_1, v_1_0 { z1 := v_1_0 - if z1.Op != OpAMD64SHRQconst || z1.AuxInt != 63 { + if z1.Op != OpAMD64SHRQconst || auxIntToInt8(z1.AuxInt) != 63 { continue } x := z1.Args[0] @@ -25098,10 +25059,10 @@ func rewriteValueAMD64_OpAMD64SETNEstore(v *Value) bool { continue } v.reset(OpAMD64SETBstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v0 := b.NewValue0(v.Pos, OpAMD64BTQconst, types.TypeFlags) - v0.AuxInt = 63 + v0.AuxInt = int8ToAuxInt(63) v0.AddArg(x) v.AddArg3(ptr, v0, mem) return true @@ -25112,8 +25073,8 @@ func rewriteValueAMD64_OpAMD64SETNEstore(v *Value) bool { // cond: z1==z2 // result: (SETBstore [off] {sym} ptr (BTLconst [31] x) mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64TESTL { break @@ -25123,7 +25084,7 @@ func rewriteValueAMD64_OpAMD64SETNEstore(v *Value) bool { v_1_1 := v_1.Args[1] for _i0 := 0; _i0 <= 1; _i0, v_1_0, v_1_1 = _i0+1, v_1_1, v_1_0 { z1 := v_1_0 - if z1.Op != OpAMD64SHRLconst || z1.AuxInt != 31 { + if z1.Op != OpAMD64SHRLconst || auxIntToInt8(z1.AuxInt) != 31 { continue } x := z1.Args[0] @@ -25133,10 +25094,10 @@ func rewriteValueAMD64_OpAMD64SETNEstore(v *Value) bool { continue } v.reset(OpAMD64SETBstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v0 := b.NewValue0(v.Pos, OpAMD64BTLconst, types.TypeFlags) - v0.AuxInt = 31 + v0.AuxInt = int8ToAuxInt(31) v0.AddArg(x) v.AddArg3(ptr, v0, mem) return true @@ -25146,8 +25107,8 @@ func rewriteValueAMD64_OpAMD64SETNEstore(v *Value) bool { // match: (SETNEstore [off] {sym} ptr (InvertFlags x) mem) // result: (SETNEstore [off] {sym} ptr x mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpAMD64InvertFlags { break @@ -25155,30 +25116,30 @@ func rewriteValueAMD64_OpAMD64SETNEstore(v *Value) bool { x := v_1.Args[0] mem := v_2 v.reset(OpAMD64SETNEstore) - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(ptr, x, mem) return true } // match: (SETNEstore [off1] {sym} (ADDQconst [off2] base) val mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (SETNEstore [off1+off2] {sym} base val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64SETNEstore) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(base, val, mem) return true } @@ -25302,28 +25263,28 @@ func rewriteValueAMD64_OpAMD64SHLL(v *Value) bool { v_0 := v.Args[0] b := v.Block // match: (SHLL x (MOVQconst [c])) - // result: (SHLLconst [c&31] x) + // result: (SHLLconst [int8(c&31)] x) for { x := v_0 if v_1.Op != OpAMD64MOVQconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) v.reset(OpAMD64SHLLconst) - v.AuxInt = c & 31 + v.AuxInt = int8ToAuxInt(int8(c & 31)) v.AddArg(x) return true } // match: (SHLL x (MOVLconst [c])) - // result: (SHLLconst [c&31] x) + // result: (SHLLconst [int8(c&31)] x) for { x := v_0 if v_1.Op != OpAMD64MOVLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) v.reset(OpAMD64SHLLconst) - v.AuxInt = c & 31 + v.AuxInt = int8ToAuxInt(int8(c & 31)) v.AddArg(x) return true } @@ -25335,7 +25296,7 @@ func rewriteValueAMD64_OpAMD64SHLL(v *Value) bool { if v_1.Op != OpAMD64ADDQconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) y := v_1.Args[0] if !(c&31 == 0) { break @@ -25357,7 +25318,7 @@ func rewriteValueAMD64_OpAMD64SHLL(v *Value) bool { if v_1_0.Op != OpAMD64ADDQconst { break } - c := v_1_0.AuxInt + c := auxIntToInt32(v_1_0.AuxInt) y := v_1_0.Args[0] if !(c&31 == 0) { break @@ -25376,7 +25337,7 @@ func rewriteValueAMD64_OpAMD64SHLL(v *Value) bool { if v_1.Op != OpAMD64ANDQconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) y := v_1.Args[0] if !(c&31 == 31) { break @@ -25398,7 +25359,7 @@ func rewriteValueAMD64_OpAMD64SHLL(v *Value) bool { if v_1_0.Op != OpAMD64ANDQconst { break } - c := v_1_0.AuxInt + c := auxIntToInt32(v_1_0.AuxInt) y := v_1_0.Args[0] if !(c&31 == 31) { break @@ -25417,7 +25378,7 @@ func rewriteValueAMD64_OpAMD64SHLL(v *Value) bool { if v_1.Op != OpAMD64ADDLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) y := v_1.Args[0] if !(c&31 == 0) { break @@ -25439,7 +25400,7 @@ func rewriteValueAMD64_OpAMD64SHLL(v *Value) bool { if v_1_0.Op != OpAMD64ADDLconst { break } - c := v_1_0.AuxInt + c := auxIntToInt32(v_1_0.AuxInt) y := v_1_0.Args[0] if !(c&31 == 0) { break @@ -25458,7 +25419,7 @@ func rewriteValueAMD64_OpAMD64SHLL(v *Value) bool { if v_1.Op != OpAMD64ANDLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) y := v_1.Args[0] if !(c&31 == 31) { break @@ -25480,7 +25441,7 @@ func rewriteValueAMD64_OpAMD64SHLL(v *Value) bool { if v_1_0.Op != OpAMD64ANDLconst { break } - c := v_1_0.AuxInt + c := auxIntToInt32(v_1_0.AuxInt) y := v_1_0.Args[0] if !(c&31 == 31) { break @@ -25498,19 +25459,19 @@ func rewriteValueAMD64_OpAMD64SHLLconst(v *Value) bool { // match: (SHLLconst [1] (SHRLconst [1] x)) // result: (BTRLconst [0] x) for { - if v.AuxInt != 1 || v_0.Op != OpAMD64SHRLconst || v_0.AuxInt != 1 { + if auxIntToInt8(v.AuxInt) != 1 || v_0.Op != OpAMD64SHRLconst || auxIntToInt8(v_0.AuxInt) != 1 { break } x := v_0.Args[0] v.reset(OpAMD64BTRLconst) - v.AuxInt = 0 + v.AuxInt = int8ToAuxInt(0) v.AddArg(x) return true } // match: (SHLLconst x [0]) // result: x for { - if v.AuxInt != 0 { + if auxIntToInt8(v.AuxInt) != 0 { break } x := v_0 @@ -25536,28 +25497,28 @@ func rewriteValueAMD64_OpAMD64SHLQ(v *Value) bool { v_0 := v.Args[0] b := v.Block // match: (SHLQ x (MOVQconst [c])) - // result: (SHLQconst [c&63] x) + // result: (SHLQconst [int8(c&63)] x) for { x := v_0 if v_1.Op != OpAMD64MOVQconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) v.reset(OpAMD64SHLQconst) - v.AuxInt = c & 63 + v.AuxInt = int8ToAuxInt(int8(c & 63)) v.AddArg(x) return true } // match: (SHLQ x (MOVLconst [c])) - // result: (SHLQconst [c&63] x) + // result: (SHLQconst [int8(c&63)] x) for { x := v_0 if v_1.Op != OpAMD64MOVLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) v.reset(OpAMD64SHLQconst) - v.AuxInt = c & 63 + v.AuxInt = int8ToAuxInt(int8(c & 63)) v.AddArg(x) return true } @@ -25569,7 +25530,7 @@ func rewriteValueAMD64_OpAMD64SHLQ(v *Value) bool { if v_1.Op != OpAMD64ADDQconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) y := v_1.Args[0] if !(c&63 == 0) { break @@ -25591,7 +25552,7 @@ func rewriteValueAMD64_OpAMD64SHLQ(v *Value) bool { if v_1_0.Op != OpAMD64ADDQconst { break } - c := v_1_0.AuxInt + c := auxIntToInt32(v_1_0.AuxInt) y := v_1_0.Args[0] if !(c&63 == 0) { break @@ -25610,7 +25571,7 @@ func rewriteValueAMD64_OpAMD64SHLQ(v *Value) bool { if v_1.Op != OpAMD64ANDQconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) y := v_1.Args[0] if !(c&63 == 63) { break @@ -25632,7 +25593,7 @@ func rewriteValueAMD64_OpAMD64SHLQ(v *Value) bool { if v_1_0.Op != OpAMD64ANDQconst { break } - c := v_1_0.AuxInt + c := auxIntToInt32(v_1_0.AuxInt) y := v_1_0.Args[0] if !(c&63 == 63) { break @@ -25651,7 +25612,7 @@ func rewriteValueAMD64_OpAMD64SHLQ(v *Value) bool { if v_1.Op != OpAMD64ADDLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) y := v_1.Args[0] if !(c&63 == 0) { break @@ -25673,7 +25634,7 @@ func rewriteValueAMD64_OpAMD64SHLQ(v *Value) bool { if v_1_0.Op != OpAMD64ADDLconst { break } - c := v_1_0.AuxInt + c := auxIntToInt32(v_1_0.AuxInt) y := v_1_0.Args[0] if !(c&63 == 0) { break @@ -25692,7 +25653,7 @@ func rewriteValueAMD64_OpAMD64SHLQ(v *Value) bool { if v_1.Op != OpAMD64ANDLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) y := v_1.Args[0] if !(c&63 == 63) { break @@ -25714,7 +25675,7 @@ func rewriteValueAMD64_OpAMD64SHLQ(v *Value) bool { if v_1_0.Op != OpAMD64ANDLconst { break } - c := v_1_0.AuxInt + c := auxIntToInt32(v_1_0.AuxInt) y := v_1_0.Args[0] if !(c&63 == 63) { break @@ -25732,19 +25693,19 @@ func rewriteValueAMD64_OpAMD64SHLQconst(v *Value) bool { // match: (SHLQconst [1] (SHRQconst [1] x)) // result: (BTRQconst [0] x) for { - if v.AuxInt != 1 || v_0.Op != OpAMD64SHRQconst || v_0.AuxInt != 1 { + if auxIntToInt8(v.AuxInt) != 1 || v_0.Op != OpAMD64SHRQconst || auxIntToInt8(v_0.AuxInt) != 1 { break } x := v_0.Args[0] v.reset(OpAMD64BTRQconst) - v.AuxInt = 0 + v.AuxInt = int8ToAuxInt(0) v.AddArg(x) return true } // match: (SHLQconst x [0]) // result: x for { - if v.AuxInt != 0 { + if auxIntToInt8(v.AuxInt) != 0 { break } x := v_0 @@ -25782,35 +25743,35 @@ func rewriteValueAMD64_OpAMD64SHRB(v *Value) bool { v_0 := v.Args[0] // match: (SHRB x (MOVQconst [c])) // cond: c&31 < 8 - // result: (SHRBconst [c&31] x) + // result: (SHRBconst [int8(c&31)] x) for { x := v_0 if v_1.Op != OpAMD64MOVQconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) if !(c&31 < 8) { break } v.reset(OpAMD64SHRBconst) - v.AuxInt = c & 31 + v.AuxInt = int8ToAuxInt(int8(c & 31)) v.AddArg(x) return true } // match: (SHRB x (MOVLconst [c])) // cond: c&31 < 8 - // result: (SHRBconst [c&31] x) + // result: (SHRBconst [int8(c&31)] x) for { x := v_0 if v_1.Op != OpAMD64MOVLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) if !(c&31 < 8) { break } v.reset(OpAMD64SHRBconst) - v.AuxInt = c & 31 + v.AuxInt = int8ToAuxInt(int8(c & 31)) v.AddArg(x) return true } @@ -25821,12 +25782,12 @@ func rewriteValueAMD64_OpAMD64SHRB(v *Value) bool { if v_1.Op != OpAMD64MOVQconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) if !(c&31 >= 8) { break } v.reset(OpAMD64MOVLconst) - v.AuxInt = 0 + v.AuxInt = int32ToAuxInt(0) return true } // match: (SHRB _ (MOVLconst [c])) @@ -25836,12 +25797,12 @@ func rewriteValueAMD64_OpAMD64SHRB(v *Value) bool { if v_1.Op != OpAMD64MOVLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) if !(c&31 >= 8) { break } v.reset(OpAMD64MOVLconst) - v.AuxInt = 0 + v.AuxInt = int32ToAuxInt(0) return true } return false @@ -25851,7 +25812,7 @@ func rewriteValueAMD64_OpAMD64SHRBconst(v *Value) bool { // match: (SHRBconst x [0]) // result: x for { - if v.AuxInt != 0 { + if auxIntToInt8(v.AuxInt) != 0 { break } x := v_0 @@ -25865,28 +25826,28 @@ func rewriteValueAMD64_OpAMD64SHRL(v *Value) bool { v_0 := v.Args[0] b := v.Block // match: (SHRL x (MOVQconst [c])) - // result: (SHRLconst [c&31] x) + // result: (SHRLconst [int8(c&31)] x) for { x := v_0 if v_1.Op != OpAMD64MOVQconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) v.reset(OpAMD64SHRLconst) - v.AuxInt = c & 31 + v.AuxInt = int8ToAuxInt(int8(c & 31)) v.AddArg(x) return true } // match: (SHRL x (MOVLconst [c])) - // result: (SHRLconst [c&31] x) + // result: (SHRLconst [int8(c&31)] x) for { x := v_0 if v_1.Op != OpAMD64MOVLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) v.reset(OpAMD64SHRLconst) - v.AuxInt = c & 31 + v.AuxInt = int8ToAuxInt(int8(c & 31)) v.AddArg(x) return true } @@ -25898,7 +25859,7 @@ func rewriteValueAMD64_OpAMD64SHRL(v *Value) bool { if v_1.Op != OpAMD64ADDQconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) y := v_1.Args[0] if !(c&31 == 0) { break @@ -25920,7 +25881,7 @@ func rewriteValueAMD64_OpAMD64SHRL(v *Value) bool { if v_1_0.Op != OpAMD64ADDQconst { break } - c := v_1_0.AuxInt + c := auxIntToInt32(v_1_0.AuxInt) y := v_1_0.Args[0] if !(c&31 == 0) { break @@ -25939,7 +25900,7 @@ func rewriteValueAMD64_OpAMD64SHRL(v *Value) bool { if v_1.Op != OpAMD64ANDQconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) y := v_1.Args[0] if !(c&31 == 31) { break @@ -25961,7 +25922,7 @@ func rewriteValueAMD64_OpAMD64SHRL(v *Value) bool { if v_1_0.Op != OpAMD64ANDQconst { break } - c := v_1_0.AuxInt + c := auxIntToInt32(v_1_0.AuxInt) y := v_1_0.Args[0] if !(c&31 == 31) { break @@ -25980,7 +25941,7 @@ func rewriteValueAMD64_OpAMD64SHRL(v *Value) bool { if v_1.Op != OpAMD64ADDLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) y := v_1.Args[0] if !(c&31 == 0) { break @@ -26002,7 +25963,7 @@ func rewriteValueAMD64_OpAMD64SHRL(v *Value) bool { if v_1_0.Op != OpAMD64ADDLconst { break } - c := v_1_0.AuxInt + c := auxIntToInt32(v_1_0.AuxInt) y := v_1_0.Args[0] if !(c&31 == 0) { break @@ -26021,7 +25982,7 @@ func rewriteValueAMD64_OpAMD64SHRL(v *Value) bool { if v_1.Op != OpAMD64ANDLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) y := v_1.Args[0] if !(c&31 == 31) { break @@ -26043,7 +26004,7 @@ func rewriteValueAMD64_OpAMD64SHRL(v *Value) bool { if v_1_0.Op != OpAMD64ANDLconst { break } - c := v_1_0.AuxInt + c := auxIntToInt32(v_1_0.AuxInt) y := v_1_0.Args[0] if !(c&31 == 31) { break @@ -26061,19 +26022,19 @@ func rewriteValueAMD64_OpAMD64SHRLconst(v *Value) bool { // match: (SHRLconst [1] (SHLLconst [1] x)) // result: (BTRLconst [31] x) for { - if v.AuxInt != 1 || v_0.Op != OpAMD64SHLLconst || v_0.AuxInt != 1 { + if auxIntToInt8(v.AuxInt) != 1 || v_0.Op != OpAMD64SHLLconst || auxIntToInt8(v_0.AuxInt) != 1 { break } x := v_0.Args[0] v.reset(OpAMD64BTRLconst) - v.AuxInt = 31 + v.AuxInt = int8ToAuxInt(31) v.AddArg(x) return true } // match: (SHRLconst x [0]) // result: x for { - if v.AuxInt != 0 { + if auxIntToInt8(v.AuxInt) != 0 { break } x := v_0 @@ -26087,28 +26048,28 @@ func rewriteValueAMD64_OpAMD64SHRQ(v *Value) bool { v_0 := v.Args[0] b := v.Block // match: (SHRQ x (MOVQconst [c])) - // result: (SHRQconst [c&63] x) + // result: (SHRQconst [int8(c&63)] x) for { x := v_0 if v_1.Op != OpAMD64MOVQconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) v.reset(OpAMD64SHRQconst) - v.AuxInt = c & 63 + v.AuxInt = int8ToAuxInt(int8(c & 63)) v.AddArg(x) return true } // match: (SHRQ x (MOVLconst [c])) - // result: (SHRQconst [c&63] x) + // result: (SHRQconst [int8(c&63)] x) for { x := v_0 if v_1.Op != OpAMD64MOVLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) v.reset(OpAMD64SHRQconst) - v.AuxInt = c & 63 + v.AuxInt = int8ToAuxInt(int8(c & 63)) v.AddArg(x) return true } @@ -26120,7 +26081,7 @@ func rewriteValueAMD64_OpAMD64SHRQ(v *Value) bool { if v_1.Op != OpAMD64ADDQconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) y := v_1.Args[0] if !(c&63 == 0) { break @@ -26142,7 +26103,7 @@ func rewriteValueAMD64_OpAMD64SHRQ(v *Value) bool { if v_1_0.Op != OpAMD64ADDQconst { break } - c := v_1_0.AuxInt + c := auxIntToInt32(v_1_0.AuxInt) y := v_1_0.Args[0] if !(c&63 == 0) { break @@ -26161,7 +26122,7 @@ func rewriteValueAMD64_OpAMD64SHRQ(v *Value) bool { if v_1.Op != OpAMD64ANDQconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) y := v_1.Args[0] if !(c&63 == 63) { break @@ -26183,7 +26144,7 @@ func rewriteValueAMD64_OpAMD64SHRQ(v *Value) bool { if v_1_0.Op != OpAMD64ANDQconst { break } - c := v_1_0.AuxInt + c := auxIntToInt32(v_1_0.AuxInt) y := v_1_0.Args[0] if !(c&63 == 63) { break @@ -26202,7 +26163,7 @@ func rewriteValueAMD64_OpAMD64SHRQ(v *Value) bool { if v_1.Op != OpAMD64ADDLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) y := v_1.Args[0] if !(c&63 == 0) { break @@ -26224,7 +26185,7 @@ func rewriteValueAMD64_OpAMD64SHRQ(v *Value) bool { if v_1_0.Op != OpAMD64ADDLconst { break } - c := v_1_0.AuxInt + c := auxIntToInt32(v_1_0.AuxInt) y := v_1_0.Args[0] if !(c&63 == 0) { break @@ -26243,7 +26204,7 @@ func rewriteValueAMD64_OpAMD64SHRQ(v *Value) bool { if v_1.Op != OpAMD64ANDLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) y := v_1.Args[0] if !(c&63 == 63) { break @@ -26265,7 +26226,7 @@ func rewriteValueAMD64_OpAMD64SHRQ(v *Value) bool { if v_1_0.Op != OpAMD64ANDLconst { break } - c := v_1_0.AuxInt + c := auxIntToInt32(v_1_0.AuxInt) y := v_1_0.Args[0] if !(c&63 == 63) { break @@ -26283,19 +26244,19 @@ func rewriteValueAMD64_OpAMD64SHRQconst(v *Value) bool { // match: (SHRQconst [1] (SHLQconst [1] x)) // result: (BTRQconst [63] x) for { - if v.AuxInt != 1 || v_0.Op != OpAMD64SHLQconst || v_0.AuxInt != 1 { + if auxIntToInt8(v.AuxInt) != 1 || v_0.Op != OpAMD64SHLQconst || auxIntToInt8(v_0.AuxInt) != 1 { break } x := v_0.Args[0] v.reset(OpAMD64BTRQconst) - v.AuxInt = 63 + v.AuxInt = int8ToAuxInt(63) v.AddArg(x) return true } // match: (SHRQconst x [0]) // result: x for { - if v.AuxInt != 0 { + if auxIntToInt8(v.AuxInt) != 0 { break } x := v_0 @@ -26309,35 +26270,35 @@ func rewriteValueAMD64_OpAMD64SHRW(v *Value) bool { v_0 := v.Args[0] // match: (SHRW x (MOVQconst [c])) // cond: c&31 < 16 - // result: (SHRWconst [c&31] x) + // result: (SHRWconst [int8(c&31)] x) for { x := v_0 if v_1.Op != OpAMD64MOVQconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) if !(c&31 < 16) { break } v.reset(OpAMD64SHRWconst) - v.AuxInt = c & 31 + v.AuxInt = int8ToAuxInt(int8(c & 31)) v.AddArg(x) return true } // match: (SHRW x (MOVLconst [c])) // cond: c&31 < 16 - // result: (SHRWconst [c&31] x) + // result: (SHRWconst [int8(c&31)] x) for { x := v_0 if v_1.Op != OpAMD64MOVLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) if !(c&31 < 16) { break } v.reset(OpAMD64SHRWconst) - v.AuxInt = c & 31 + v.AuxInt = int8ToAuxInt(int8(c & 31)) v.AddArg(x) return true } @@ -26348,12 +26309,12 @@ func rewriteValueAMD64_OpAMD64SHRW(v *Value) bool { if v_1.Op != OpAMD64MOVQconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) if !(c&31 >= 16) { break } v.reset(OpAMD64MOVLconst) - v.AuxInt = 0 + v.AuxInt = int32ToAuxInt(0) return true } // match: (SHRW _ (MOVLconst [c])) @@ -26363,12 +26324,12 @@ func rewriteValueAMD64_OpAMD64SHRW(v *Value) bool { if v_1.Op != OpAMD64MOVLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) if !(c&31 >= 16) { break } v.reset(OpAMD64MOVLconst) - v.AuxInt = 0 + v.AuxInt = int32ToAuxInt(0) return true } return false @@ -26378,7 +26339,7 @@ func rewriteValueAMD64_OpAMD64SHRWconst(v *Value) bool { // match: (SHRWconst x [0]) // result: x for { - if v.AuxInt != 0 { + if auxIntToInt8(v.AuxInt) != 0 { break } x := v_0 @@ -26398,9 +26359,9 @@ func rewriteValueAMD64_OpAMD64SUBL(v *Value) bool { if v_1.Op != OpAMD64MOVLconst { break } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) v.reset(OpAMD64SUBLconst) - v.AuxInt = c + v.AuxInt = int32ToAuxInt(c) v.AddArg(x) return true } @@ -26410,11 +26371,11 @@ func rewriteValueAMD64_OpAMD64SUBL(v *Value) bool { if v_0.Op != OpAMD64MOVLconst { break } - c := v_0.AuxInt + c := auxIntToInt32(v_0.AuxInt) x := v_1 v.reset(OpAMD64NEGL) v0 := b.NewValue0(v.Pos, OpAMD64SUBLconst, v.Type) - v0.AuxInt = c + v0.AuxInt = int32ToAuxInt(c) v0.AddArg(x) v.AddArg(v0) return true @@ -26486,24 +26447,24 @@ func rewriteValueAMD64_OpAMD64SUBLload(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (SUBLload [off1] {sym} val (ADDQconst [off2] base) mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (SUBLload [off1+off2] {sym} val base mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) val := v_0 if v_1.Op != OpAMD64ADDQconst { break } - off2 := v_1.AuxInt + off2 := auxIntToInt32(v_1.AuxInt) base := v_1.Args[0] mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64SUBLload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(val, base, mem) return true } @@ -26557,24 +26518,24 @@ func rewriteValueAMD64_OpAMD64SUBLmodify(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (SUBLmodify [off1] {sym} (ADDQconst [off2] base) val mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (SUBLmodify [off1+off2] {sym} base val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64SUBLmodify) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(base, val, mem) return true } @@ -26609,36 +26570,36 @@ func rewriteValueAMD64_OpAMD64SUBQ(v *Value) bool { b := v.Block // match: (SUBQ x (MOVQconst [c])) // cond: is32Bit(c) - // result: (SUBQconst x [c]) + // result: (SUBQconst x [int32(c)]) for { x := v_0 if v_1.Op != OpAMD64MOVQconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) if !(is32Bit(c)) { break } v.reset(OpAMD64SUBQconst) - v.AuxInt = c + v.AuxInt = int32ToAuxInt(int32(c)) v.AddArg(x) return true } // match: (SUBQ (MOVQconst [c]) x) // cond: is32Bit(c) - // result: (NEGQ (SUBQconst <v.Type> x [c])) + // result: (NEGQ (SUBQconst <v.Type> x [int32(c)])) for { if v_0.Op != OpAMD64MOVQconst { break } - c := v_0.AuxInt + c := auxIntToInt64(v_0.AuxInt) x := v_1 if !(is32Bit(c)) { break } v.reset(OpAMD64NEGQ) v0 := b.NewValue0(v.Pos, OpAMD64SUBQconst, v.Type) - v0.AuxInt = c + v0.AuxInt = int32ToAuxInt(int32(c)) v0.AddArg(x) v.AddArg(v0) return true @@ -26765,24 +26726,24 @@ func rewriteValueAMD64_OpAMD64SUBQload(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (SUBQload [off1] {sym} val (ADDQconst [off2] base) mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (SUBQload [off1+off2] {sym} val base mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) val := v_0 if v_1.Op != OpAMD64ADDQconst { break } - off2 := v_1.AuxInt + off2 := auxIntToInt32(v_1.AuxInt) base := v_1.Args[0] mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64SUBQload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(val, base, mem) return true } @@ -26836,24 +26797,24 @@ func rewriteValueAMD64_OpAMD64SUBQmodify(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (SUBQmodify [off1] {sym} (ADDQconst [off2] base) val mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (SUBQmodify [off1+off2] {sym} base val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64SUBQmodify) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(base, val, mem) return true } @@ -26916,24 +26877,24 @@ func rewriteValueAMD64_OpAMD64SUBSDload(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (SUBSDload [off1] {sym} val (ADDQconst [off2] base) mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (SUBSDload [off1+off2] {sym} val base mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) val := v_0 if v_1.Op != OpAMD64ADDQconst { break } - off2 := v_1.AuxInt + off2 := auxIntToInt32(v_1.AuxInt) base := v_1.Args[0] mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64SUBSDload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(val, base, mem) return true } @@ -27016,24 +26977,24 @@ func rewriteValueAMD64_OpAMD64SUBSSload(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (SUBSSload [off1] {sym} val (ADDQconst [off2] base) mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (SUBSSload [off1+off2] {sym} val base mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) val := v_0 if v_1.Op != OpAMD64ADDQconst { break } - off2 := v_1.AuxInt + off2 := auxIntToInt32(v_1.AuxInt) base := v_1.Args[0] mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64SUBSSload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(val, base, mem) return true } @@ -27594,7 +27555,7 @@ func rewriteValueAMD64_OpAMD64XORL(v *Value) bool { } y := v_0.Args[1] v_0_0 := v_0.Args[0] - if v_0_0.Op != OpAMD64MOVLconst || v_0_0.AuxInt != 1 { + if v_0_0.Op != OpAMD64MOVLconst || auxIntToInt32(v_0_0.AuxInt) != 1 { continue } x := v_1 @@ -27605,20 +27566,20 @@ func rewriteValueAMD64_OpAMD64XORL(v *Value) bool { break } // match: (XORL (MOVLconst [c]) x) - // cond: isUint32PowerOfTwo(c) && uint64(c) >= 128 - // result: (BTCLconst [log2uint32(c)] x) + // cond: isUint32PowerOfTwo(int64(c)) && uint64(c) >= 128 + // result: (BTCLconst [int8(log32(c))] x) for { for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { if v_0.Op != OpAMD64MOVLconst { continue } - c := v_0.AuxInt + c := auxIntToInt32(v_0.AuxInt) x := v_1 - if !(isUint32PowerOfTwo(c) && uint64(c) >= 128) { + if !(isUint32PowerOfTwo(int64(c)) && uint64(c) >= 128) { continue } v.reset(OpAMD64BTCLconst) - v.AuxInt = log2uint32(c) + v.AuxInt = int8ToAuxInt(int8(log32(c))) v.AddArg(x) return true } @@ -27632,9 +27593,9 @@ func rewriteValueAMD64_OpAMD64XORL(v *Value) bool { if v_1.Op != OpAMD64MOVLconst { continue } - c := v_1.AuxInt + c := auxIntToInt32(v_1.AuxInt) v.reset(OpAMD64XORLconst) - v.AuxInt = c + v.AuxInt = int32ToAuxInt(c) v.AddArg(x) return true } @@ -27648,17 +27609,17 @@ func rewriteValueAMD64_OpAMD64XORL(v *Value) bool { if v_0.Op != OpAMD64SHLLconst { continue } - c := v_0.AuxInt + c := auxIntToInt8(v_0.AuxInt) x := v_0.Args[0] if v_1.Op != OpAMD64SHRLconst { continue } - d := v_1.AuxInt + d := auxIntToInt8(v_1.AuxInt) if x != v_1.Args[0] || !(d == 32-c) { continue } v.reset(OpAMD64ROLLconst) - v.AuxInt = c + v.AuxInt = int8ToAuxInt(c) v.AddArg(x) return true } @@ -27673,17 +27634,17 @@ func rewriteValueAMD64_OpAMD64XORL(v *Value) bool { if v_0.Op != OpAMD64SHLLconst { continue } - c := v_0.AuxInt + c := auxIntToInt8(v_0.AuxInt) x := v_0.Args[0] if v_1.Op != OpAMD64SHRWconst { continue } - d := v_1.AuxInt + d := auxIntToInt8(v_1.AuxInt) if x != v_1.Args[0] || !(d == 16-c && c < 16 && t.Size() == 2) { continue } v.reset(OpAMD64ROLWconst) - v.AuxInt = c + v.AuxInt = int8ToAuxInt(c) v.AddArg(x) return true } @@ -27698,17 +27659,17 @@ func rewriteValueAMD64_OpAMD64XORL(v *Value) bool { if v_0.Op != OpAMD64SHLLconst { continue } - c := v_0.AuxInt + c := auxIntToInt8(v_0.AuxInt) x := v_0.Args[0] if v_1.Op != OpAMD64SHRBconst { continue } - d := v_1.AuxInt + d := auxIntToInt8(v_1.AuxInt) if x != v_1.Args[0] || !(d == 8-c && c < 8 && t.Size() == 1) { continue } v.reset(OpAMD64ROLBconst) - v.AuxInt = c + v.AuxInt = int8ToAuxInt(c) v.AddArg(x) return true } @@ -27755,23 +27716,23 @@ func rewriteValueAMD64_OpAMD64XORL(v *Value) bool { func rewriteValueAMD64_OpAMD64XORLconst(v *Value) bool { v_0 := v.Args[0] // match: (XORLconst [c] x) - // cond: isUint32PowerOfTwo(c) && uint64(c) >= 128 - // result: (BTCLconst [log2uint32(c)] x) + // cond: isUint32PowerOfTwo(int64(c)) && uint64(c) >= 128 + // result: (BTCLconst [int8(log32(c))] x) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) x := v_0 - if !(isUint32PowerOfTwo(c) && uint64(c) >= 128) { + if !(isUint32PowerOfTwo(int64(c)) && uint64(c) >= 128) { break } v.reset(OpAMD64BTCLconst) - v.AuxInt = log2uint32(c) + v.AuxInt = int8ToAuxInt(int8(log32(c))) v.AddArg(x) return true } // match: (XORLconst [1] (SETNE x)) // result: (SETEQ x) for { - if v.AuxInt != 1 || v_0.Op != OpAMD64SETNE { + if auxIntToInt32(v.AuxInt) != 1 || v_0.Op != OpAMD64SETNE { break } x := v_0.Args[0] @@ -27782,7 +27743,7 @@ func rewriteValueAMD64_OpAMD64XORLconst(v *Value) bool { // match: (XORLconst [1] (SETEQ x)) // result: (SETNE x) for { - if v.AuxInt != 1 || v_0.Op != OpAMD64SETEQ { + if auxIntToInt32(v.AuxInt) != 1 || v_0.Op != OpAMD64SETEQ { break } x := v_0.Args[0] @@ -27793,7 +27754,7 @@ func rewriteValueAMD64_OpAMD64XORLconst(v *Value) bool { // match: (XORLconst [1] (SETL x)) // result: (SETGE x) for { - if v.AuxInt != 1 || v_0.Op != OpAMD64SETL { + if auxIntToInt32(v.AuxInt) != 1 || v_0.Op != OpAMD64SETL { break } x := v_0.Args[0] @@ -27804,7 +27765,7 @@ func rewriteValueAMD64_OpAMD64XORLconst(v *Value) bool { // match: (XORLconst [1] (SETGE x)) // result: (SETL x) for { - if v.AuxInt != 1 || v_0.Op != OpAMD64SETGE { + if auxIntToInt32(v.AuxInt) != 1 || v_0.Op != OpAMD64SETGE { break } x := v_0.Args[0] @@ -27815,7 +27776,7 @@ func rewriteValueAMD64_OpAMD64XORLconst(v *Value) bool { // match: (XORLconst [1] (SETLE x)) // result: (SETG x) for { - if v.AuxInt != 1 || v_0.Op != OpAMD64SETLE { + if auxIntToInt32(v.AuxInt) != 1 || v_0.Op != OpAMD64SETLE { break } x := v_0.Args[0] @@ -27826,7 +27787,7 @@ func rewriteValueAMD64_OpAMD64XORLconst(v *Value) bool { // match: (XORLconst [1] (SETG x)) // result: (SETLE x) for { - if v.AuxInt != 1 || v_0.Op != OpAMD64SETG { + if auxIntToInt32(v.AuxInt) != 1 || v_0.Op != OpAMD64SETG { break } x := v_0.Args[0] @@ -27837,7 +27798,7 @@ func rewriteValueAMD64_OpAMD64XORLconst(v *Value) bool { // match: (XORLconst [1] (SETB x)) // result: (SETAE x) for { - if v.AuxInt != 1 || v_0.Op != OpAMD64SETB { + if auxIntToInt32(v.AuxInt) != 1 || v_0.Op != OpAMD64SETB { break } x := v_0.Args[0] @@ -27848,7 +27809,7 @@ func rewriteValueAMD64_OpAMD64XORLconst(v *Value) bool { // match: (XORLconst [1] (SETAE x)) // result: (SETB x) for { - if v.AuxInt != 1 || v_0.Op != OpAMD64SETAE { + if auxIntToInt32(v.AuxInt) != 1 || v_0.Op != OpAMD64SETAE { break } x := v_0.Args[0] @@ -27859,7 +27820,7 @@ func rewriteValueAMD64_OpAMD64XORLconst(v *Value) bool { // match: (XORLconst [1] (SETBE x)) // result: (SETA x) for { - if v.AuxInt != 1 || v_0.Op != OpAMD64SETBE { + if auxIntToInt32(v.AuxInt) != 1 || v_0.Op != OpAMD64SETBE { break } x := v_0.Args[0] @@ -27870,7 +27831,7 @@ func rewriteValueAMD64_OpAMD64XORLconst(v *Value) bool { // match: (XORLconst [1] (SETA x)) // result: (SETBE x) for { - if v.AuxInt != 1 || v_0.Op != OpAMD64SETA { + if auxIntToInt32(v.AuxInt) != 1 || v_0.Op != OpAMD64SETA { break } x := v_0.Args[0] @@ -27936,23 +27897,23 @@ func rewriteValueAMD64_OpAMD64XORLconstmodify(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (XORLconstmodify [valoff1] {sym} (ADDQconst [off2] base) mem) - // cond: ValAndOff(valoff1).canAdd(off2) - // result: (XORLconstmodify [ValAndOff(valoff1).add(off2)] {sym} base mem) + // cond: ValAndOff(valoff1).canAdd32(off2) + // result: (XORLconstmodify [ValAndOff(valoff1).addOffset32(off2)] {sym} base mem) for { - valoff1 := v.AuxInt - sym := v.Aux + valoff1 := auxIntToValAndOff(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] mem := v_1 - if !(ValAndOff(valoff1).canAdd(off2)) { + if !(ValAndOff(valoff1).canAdd32(off2)) { break } v.reset(OpAMD64XORLconstmodify) - v.AuxInt = ValAndOff(valoff1).add(off2) - v.Aux = sym + v.AuxInt = valAndOffToAuxInt(ValAndOff(valoff1).addOffset32(off2)) + v.Aux = symToAux(sym) v.AddArg2(base, mem) return true } @@ -27987,24 +27948,24 @@ func rewriteValueAMD64_OpAMD64XORLload(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (XORLload [off1] {sym} val (ADDQconst [off2] base) mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (XORLload [off1+off2] {sym} val base mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) val := v_0 if v_1.Op != OpAMD64ADDQconst { break } - off2 := v_1.AuxInt + off2 := auxIntToInt32(v_1.AuxInt) base := v_1.Args[0] mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64XORLload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(val, base, mem) return true } @@ -28058,24 +28019,24 @@ func rewriteValueAMD64_OpAMD64XORLmodify(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (XORLmodify [off1] {sym} (ADDQconst [off2] base) val mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (XORLmodify [off1+off2] {sym} base val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64XORLmodify) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(base, val, mem) return true } @@ -28116,7 +28077,7 @@ func rewriteValueAMD64_OpAMD64XORQ(v *Value) bool { } y := v_0.Args[1] v_0_0 := v_0.Args[0] - if v_0_0.Op != OpAMD64MOVQconst || v_0_0.AuxInt != 1 { + if v_0_0.Op != OpAMD64MOVQconst || auxIntToInt64(v_0_0.AuxInt) != 1 { continue } x := v_1 @@ -28128,19 +28089,19 @@ func rewriteValueAMD64_OpAMD64XORQ(v *Value) bool { } // match: (XORQ (MOVQconst [c]) x) // cond: isUint64PowerOfTwo(c) && uint64(c) >= 128 - // result: (BTCQconst [log2(c)] x) + // result: (BTCQconst [int8(log2(c))] x) for { for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { if v_0.Op != OpAMD64MOVQconst { continue } - c := v_0.AuxInt + c := auxIntToInt64(v_0.AuxInt) x := v_1 if !(isUint64PowerOfTwo(c) && uint64(c) >= 128) { continue } v.reset(OpAMD64BTCQconst) - v.AuxInt = log2(c) + v.AuxInt = int8ToAuxInt(int8(log2(c))) v.AddArg(x) return true } @@ -28148,19 +28109,19 @@ func rewriteValueAMD64_OpAMD64XORQ(v *Value) bool { } // match: (XORQ x (MOVQconst [c])) // cond: is32Bit(c) - // result: (XORQconst [c] x) + // result: (XORQconst [int32(c)] x) for { for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { x := v_0 if v_1.Op != OpAMD64MOVQconst { continue } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) if !(is32Bit(c)) { continue } v.reset(OpAMD64XORQconst) - v.AuxInt = c + v.AuxInt = int32ToAuxInt(int32(c)) v.AddArg(x) return true } @@ -28174,17 +28135,17 @@ func rewriteValueAMD64_OpAMD64XORQ(v *Value) bool { if v_0.Op != OpAMD64SHLQconst { continue } - c := v_0.AuxInt + c := auxIntToInt8(v_0.AuxInt) x := v_0.Args[0] if v_1.Op != OpAMD64SHRQconst { continue } - d := v_1.AuxInt + d := auxIntToInt8(v_1.AuxInt) if x != v_1.Args[0] || !(d == 64-c) { continue } v.reset(OpAMD64ROLQconst) - v.AuxInt = c + v.AuxInt = int8ToAuxInt(c) v.AddArg(x) return true } @@ -28231,16 +28192,16 @@ func rewriteValueAMD64_OpAMD64XORQ(v *Value) bool { func rewriteValueAMD64_OpAMD64XORQconst(v *Value) bool { v_0 := v.Args[0] // match: (XORQconst [c] x) - // cond: isUint64PowerOfTwo(c) && uint64(c) >= 128 - // result: (BTCQconst [log2(c)] x) + // cond: isUint64PowerOfTwo(int64(c)) && uint64(c) >= 128 + // result: (BTCQconst [int8(log32(c))] x) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) x := v_0 - if !(isUint64PowerOfTwo(c) && uint64(c) >= 128) { + if !(isUint64PowerOfTwo(int64(c)) && uint64(c) >= 128) { break } v.reset(OpAMD64BTCQconst) - v.AuxInt = log2(c) + v.AuxInt = int8ToAuxInt(int8(log32(c))) v.AddArg(x) return true } @@ -28304,23 +28265,23 @@ func rewriteValueAMD64_OpAMD64XORQconstmodify(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (XORQconstmodify [valoff1] {sym} (ADDQconst [off2] base) mem) - // cond: ValAndOff(valoff1).canAdd(off2) - // result: (XORQconstmodify [ValAndOff(valoff1).add(off2)] {sym} base mem) + // cond: ValAndOff(valoff1).canAdd32(off2) + // result: (XORQconstmodify [ValAndOff(valoff1).addOffset32(off2)] {sym} base mem) for { - valoff1 := v.AuxInt - sym := v.Aux + valoff1 := auxIntToValAndOff(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] mem := v_1 - if !(ValAndOff(valoff1).canAdd(off2)) { + if !(ValAndOff(valoff1).canAdd32(off2)) { break } v.reset(OpAMD64XORQconstmodify) - v.AuxInt = ValAndOff(valoff1).add(off2) - v.Aux = sym + v.AuxInt = valAndOffToAuxInt(ValAndOff(valoff1).addOffset32(off2)) + v.Aux = symToAux(sym) v.AddArg2(base, mem) return true } @@ -28355,24 +28316,24 @@ func rewriteValueAMD64_OpAMD64XORQload(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (XORQload [off1] {sym} val (ADDQconst [off2] base) mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (XORQload [off1+off2] {sym} val base mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) val := v_0 if v_1.Op != OpAMD64ADDQconst { break } - off2 := v_1.AuxInt + off2 := auxIntToInt32(v_1.AuxInt) base := v_1.Args[0] mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64XORQload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(val, base, mem) return true } @@ -28426,24 +28387,24 @@ func rewriteValueAMD64_OpAMD64XORQmodify(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (XORQmodify [off1] {sym} (ADDQconst [off2] base) val mem) - // cond: is32Bit(off1+off2) + // cond: is32Bit(int64(off1)+int64(off2)) // result: (XORQmodify [off1+off2] {sym} base val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpAMD64ADDQconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) base := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1 + off2)) { + if !(is32Bit(int64(off1) + int64(off2))) { break } v.reset(OpAMD64XORQmodify) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(base, val, mem) return true } @@ -30018,12 +29979,12 @@ func rewriteValueAMD64_OpHasCPUFeature(v *Value) bool { // match: (HasCPUFeature {s}) // result: (SETNE (CMPQconst [0] (LoweredHasCPUFeature {s}))) for { - s := v.Aux + s := auxToSym(v.Aux) v.reset(OpAMD64SETNE) v0 := b.NewValue0(v.Pos, OpAMD64CMPQconst, types.TypeFlags) - v0.AuxInt = 0 + v0.AuxInt = int32ToAuxInt(0) v1 := b.NewValue0(v.Pos, OpAMD64LoweredHasCPUFeature, typ.UInt64) - v1.Aux = s + v1.Aux = symToAux(s) v0.AddArg(v1) v.AddArg(v0) return true @@ -30489,10 +30450,10 @@ func rewriteValueAMD64_OpLocalAddr(v *Value) bool { // match: (LocalAddr {sym} base _) // result: (LEAQ {sym} base) for { - sym := v.Aux + sym := auxToSym(v.Aux) base := v_0 v.reset(OpAMD64LEAQ) - v.Aux = sym + v.Aux = symToAux(sym) v.AddArg(base) return true } @@ -31982,7 +31943,7 @@ func rewriteValueAMD64_OpPanicBounds(v *Value) bool { // cond: boundsABI(kind) == 0 // result: (LoweredPanicBoundsA [kind] x y mem) for { - kind := v.AuxInt + kind := auxIntToInt64(v.AuxInt) x := v_0 y := v_1 mem := v_2 @@ -31990,7 +31951,7 @@ func rewriteValueAMD64_OpPanicBounds(v *Value) bool { break } v.reset(OpAMD64LoweredPanicBoundsA) - v.AuxInt = kind + v.AuxInt = int64ToAuxInt(kind) v.AddArg3(x, y, mem) return true } @@ -31998,7 +31959,7 @@ func rewriteValueAMD64_OpPanicBounds(v *Value) bool { // cond: boundsABI(kind) == 1 // result: (LoweredPanicBoundsB [kind] x y mem) for { - kind := v.AuxInt + kind := auxIntToInt64(v.AuxInt) x := v_0 y := v_1 mem := v_2 @@ -32006,7 +31967,7 @@ func rewriteValueAMD64_OpPanicBounds(v *Value) bool { break } v.reset(OpAMD64LoweredPanicBoundsB) - v.AuxInt = kind + v.AuxInt = int64ToAuxInt(kind) v.AddArg3(x, y, mem) return true } @@ -32014,7 +31975,7 @@ func rewriteValueAMD64_OpPanicBounds(v *Value) bool { // cond: boundsABI(kind) == 2 // result: (LoweredPanicBoundsC [kind] x y mem) for { - kind := v.AuxInt + kind := auxIntToInt64(v.AuxInt) x := v_0 y := v_1 mem := v_2 @@ -32022,7 +31983,7 @@ func rewriteValueAMD64_OpPanicBounds(v *Value) bool { break } v.reset(OpAMD64LoweredPanicBoundsC) - v.AuxInt = kind + v.AuxInt = int64ToAuxInt(kind) v.AddArg3(x, y, mem) return true } @@ -34243,7 +34204,7 @@ func rewriteBlockAMD64(b *Block) bool { } x := v_0_0.Args[1] v_0_0_0 := v_0_0.Args[0] - if v_0_0_0.Op != OpAMD64MOVLconst || v_0_0_0.AuxInt != 1 { + if v_0_0_0.Op != OpAMD64MOVLconst || auxIntToInt32(v_0_0_0.AuxInt) != 1 { continue } y := v_0_1 @@ -34267,7 +34228,7 @@ func rewriteBlockAMD64(b *Block) bool { } x := v_0_0.Args[1] v_0_0_0 := v_0_0.Args[0] - if v_0_0_0.Op != OpAMD64MOVQconst || v_0_0_0.AuxInt != 1 { + if v_0_0_0.Op != OpAMD64MOVQconst || auxIntToInt64(v_0_0_0.AuxInt) != 1 { continue } y := v_0_1 @@ -34279,40 +34240,40 @@ func rewriteBlockAMD64(b *Block) bool { break } // match: (EQ (TESTLconst [c] x)) - // cond: isUint32PowerOfTwo(c) - // result: (UGE (BTLconst [log2uint32(c)] x)) + // cond: isUint32PowerOfTwo(int64(c)) + // result: (UGE (BTLconst [int8(log32(c))] x)) for b.Controls[0].Op == OpAMD64TESTLconst { v_0 := b.Controls[0] - c := v_0.AuxInt + c := auxIntToInt32(v_0.AuxInt) x := v_0.Args[0] - if !(isUint32PowerOfTwo(c)) { + if !(isUint32PowerOfTwo(int64(c))) { break } v0 := b.NewValue0(v_0.Pos, OpAMD64BTLconst, types.TypeFlags) - v0.AuxInt = log2uint32(c) + v0.AuxInt = int8ToAuxInt(int8(log32(c))) v0.AddArg(x) b.resetWithControl(BlockAMD64UGE, v0) return true } // match: (EQ (TESTQconst [c] x)) - // cond: isUint64PowerOfTwo(c) - // result: (UGE (BTQconst [log2(c)] x)) + // cond: isUint64PowerOfTwo(int64(c)) + // result: (UGE (BTQconst [int8(log32(c))] x)) for b.Controls[0].Op == OpAMD64TESTQconst { v_0 := b.Controls[0] - c := v_0.AuxInt + c := auxIntToInt32(v_0.AuxInt) x := v_0.Args[0] - if !(isUint64PowerOfTwo(c)) { + if !(isUint64PowerOfTwo(int64(c))) { break } v0 := b.NewValue0(v_0.Pos, OpAMD64BTQconst, types.TypeFlags) - v0.AuxInt = log2(c) + v0.AuxInt = int8ToAuxInt(int8(log32(c))) v0.AddArg(x) b.resetWithControl(BlockAMD64UGE, v0) return true } // match: (EQ (TESTQ (MOVQconst [c]) x)) // cond: isUint64PowerOfTwo(c) - // result: (UGE (BTQconst [log2(c)] x)) + // result: (UGE (BTQconst [int8(log2(c))] x)) for b.Controls[0].Op == OpAMD64TESTQ { v_0 := b.Controls[0] _ = v_0.Args[1] @@ -34322,13 +34283,13 @@ func rewriteBlockAMD64(b *Block) bool { if v_0_0.Op != OpAMD64MOVQconst { continue } - c := v_0_0.AuxInt + c := auxIntToInt64(v_0_0.AuxInt) x := v_0_1 if !(isUint64PowerOfTwo(c)) { continue } v0 := b.NewValue0(v_0.Pos, OpAMD64BTQconst, types.TypeFlags) - v0.AuxInt = log2(c) + v0.AuxInt = int8ToAuxInt(int8(log2(c))) v0.AddArg(x) b.resetWithControl(BlockAMD64UGE, v0) return true @@ -34345,11 +34306,11 @@ func rewriteBlockAMD64(b *Block) bool { v_0_1 := v_0.Args[1] for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { z1 := v_0_0 - if z1.Op != OpAMD64SHLQconst || z1.AuxInt != 63 { + if z1.Op != OpAMD64SHLQconst || auxIntToInt8(z1.AuxInt) != 63 { continue } z1_0 := z1.Args[0] - if z1_0.Op != OpAMD64SHRQconst || z1_0.AuxInt != 63 { + if z1_0.Op != OpAMD64SHRQconst || auxIntToInt8(z1_0.AuxInt) != 63 { continue } x := z1_0.Args[0] @@ -34358,7 +34319,7 @@ func rewriteBlockAMD64(b *Block) bool { continue } v0 := b.NewValue0(v_0.Pos, OpAMD64BTQconst, types.TypeFlags) - v0.AuxInt = 63 + v0.AuxInt = int8ToAuxInt(63) v0.AddArg(x) b.resetWithControl(BlockAMD64UGE, v0) return true @@ -34375,11 +34336,11 @@ func rewriteBlockAMD64(b *Block) bool { v_0_1 := v_0.Args[1] for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { z1 := v_0_0 - if z1.Op != OpAMD64SHLLconst || z1.AuxInt != 31 { + if z1.Op != OpAMD64SHLLconst || auxIntToInt8(z1.AuxInt) != 31 { continue } z1_0 := z1.Args[0] - if z1_0.Op != OpAMD64SHRQconst || z1_0.AuxInt != 31 { + if z1_0.Op != OpAMD64SHRQconst || auxIntToInt8(z1_0.AuxInt) != 31 { continue } x := z1_0.Args[0] @@ -34388,7 +34349,7 @@ func rewriteBlockAMD64(b *Block) bool { continue } v0 := b.NewValue0(v_0.Pos, OpAMD64BTQconst, types.TypeFlags) - v0.AuxInt = 31 + v0.AuxInt = int8ToAuxInt(31) v0.AddArg(x) b.resetWithControl(BlockAMD64UGE, v0) return true @@ -34405,11 +34366,11 @@ func rewriteBlockAMD64(b *Block) bool { v_0_1 := v_0.Args[1] for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { z1 := v_0_0 - if z1.Op != OpAMD64SHRQconst || z1.AuxInt != 63 { + if z1.Op != OpAMD64SHRQconst || auxIntToInt8(z1.AuxInt) != 63 { continue } z1_0 := z1.Args[0] - if z1_0.Op != OpAMD64SHLQconst || z1_0.AuxInt != 63 { + if z1_0.Op != OpAMD64SHLQconst || auxIntToInt8(z1_0.AuxInt) != 63 { continue } x := z1_0.Args[0] @@ -34418,7 +34379,7 @@ func rewriteBlockAMD64(b *Block) bool { continue } v0 := b.NewValue0(v_0.Pos, OpAMD64BTQconst, types.TypeFlags) - v0.AuxInt = 0 + v0.AuxInt = int8ToAuxInt(0) v0.AddArg(x) b.resetWithControl(BlockAMD64UGE, v0) return true @@ -34435,11 +34396,11 @@ func rewriteBlockAMD64(b *Block) bool { v_0_1 := v_0.Args[1] for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { z1 := v_0_0 - if z1.Op != OpAMD64SHRLconst || z1.AuxInt != 31 { + if z1.Op != OpAMD64SHRLconst || auxIntToInt8(z1.AuxInt) != 31 { continue } z1_0 := z1.Args[0] - if z1_0.Op != OpAMD64SHLLconst || z1_0.AuxInt != 31 { + if z1_0.Op != OpAMD64SHLLconst || auxIntToInt8(z1_0.AuxInt) != 31 { continue } x := z1_0.Args[0] @@ -34448,7 +34409,7 @@ func rewriteBlockAMD64(b *Block) bool { continue } v0 := b.NewValue0(v_0.Pos, OpAMD64BTLconst, types.TypeFlags) - v0.AuxInt = 0 + v0.AuxInt = int8ToAuxInt(0) v0.AddArg(x) b.resetWithControl(BlockAMD64UGE, v0) return true @@ -34465,7 +34426,7 @@ func rewriteBlockAMD64(b *Block) bool { v_0_1 := v_0.Args[1] for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { z1 := v_0_0 - if z1.Op != OpAMD64SHRQconst || z1.AuxInt != 63 { + if z1.Op != OpAMD64SHRQconst || auxIntToInt8(z1.AuxInt) != 63 { continue } x := z1.Args[0] @@ -34474,7 +34435,7 @@ func rewriteBlockAMD64(b *Block) bool { continue } v0 := b.NewValue0(v_0.Pos, OpAMD64BTQconst, types.TypeFlags) - v0.AuxInt = 63 + v0.AuxInt = int8ToAuxInt(63) v0.AddArg(x) b.resetWithControl(BlockAMD64UGE, v0) return true @@ -34491,7 +34452,7 @@ func rewriteBlockAMD64(b *Block) bool { v_0_1 := v_0.Args[1] for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { z1 := v_0_0 - if z1.Op != OpAMD64SHRLconst || z1.AuxInt != 31 { + if z1.Op != OpAMD64SHRLconst || auxIntToInt8(z1.AuxInt) != 31 { continue } x := z1.Args[0] @@ -34500,7 +34461,7 @@ func rewriteBlockAMD64(b *Block) bool { continue } v0 := b.NewValue0(v_0.Pos, OpAMD64BTLconst, types.TypeFlags) - v0.AuxInt = 31 + v0.AuxInt = int8ToAuxInt(31) v0.AddArg(x) b.resetWithControl(BlockAMD64UGE, v0) return true @@ -35046,7 +35007,7 @@ func rewriteBlockAMD64(b *Block) bool { } x := v_0_0.Args[1] v_0_0_0 := v_0_0.Args[0] - if v_0_0_0.Op != OpAMD64MOVLconst || v_0_0_0.AuxInt != 1 { + if v_0_0_0.Op != OpAMD64MOVLconst || auxIntToInt32(v_0_0_0.AuxInt) != 1 { continue } y := v_0_1 @@ -35070,7 +35031,7 @@ func rewriteBlockAMD64(b *Block) bool { } x := v_0_0.Args[1] v_0_0_0 := v_0_0.Args[0] - if v_0_0_0.Op != OpAMD64MOVQconst || v_0_0_0.AuxInt != 1 { + if v_0_0_0.Op != OpAMD64MOVQconst || auxIntToInt64(v_0_0_0.AuxInt) != 1 { continue } y := v_0_1 @@ -35082,40 +35043,40 @@ func rewriteBlockAMD64(b *Block) bool { break } // match: (NE (TESTLconst [c] x)) - // cond: isUint32PowerOfTwo(c) - // result: (ULT (BTLconst [log2uint32(c)] x)) + // cond: isUint32PowerOfTwo(int64(c)) + // result: (ULT (BTLconst [int8(log32(c))] x)) for b.Controls[0].Op == OpAMD64TESTLconst { v_0 := b.Controls[0] - c := v_0.AuxInt + c := auxIntToInt32(v_0.AuxInt) x := v_0.Args[0] - if !(isUint32PowerOfTwo(c)) { + if !(isUint32PowerOfTwo(int64(c))) { break } v0 := b.NewValue0(v_0.Pos, OpAMD64BTLconst, types.TypeFlags) - v0.AuxInt = log2uint32(c) + v0.AuxInt = int8ToAuxInt(int8(log32(c))) v0.AddArg(x) b.resetWithControl(BlockAMD64ULT, v0) return true } // match: (NE (TESTQconst [c] x)) - // cond: isUint64PowerOfTwo(c) - // result: (ULT (BTQconst [log2(c)] x)) + // cond: isUint64PowerOfTwo(int64(c)) + // result: (ULT (BTQconst [int8(log32(c))] x)) for b.Controls[0].Op == OpAMD64TESTQconst { v_0 := b.Controls[0] - c := v_0.AuxInt + c := auxIntToInt32(v_0.AuxInt) x := v_0.Args[0] - if !(isUint64PowerOfTwo(c)) { + if !(isUint64PowerOfTwo(int64(c))) { break } v0 := b.NewValue0(v_0.Pos, OpAMD64BTQconst, types.TypeFlags) - v0.AuxInt = log2(c) + v0.AuxInt = int8ToAuxInt(int8(log32(c))) v0.AddArg(x) b.resetWithControl(BlockAMD64ULT, v0) return true } // match: (NE (TESTQ (MOVQconst [c]) x)) // cond: isUint64PowerOfTwo(c) - // result: (ULT (BTQconst [log2(c)] x)) + // result: (ULT (BTQconst [int8(log2(c))] x)) for b.Controls[0].Op == OpAMD64TESTQ { v_0 := b.Controls[0] _ = v_0.Args[1] @@ -35125,13 +35086,13 @@ func rewriteBlockAMD64(b *Block) bool { if v_0_0.Op != OpAMD64MOVQconst { continue } - c := v_0_0.AuxInt + c := auxIntToInt64(v_0_0.AuxInt) x := v_0_1 if !(isUint64PowerOfTwo(c)) { continue } v0 := b.NewValue0(v_0.Pos, OpAMD64BTQconst, types.TypeFlags) - v0.AuxInt = log2(c) + v0.AuxInt = int8ToAuxInt(int8(log2(c))) v0.AddArg(x) b.resetWithControl(BlockAMD64ULT, v0) return true @@ -35148,11 +35109,11 @@ func rewriteBlockAMD64(b *Block) bool { v_0_1 := v_0.Args[1] for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { z1 := v_0_0 - if z1.Op != OpAMD64SHLQconst || z1.AuxInt != 63 { + if z1.Op != OpAMD64SHLQconst || auxIntToInt8(z1.AuxInt) != 63 { continue } z1_0 := z1.Args[0] - if z1_0.Op != OpAMD64SHRQconst || z1_0.AuxInt != 63 { + if z1_0.Op != OpAMD64SHRQconst || auxIntToInt8(z1_0.AuxInt) != 63 { continue } x := z1_0.Args[0] @@ -35161,7 +35122,7 @@ func rewriteBlockAMD64(b *Block) bool { continue } v0 := b.NewValue0(v_0.Pos, OpAMD64BTQconst, types.TypeFlags) - v0.AuxInt = 63 + v0.AuxInt = int8ToAuxInt(63) v0.AddArg(x) b.resetWithControl(BlockAMD64ULT, v0) return true @@ -35178,11 +35139,11 @@ func rewriteBlockAMD64(b *Block) bool { v_0_1 := v_0.Args[1] for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { z1 := v_0_0 - if z1.Op != OpAMD64SHLLconst || z1.AuxInt != 31 { + if z1.Op != OpAMD64SHLLconst || auxIntToInt8(z1.AuxInt) != 31 { continue } z1_0 := z1.Args[0] - if z1_0.Op != OpAMD64SHRQconst || z1_0.AuxInt != 31 { + if z1_0.Op != OpAMD64SHRQconst || auxIntToInt8(z1_0.AuxInt) != 31 { continue } x := z1_0.Args[0] @@ -35191,7 +35152,7 @@ func rewriteBlockAMD64(b *Block) bool { continue } v0 := b.NewValue0(v_0.Pos, OpAMD64BTQconst, types.TypeFlags) - v0.AuxInt = 31 + v0.AuxInt = int8ToAuxInt(31) v0.AddArg(x) b.resetWithControl(BlockAMD64ULT, v0) return true @@ -35208,11 +35169,11 @@ func rewriteBlockAMD64(b *Block) bool { v_0_1 := v_0.Args[1] for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { z1 := v_0_0 - if z1.Op != OpAMD64SHRQconst || z1.AuxInt != 63 { + if z1.Op != OpAMD64SHRQconst || auxIntToInt8(z1.AuxInt) != 63 { continue } z1_0 := z1.Args[0] - if z1_0.Op != OpAMD64SHLQconst || z1_0.AuxInt != 63 { + if z1_0.Op != OpAMD64SHLQconst || auxIntToInt8(z1_0.AuxInt) != 63 { continue } x := z1_0.Args[0] @@ -35221,7 +35182,7 @@ func rewriteBlockAMD64(b *Block) bool { continue } v0 := b.NewValue0(v_0.Pos, OpAMD64BTQconst, types.TypeFlags) - v0.AuxInt = 0 + v0.AuxInt = int8ToAuxInt(0) v0.AddArg(x) b.resetWithControl(BlockAMD64ULT, v0) return true @@ -35238,11 +35199,11 @@ func rewriteBlockAMD64(b *Block) bool { v_0_1 := v_0.Args[1] for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { z1 := v_0_0 - if z1.Op != OpAMD64SHRLconst || z1.AuxInt != 31 { + if z1.Op != OpAMD64SHRLconst || auxIntToInt8(z1.AuxInt) != 31 { continue } z1_0 := z1.Args[0] - if z1_0.Op != OpAMD64SHLLconst || z1_0.AuxInt != 31 { + if z1_0.Op != OpAMD64SHLLconst || auxIntToInt8(z1_0.AuxInt) != 31 { continue } x := z1_0.Args[0] @@ -35251,7 +35212,7 @@ func rewriteBlockAMD64(b *Block) bool { continue } v0 := b.NewValue0(v_0.Pos, OpAMD64BTLconst, types.TypeFlags) - v0.AuxInt = 0 + v0.AuxInt = int8ToAuxInt(0) v0.AddArg(x) b.resetWithControl(BlockAMD64ULT, v0) return true @@ -35268,7 +35229,7 @@ func rewriteBlockAMD64(b *Block) bool { v_0_1 := v_0.Args[1] for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { z1 := v_0_0 - if z1.Op != OpAMD64SHRQconst || z1.AuxInt != 63 { + if z1.Op != OpAMD64SHRQconst || auxIntToInt8(z1.AuxInt) != 63 { continue } x := z1.Args[0] @@ -35277,7 +35238,7 @@ func rewriteBlockAMD64(b *Block) bool { continue } v0 := b.NewValue0(v_0.Pos, OpAMD64BTQconst, types.TypeFlags) - v0.AuxInt = 63 + v0.AuxInt = int8ToAuxInt(63) v0.AddArg(x) b.resetWithControl(BlockAMD64ULT, v0) return true @@ -35294,7 +35255,7 @@ func rewriteBlockAMD64(b *Block) bool { v_0_1 := v_0.Args[1] for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { z1 := v_0_0 - if z1.Op != OpAMD64SHRLconst || z1.AuxInt != 31 { + if z1.Op != OpAMD64SHRLconst || auxIntToInt8(z1.AuxInt) != 31 { continue } x := z1.Args[0] @@ -35303,7 +35264,7 @@ func rewriteBlockAMD64(b *Block) bool { continue } v0 := b.NewValue0(v_0.Pos, OpAMD64BTLconst, types.TypeFlags) - v0.AuxInt = 31 + v0.AuxInt = int8ToAuxInt(31) v0.AddArg(x) b.resetWithControl(BlockAMD64ULT, v0) return true diff --git a/src/cmd/compile/internal/ssa/rewriteARM64.go b/src/cmd/compile/internal/ssa/rewriteARM64.go index 453578aa9a..0fb86b6bdd 100644 --- a/src/cmd/compile/internal/ssa/rewriteARM64.go +++ b/src/cmd/compile/internal/ssa/rewriteARM64.go @@ -1285,7 +1285,7 @@ func rewriteValueARM64_OpARM64ADD(v *Value) bool { } break } - // match: (ADD (SLL x (ANDconst <t> [63] y)) (CSEL0 <typ.UInt64> {cc} (SRL <typ.UInt64> x (SUB <t> (MOVDconst [64]) (ANDconst <t> [63] y))) (CMPconst [64] (SUB <t> (MOVDconst [64]) (ANDconst <t> [63] y))))) + // match: (ADD (SLL x (ANDconst <t> [63] y)) (CSEL0 <typ.UInt64> [cc] (SRL <typ.UInt64> x (SUB <t> (MOVDconst [64]) (ANDconst <t> [63] y))) (CMPconst [64] (SUB <t> (MOVDconst [64]) (ANDconst <t> [63] y))))) // cond: cc == OpARM64LessThanU // result: (ROR x (NEG <t> y)) for { @@ -1307,7 +1307,7 @@ func rewriteValueARM64_OpARM64ADD(v *Value) bool { if v_1.Op != OpARM64CSEL0 || v_1.Type != typ.UInt64 { continue } - cc := auxToCCop(v_1.Aux) + cc := auxIntToOp(v_1.AuxInt) _ = v_1.Args[1] v_1_0 := v_1.Args[0] if v_1_0.Op != OpARM64SRL || v_1_0.Type != typ.UInt64 { @@ -1355,7 +1355,7 @@ func rewriteValueARM64_OpARM64ADD(v *Value) bool { } break } - // match: (ADD (SRL <typ.UInt64> x (ANDconst <t> [63] y)) (CSEL0 <typ.UInt64> {cc} (SLL x (SUB <t> (MOVDconst [64]) (ANDconst <t> [63] y))) (CMPconst [64] (SUB <t> (MOVDconst [64]) (ANDconst <t> [63] y))))) + // match: (ADD (SRL <typ.UInt64> x (ANDconst <t> [63] y)) (CSEL0 <typ.UInt64> [cc] (SLL x (SUB <t> (MOVDconst [64]) (ANDconst <t> [63] y))) (CMPconst [64] (SUB <t> (MOVDconst [64]) (ANDconst <t> [63] y))))) // cond: cc == OpARM64LessThanU // result: (ROR x y) for { @@ -1377,7 +1377,7 @@ func rewriteValueARM64_OpARM64ADD(v *Value) bool { if v_1.Op != OpARM64CSEL0 || v_1.Type != typ.UInt64 { continue } - cc := auxToCCop(v_1.Aux) + cc := auxIntToOp(v_1.AuxInt) _ = v_1.Args[1] v_1_0 := v_1.Args[0] if v_1_0.Op != OpARM64SLL { @@ -1423,7 +1423,7 @@ func rewriteValueARM64_OpARM64ADD(v *Value) bool { } break } - // match: (ADD (SLL x (ANDconst <t> [31] y)) (CSEL0 <typ.UInt32> {cc} (SRL <typ.UInt32> (MOVWUreg x) (SUB <t> (MOVDconst [32]) (ANDconst <t> [31] y))) (CMPconst [64] (SUB <t> (MOVDconst [32]) (ANDconst <t> [31] y))))) + // match: (ADD (SLL x (ANDconst <t> [31] y)) (CSEL0 <typ.UInt32> [cc] (SRL <typ.UInt32> (MOVWUreg x) (SUB <t> (MOVDconst [32]) (ANDconst <t> [31] y))) (CMPconst [64] (SUB <t> (MOVDconst [32]) (ANDconst <t> [31] y))))) // cond: cc == OpARM64LessThanU // result: (RORW x (NEG <t> y)) for { @@ -1445,7 +1445,7 @@ func rewriteValueARM64_OpARM64ADD(v *Value) bool { if v_1.Op != OpARM64CSEL0 || v_1.Type != typ.UInt32 { continue } - cc := auxToCCop(v_1.Aux) + cc := auxIntToOp(v_1.AuxInt) _ = v_1.Args[1] v_1_0 := v_1.Args[0] if v_1_0.Op != OpARM64SRL || v_1_0.Type != typ.UInt32 { @@ -1494,7 +1494,7 @@ func rewriteValueARM64_OpARM64ADD(v *Value) bool { } break } - // match: (ADD (SRL <typ.UInt32> (MOVWUreg x) (ANDconst <t> [31] y)) (CSEL0 <typ.UInt32> {cc} (SLL x (SUB <t> (MOVDconst [32]) (ANDconst <t> [31] y))) (CMPconst [64] (SUB <t> (MOVDconst [32]) (ANDconst <t> [31] y))))) + // match: (ADD (SRL <typ.UInt32> (MOVWUreg x) (ANDconst <t> [31] y)) (CSEL0 <typ.UInt32> [cc] (SLL x (SUB <t> (MOVDconst [32]) (ANDconst <t> [31] y))) (CMPconst [64] (SUB <t> (MOVDconst [32]) (ANDconst <t> [31] y))))) // cond: cc == OpARM64LessThanU // result: (RORW x y) for { @@ -1520,7 +1520,7 @@ func rewriteValueARM64_OpARM64ADD(v *Value) bool { if v_1.Op != OpARM64CSEL0 || v_1.Type != typ.UInt32 { continue } - cc := auxToCCop(v_1.Aux) + cc := auxIntToOp(v_1.AuxInt) _ = v_1.Args[1] v_1_0 := v_1.Args[0] if v_1_0.Op != OpARM64SLL { @@ -3178,38 +3178,38 @@ func rewriteValueARM64_OpARM64CSEL(v *Value) bool { v_2 := v.Args[2] v_1 := v.Args[1] v_0 := v.Args[0] - // match: (CSEL {cc} x (MOVDconst [0]) flag) - // result: (CSEL0 {cc} x flag) + // match: (CSEL [cc] x (MOVDconst [0]) flag) + // result: (CSEL0 [cc] x flag) for { - cc := v.Aux + cc := auxIntToOp(v.AuxInt) x := v_0 - if v_1.Op != OpARM64MOVDconst || v_1.AuxInt != 0 { + if v_1.Op != OpARM64MOVDconst || auxIntToInt64(v_1.AuxInt) != 0 { break } flag := v_2 v.reset(OpARM64CSEL0) - v.Aux = cc + v.AuxInt = opToAuxInt(cc) v.AddArg2(x, flag) return true } - // match: (CSEL {cc} (MOVDconst [0]) y flag) - // result: (CSEL0 {arm64Negate(cc.(Op))} y flag) + // match: (CSEL [cc] (MOVDconst [0]) y flag) + // result: (CSEL0 [arm64Negate(cc)] y flag) for { - cc := v.Aux - if v_0.Op != OpARM64MOVDconst || v_0.AuxInt != 0 { + cc := auxIntToOp(v.AuxInt) + if v_0.Op != OpARM64MOVDconst || auxIntToInt64(v_0.AuxInt) != 0 { break } y := v_1 flag := v_2 v.reset(OpARM64CSEL0) - v.Aux = arm64Negate(cc.(Op)) + v.AuxInt = opToAuxInt(arm64Negate(cc)) v.AddArg2(y, flag) return true } - // match: (CSEL {cc} x y (InvertFlags cmp)) - // result: (CSEL {arm64Invert(cc)} x y cmp) + // match: (CSEL [cc] x y (InvertFlags cmp)) + // result: (CSEL [arm64Invert(cc)] x y cmp) for { - cc := auxToCCop(v.Aux) + cc := auxIntToOp(v.AuxInt) x := v_0 y := v_1 if v_2.Op != OpARM64InvertFlags { @@ -3217,15 +3217,15 @@ func rewriteValueARM64_OpARM64CSEL(v *Value) bool { } cmp := v_2.Args[0] v.reset(OpARM64CSEL) - v.Aux = cCopToAux(arm64Invert(cc)) + v.AuxInt = opToAuxInt(arm64Invert(cc)) v.AddArg3(x, y, cmp) return true } - // match: (CSEL {cc} x _ flag) + // match: (CSEL [cc] x _ flag) // cond: ccARM64Eval(cc, flag) > 0 // result: x for { - cc := auxToCCop(v.Aux) + cc := auxIntToOp(v.AuxInt) x := v_0 flag := v_2 if !(ccARM64Eval(cc, flag) > 0) { @@ -3234,11 +3234,11 @@ func rewriteValueARM64_OpARM64CSEL(v *Value) bool { v.copyOf(x) return true } - // match: (CSEL {cc} _ y flag) + // match: (CSEL [cc] _ y flag) // cond: ccARM64Eval(cc, flag) < 0 // result: y for { - cc := auxToCCop(v.Aux) + cc := auxIntToOp(v.AuxInt) y := v_1 flag := v_2 if !(ccARM64Eval(cc, flag) < 0) { @@ -3247,11 +3247,11 @@ func rewriteValueARM64_OpARM64CSEL(v *Value) bool { v.copyOf(y) return true } - // match: (CSEL {cc} x y (CMPWconst [0] boolval)) + // match: (CSEL [cc] x y (CMPWconst [0] boolval)) // cond: cc == OpARM64NotEqual && flagArg(boolval) != nil - // result: (CSEL {boolval.Op} x y flagArg(boolval)) + // result: (CSEL [boolval.Op] x y flagArg(boolval)) for { - cc := auxToCCop(v.Aux) + cc := auxIntToOp(v.AuxInt) x := v_0 y := v_1 if v_2.Op != OpARM64CMPWconst || auxIntToInt32(v_2.AuxInt) != 0 { @@ -3262,15 +3262,15 @@ func rewriteValueARM64_OpARM64CSEL(v *Value) bool { break } v.reset(OpARM64CSEL) - v.Aux = cCopToAux(boolval.Op) + v.AuxInt = opToAuxInt(boolval.Op) v.AddArg3(x, y, flagArg(boolval)) return true } - // match: (CSEL {cc} x y (CMPWconst [0] boolval)) + // match: (CSEL [cc] x y (CMPWconst [0] boolval)) // cond: cc == OpARM64Equal && flagArg(boolval) != nil - // result: (CSEL {arm64Negate(boolval.Op)} x y flagArg(boolval)) + // result: (CSEL [arm64Negate(boolval.Op)] x y flagArg(boolval)) for { - cc := auxToCCop(v.Aux) + cc := auxIntToOp(v.AuxInt) x := v_0 y := v_1 if v_2.Op != OpARM64CMPWconst || auxIntToInt32(v_2.AuxInt) != 0 { @@ -3281,7 +3281,7 @@ func rewriteValueARM64_OpARM64CSEL(v *Value) bool { break } v.reset(OpARM64CSEL) - v.Aux = cCopToAux(arm64Negate(boolval.Op)) + v.AuxInt = opToAuxInt(arm64Negate(boolval.Op)) v.AddArg3(x, y, flagArg(boolval)) return true } @@ -3290,25 +3290,25 @@ func rewriteValueARM64_OpARM64CSEL(v *Value) bool { func rewriteValueARM64_OpARM64CSEL0(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] - // match: (CSEL0 {cc} x (InvertFlags cmp)) - // result: (CSEL0 {arm64Invert(cc)} x cmp) + // match: (CSEL0 [cc] x (InvertFlags cmp)) + // result: (CSEL0 [arm64Invert(cc)] x cmp) for { - cc := auxToCCop(v.Aux) + cc := auxIntToOp(v.AuxInt) x := v_0 if v_1.Op != OpARM64InvertFlags { break } cmp := v_1.Args[0] v.reset(OpARM64CSEL0) - v.Aux = cCopToAux(arm64Invert(cc)) + v.AuxInt = opToAuxInt(arm64Invert(cc)) v.AddArg2(x, cmp) return true } - // match: (CSEL0 {cc} x flag) + // match: (CSEL0 [cc] x flag) // cond: ccARM64Eval(cc, flag) > 0 // result: x for { - cc := auxToCCop(v.Aux) + cc := auxIntToOp(v.AuxInt) x := v_0 flag := v_1 if !(ccARM64Eval(cc, flag) > 0) { @@ -3317,11 +3317,11 @@ func rewriteValueARM64_OpARM64CSEL0(v *Value) bool { v.copyOf(x) return true } - // match: (CSEL0 {cc} _ flag) + // match: (CSEL0 [cc] _ flag) // cond: ccARM64Eval(cc, flag) < 0 // result: (MOVDconst [0]) for { - cc := auxToCCop(v.Aux) + cc := auxIntToOp(v.AuxInt) flag := v_1 if !(ccARM64Eval(cc, flag) < 0) { break @@ -3330,11 +3330,11 @@ func rewriteValueARM64_OpARM64CSEL0(v *Value) bool { v.AuxInt = int64ToAuxInt(0) return true } - // match: (CSEL0 {cc} x (CMPWconst [0] boolval)) + // match: (CSEL0 [cc] x (CMPWconst [0] boolval)) // cond: cc == OpARM64NotEqual && flagArg(boolval) != nil - // result: (CSEL0 {boolval.Op} x flagArg(boolval)) + // result: (CSEL0 [boolval.Op] x flagArg(boolval)) for { - cc := auxToCCop(v.Aux) + cc := auxIntToOp(v.AuxInt) x := v_0 if v_1.Op != OpARM64CMPWconst || auxIntToInt32(v_1.AuxInt) != 0 { break @@ -3344,15 +3344,15 @@ func rewriteValueARM64_OpARM64CSEL0(v *Value) bool { break } v.reset(OpARM64CSEL0) - v.Aux = cCopToAux(boolval.Op) + v.AuxInt = opToAuxInt(boolval.Op) v.AddArg2(x, flagArg(boolval)) return true } - // match: (CSEL0 {cc} x (CMPWconst [0] boolval)) + // match: (CSEL0 [cc] x (CMPWconst [0] boolval)) // cond: cc == OpARM64Equal && flagArg(boolval) != nil - // result: (CSEL0 {arm64Negate(boolval.Op)} x flagArg(boolval)) + // result: (CSEL0 [arm64Negate(boolval.Op)] x flagArg(boolval)) for { - cc := auxToCCop(v.Aux) + cc := auxIntToOp(v.AuxInt) x := v_0 if v_1.Op != OpARM64CMPWconst || auxIntToInt32(v_1.AuxInt) != 0 { break @@ -3362,7 +3362,7 @@ func rewriteValueARM64_OpARM64CSEL0(v *Value) bool { break } v.reset(OpARM64CSEL0) - v.Aux = cCopToAux(arm64Negate(boolval.Op)) + v.AuxInt = opToAuxInt(arm64Negate(boolval.Op)) v.AddArg2(x, flagArg(boolval)) return true } @@ -15043,7 +15043,7 @@ func rewriteValueARM64_OpARM64OR(v *Value) bool { } break } - // match: (OR (SLL x (ANDconst <t> [63] y)) (CSEL0 <typ.UInt64> {cc} (SRL <typ.UInt64> x (SUB <t> (MOVDconst [64]) (ANDconst <t> [63] y))) (CMPconst [64] (SUB <t> (MOVDconst [64]) (ANDconst <t> [63] y))))) + // match: (OR (SLL x (ANDconst <t> [63] y)) (CSEL0 <typ.UInt64> [cc] (SRL <typ.UInt64> x (SUB <t> (MOVDconst [64]) (ANDconst <t> [63] y))) (CMPconst [64] (SUB <t> (MOVDconst [64]) (ANDconst <t> [63] y))))) // cond: cc == OpARM64LessThanU // result: (ROR x (NEG <t> y)) for { @@ -15065,7 +15065,7 @@ func rewriteValueARM64_OpARM64OR(v *Value) bool { if v_1.Op != OpARM64CSEL0 || v_1.Type != typ.UInt64 { continue } - cc := auxToCCop(v_1.Aux) + cc := auxIntToOp(v_1.AuxInt) _ = v_1.Args[1] v_1_0 := v_1.Args[0] if v_1_0.Op != OpARM64SRL || v_1_0.Type != typ.UInt64 { @@ -15113,7 +15113,7 @@ func rewriteValueARM64_OpARM64OR(v *Value) bool { } break } - // match: (OR (SRL <typ.UInt64> x (ANDconst <t> [63] y)) (CSEL0 <typ.UInt64> {cc} (SLL x (SUB <t> (MOVDconst [64]) (ANDconst <t> [63] y))) (CMPconst [64] (SUB <t> (MOVDconst [64]) (ANDconst <t> [63] y))))) + // match: (OR (SRL <typ.UInt64> x (ANDconst <t> [63] y)) (CSEL0 <typ.UInt64> [cc] (SLL x (SUB <t> (MOVDconst [64]) (ANDconst <t> [63] y))) (CMPconst [64] (SUB <t> (MOVDconst [64]) (ANDconst <t> [63] y))))) // cond: cc == OpARM64LessThanU // result: (ROR x y) for { @@ -15135,7 +15135,7 @@ func rewriteValueARM64_OpARM64OR(v *Value) bool { if v_1.Op != OpARM64CSEL0 || v_1.Type != typ.UInt64 { continue } - cc := auxToCCop(v_1.Aux) + cc := auxIntToOp(v_1.AuxInt) _ = v_1.Args[1] v_1_0 := v_1.Args[0] if v_1_0.Op != OpARM64SLL { @@ -15181,7 +15181,7 @@ func rewriteValueARM64_OpARM64OR(v *Value) bool { } break } - // match: (OR (SLL x (ANDconst <t> [31] y)) (CSEL0 <typ.UInt32> {cc} (SRL <typ.UInt32> (MOVWUreg x) (SUB <t> (MOVDconst [32]) (ANDconst <t> [31] y))) (CMPconst [64] (SUB <t> (MOVDconst [32]) (ANDconst <t> [31] y))))) + // match: (OR (SLL x (ANDconst <t> [31] y)) (CSEL0 <typ.UInt32> [cc] (SRL <typ.UInt32> (MOVWUreg x) (SUB <t> (MOVDconst [32]) (ANDconst <t> [31] y))) (CMPconst [64] (SUB <t> (MOVDconst [32]) (ANDconst <t> [31] y))))) // cond: cc == OpARM64LessThanU // result: (RORW x (NEG <t> y)) for { @@ -15203,7 +15203,7 @@ func rewriteValueARM64_OpARM64OR(v *Value) bool { if v_1.Op != OpARM64CSEL0 || v_1.Type != typ.UInt32 { continue } - cc := auxToCCop(v_1.Aux) + cc := auxIntToOp(v_1.AuxInt) _ = v_1.Args[1] v_1_0 := v_1.Args[0] if v_1_0.Op != OpARM64SRL || v_1_0.Type != typ.UInt32 { @@ -15252,7 +15252,7 @@ func rewriteValueARM64_OpARM64OR(v *Value) bool { } break } - // match: (OR (SRL <typ.UInt32> (MOVWUreg x) (ANDconst <t> [31] y)) (CSEL0 <typ.UInt32> {cc} (SLL x (SUB <t> (MOVDconst [32]) (ANDconst <t> [31] y))) (CMPconst [64] (SUB <t> (MOVDconst [32]) (ANDconst <t> [31] y))))) + // match: (OR (SRL <typ.UInt32> (MOVWUreg x) (ANDconst <t> [31] y)) (CSEL0 <typ.UInt32> [cc] (SLL x (SUB <t> (MOVDconst [32]) (ANDconst <t> [31] y))) (CMPconst [64] (SUB <t> (MOVDconst [32]) (ANDconst <t> [31] y))))) // cond: cc == OpARM64LessThanU // result: (RORW x y) for { @@ -15278,7 +15278,7 @@ func rewriteValueARM64_OpARM64OR(v *Value) bool { if v_1.Op != OpARM64CSEL0 || v_1.Type != typ.UInt32 { continue } - cc := auxToCCop(v_1.Aux) + cc := auxIntToOp(v_1.AuxInt) _ = v_1.Args[1] v_1_0 := v_1.Args[0] if v_1_0.Op != OpARM64SLL { @@ -20713,7 +20713,7 @@ func rewriteValueARM64_OpARM64XOR(v *Value) bool { } break } - // match: (XOR (SLL x (ANDconst <t> [63] y)) (CSEL0 <typ.UInt64> {cc} (SRL <typ.UInt64> x (SUB <t> (MOVDconst [64]) (ANDconst <t> [63] y))) (CMPconst [64] (SUB <t> (MOVDconst [64]) (ANDconst <t> [63] y))))) + // match: (XOR (SLL x (ANDconst <t> [63] y)) (CSEL0 <typ.UInt64> [cc] (SRL <typ.UInt64> x (SUB <t> (MOVDconst [64]) (ANDconst <t> [63] y))) (CMPconst [64] (SUB <t> (MOVDconst [64]) (ANDconst <t> [63] y))))) // cond: cc == OpARM64LessThanU // result: (ROR x (NEG <t> y)) for { @@ -20735,7 +20735,7 @@ func rewriteValueARM64_OpARM64XOR(v *Value) bool { if v_1.Op != OpARM64CSEL0 || v_1.Type != typ.UInt64 { continue } - cc := auxToCCop(v_1.Aux) + cc := auxIntToOp(v_1.AuxInt) _ = v_1.Args[1] v_1_0 := v_1.Args[0] if v_1_0.Op != OpARM64SRL || v_1_0.Type != typ.UInt64 { @@ -20783,7 +20783,7 @@ func rewriteValueARM64_OpARM64XOR(v *Value) bool { } break } - // match: (XOR (SRL <typ.UInt64> x (ANDconst <t> [63] y)) (CSEL0 <typ.UInt64> {cc} (SLL x (SUB <t> (MOVDconst [64]) (ANDconst <t> [63] y))) (CMPconst [64] (SUB <t> (MOVDconst [64]) (ANDconst <t> [63] y))))) + // match: (XOR (SRL <typ.UInt64> x (ANDconst <t> [63] y)) (CSEL0 <typ.UInt64> [cc] (SLL x (SUB <t> (MOVDconst [64]) (ANDconst <t> [63] y))) (CMPconst [64] (SUB <t> (MOVDconst [64]) (ANDconst <t> [63] y))))) // cond: cc == OpARM64LessThanU // result: (ROR x y) for { @@ -20805,7 +20805,7 @@ func rewriteValueARM64_OpARM64XOR(v *Value) bool { if v_1.Op != OpARM64CSEL0 || v_1.Type != typ.UInt64 { continue } - cc := auxToCCop(v_1.Aux) + cc := auxIntToOp(v_1.AuxInt) _ = v_1.Args[1] v_1_0 := v_1.Args[0] if v_1_0.Op != OpARM64SLL { @@ -20851,7 +20851,7 @@ func rewriteValueARM64_OpARM64XOR(v *Value) bool { } break } - // match: (XOR (SLL x (ANDconst <t> [31] y)) (CSEL0 <typ.UInt32> {cc} (SRL <typ.UInt32> (MOVWUreg x) (SUB <t> (MOVDconst [32]) (ANDconst <t> [31] y))) (CMPconst [64] (SUB <t> (MOVDconst [32]) (ANDconst <t> [31] y))))) + // match: (XOR (SLL x (ANDconst <t> [31] y)) (CSEL0 <typ.UInt32> [cc] (SRL <typ.UInt32> (MOVWUreg x) (SUB <t> (MOVDconst [32]) (ANDconst <t> [31] y))) (CMPconst [64] (SUB <t> (MOVDconst [32]) (ANDconst <t> [31] y))))) // cond: cc == OpARM64LessThanU // result: (RORW x (NEG <t> y)) for { @@ -20873,7 +20873,7 @@ func rewriteValueARM64_OpARM64XOR(v *Value) bool { if v_1.Op != OpARM64CSEL0 || v_1.Type != typ.UInt32 { continue } - cc := auxToCCop(v_1.Aux) + cc := auxIntToOp(v_1.AuxInt) _ = v_1.Args[1] v_1_0 := v_1.Args[0] if v_1_0.Op != OpARM64SRL || v_1_0.Type != typ.UInt32 { @@ -20922,7 +20922,7 @@ func rewriteValueARM64_OpARM64XOR(v *Value) bool { } break } - // match: (XOR (SRL <typ.UInt32> (MOVWUreg x) (ANDconst <t> [31] y)) (CSEL0 <typ.UInt32> {cc} (SLL x (SUB <t> (MOVDconst [32]) (ANDconst <t> [31] y))) (CMPconst [64] (SUB <t> (MOVDconst [32]) (ANDconst <t> [31] y))))) + // match: (XOR (SRL <typ.UInt32> (MOVWUreg x) (ANDconst <t> [31] y)) (CSEL0 <typ.UInt32> [cc] (SLL x (SUB <t> (MOVDconst [32]) (ANDconst <t> [31] y))) (CMPconst [64] (SUB <t> (MOVDconst [32]) (ANDconst <t> [31] y))))) // cond: cc == OpARM64LessThanU // result: (RORW x y) for { @@ -20948,7 +20948,7 @@ func rewriteValueARM64_OpARM64XOR(v *Value) bool { if v_1.Op != OpARM64CSEL0 || v_1.Type != typ.UInt32 { continue } - cc := auxToCCop(v_1.Aux) + cc := auxIntToOp(v_1.AuxInt) _ = v_1.Args[1] v_1_0 := v_1.Args[0] if v_1_0.Op != OpARM64SLL { @@ -21471,7 +21471,7 @@ func rewriteValueARM64_OpCondSelect(v *Value) bool { b := v.Block // match: (CondSelect x y boolval) // cond: flagArg(boolval) != nil - // result: (CSEL {boolval.Op} x y flagArg(boolval)) + // result: (CSEL [boolval.Op] x y flagArg(boolval)) for { x := v_0 y := v_1 @@ -21480,13 +21480,13 @@ func rewriteValueARM64_OpCondSelect(v *Value) bool { break } v.reset(OpARM64CSEL) - v.Aux = cCopToAux(boolval.Op) + v.AuxInt = opToAuxInt(boolval.Op) v.AddArg3(x, y, flagArg(boolval)) return true } // match: (CondSelect x y boolval) // cond: flagArg(boolval) == nil - // result: (CSEL {OpARM64NotEqual} x y (CMPWconst [0] boolval)) + // result: (CSEL [OpARM64NotEqual] x y (CMPWconst [0] boolval)) for { x := v_0 y := v_1 @@ -21495,7 +21495,7 @@ func rewriteValueARM64_OpCondSelect(v *Value) bool { break } v.reset(OpARM64CSEL) - v.Aux = cCopToAux(OpARM64NotEqual) + v.AuxInt = opToAuxInt(OpARM64NotEqual) v0 := b.NewValue0(v.Pos, OpARM64CMPWconst, types.TypeFlags) v0.AuxInt = int32ToAuxInt(0) v0.AddArg(boolval) @@ -22734,13 +22734,13 @@ func rewriteValueARM64_OpLsh16x16(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Lsh16x16 <t> x y) - // result: (CSEL {OpARM64LessThanU} (SLL <t> x (ZeroExt16to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt16to64 y))) + // result: (CSEL [OpARM64LessThanU] (SLL <t> x (ZeroExt16to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt16to64 y))) for { t := v.Type x := v_0 y := v_1 v.reset(OpARM64CSEL) - v.Aux = cCopToAux(OpARM64LessThanU) + v.AuxInt = opToAuxInt(OpARM64LessThanU) v0 := b.NewValue0(v.Pos, OpARM64SLL, t) v1 := b.NewValue0(v.Pos, OpZeroExt16to64, typ.UInt64) v1.AddArg(y) @@ -22760,13 +22760,13 @@ func rewriteValueARM64_OpLsh16x32(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Lsh16x32 <t> x y) - // result: (CSEL {OpARM64LessThanU} (SLL <t> x (ZeroExt32to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt32to64 y))) + // result: (CSEL [OpARM64LessThanU] (SLL <t> x (ZeroExt32to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt32to64 y))) for { t := v.Type x := v_0 y := v_1 v.reset(OpARM64CSEL) - v.Aux = cCopToAux(OpARM64LessThanU) + v.AuxInt = opToAuxInt(OpARM64LessThanU) v0 := b.NewValue0(v.Pos, OpARM64SLL, t) v1 := b.NewValue0(v.Pos, OpZeroExt32to64, typ.UInt64) v1.AddArg(y) @@ -22785,13 +22785,13 @@ func rewriteValueARM64_OpLsh16x64(v *Value) bool { v_0 := v.Args[0] b := v.Block // match: (Lsh16x64 <t> x y) - // result: (CSEL {OpARM64LessThanU} (SLL <t> x y) (Const64 <t> [0]) (CMPconst [64] y)) + // result: (CSEL [OpARM64LessThanU] (SLL <t> x y) (Const64 <t> [0]) (CMPconst [64] y)) for { t := v.Type x := v_0 y := v_1 v.reset(OpARM64CSEL) - v.Aux = cCopToAux(OpARM64LessThanU) + v.AuxInt = opToAuxInt(OpARM64LessThanU) v0 := b.NewValue0(v.Pos, OpARM64SLL, t) v0.AddArg2(x, y) v1 := b.NewValue0(v.Pos, OpConst64, t) @@ -22809,13 +22809,13 @@ func rewriteValueARM64_OpLsh16x8(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Lsh16x8 <t> x y) - // result: (CSEL {OpARM64LessThanU} (SLL <t> x (ZeroExt8to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt8to64 y))) + // result: (CSEL [OpARM64LessThanU] (SLL <t> x (ZeroExt8to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt8to64 y))) for { t := v.Type x := v_0 y := v_1 v.reset(OpARM64CSEL) - v.Aux = cCopToAux(OpARM64LessThanU) + v.AuxInt = opToAuxInt(OpARM64LessThanU) v0 := b.NewValue0(v.Pos, OpARM64SLL, t) v1 := b.NewValue0(v.Pos, OpZeroExt8to64, typ.UInt64) v1.AddArg(y) @@ -22835,13 +22835,13 @@ func rewriteValueARM64_OpLsh32x16(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Lsh32x16 <t> x y) - // result: (CSEL {OpARM64LessThanU} (SLL <t> x (ZeroExt16to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt16to64 y))) + // result: (CSEL [OpARM64LessThanU] (SLL <t> x (ZeroExt16to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt16to64 y))) for { t := v.Type x := v_0 y := v_1 v.reset(OpARM64CSEL) - v.Aux = cCopToAux(OpARM64LessThanU) + v.AuxInt = opToAuxInt(OpARM64LessThanU) v0 := b.NewValue0(v.Pos, OpARM64SLL, t) v1 := b.NewValue0(v.Pos, OpZeroExt16to64, typ.UInt64) v1.AddArg(y) @@ -22861,13 +22861,13 @@ func rewriteValueARM64_OpLsh32x32(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Lsh32x32 <t> x y) - // result: (CSEL {OpARM64LessThanU} (SLL <t> x (ZeroExt32to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt32to64 y))) + // result: (CSEL [OpARM64LessThanU] (SLL <t> x (ZeroExt32to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt32to64 y))) for { t := v.Type x := v_0 y := v_1 v.reset(OpARM64CSEL) - v.Aux = cCopToAux(OpARM64LessThanU) + v.AuxInt = opToAuxInt(OpARM64LessThanU) v0 := b.NewValue0(v.Pos, OpARM64SLL, t) v1 := b.NewValue0(v.Pos, OpZeroExt32to64, typ.UInt64) v1.AddArg(y) @@ -22886,13 +22886,13 @@ func rewriteValueARM64_OpLsh32x64(v *Value) bool { v_0 := v.Args[0] b := v.Block // match: (Lsh32x64 <t> x y) - // result: (CSEL {OpARM64LessThanU} (SLL <t> x y) (Const64 <t> [0]) (CMPconst [64] y)) + // result: (CSEL [OpARM64LessThanU] (SLL <t> x y) (Const64 <t> [0]) (CMPconst [64] y)) for { t := v.Type x := v_0 y := v_1 v.reset(OpARM64CSEL) - v.Aux = cCopToAux(OpARM64LessThanU) + v.AuxInt = opToAuxInt(OpARM64LessThanU) v0 := b.NewValue0(v.Pos, OpARM64SLL, t) v0.AddArg2(x, y) v1 := b.NewValue0(v.Pos, OpConst64, t) @@ -22910,13 +22910,13 @@ func rewriteValueARM64_OpLsh32x8(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Lsh32x8 <t> x y) - // result: (CSEL {OpARM64LessThanU} (SLL <t> x (ZeroExt8to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt8to64 y))) + // result: (CSEL [OpARM64LessThanU] (SLL <t> x (ZeroExt8to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt8to64 y))) for { t := v.Type x := v_0 y := v_1 v.reset(OpARM64CSEL) - v.Aux = cCopToAux(OpARM64LessThanU) + v.AuxInt = opToAuxInt(OpARM64LessThanU) v0 := b.NewValue0(v.Pos, OpARM64SLL, t) v1 := b.NewValue0(v.Pos, OpZeroExt8to64, typ.UInt64) v1.AddArg(y) @@ -22936,13 +22936,13 @@ func rewriteValueARM64_OpLsh64x16(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Lsh64x16 <t> x y) - // result: (CSEL {OpARM64LessThanU} (SLL <t> x (ZeroExt16to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt16to64 y))) + // result: (CSEL [OpARM64LessThanU] (SLL <t> x (ZeroExt16to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt16to64 y))) for { t := v.Type x := v_0 y := v_1 v.reset(OpARM64CSEL) - v.Aux = cCopToAux(OpARM64LessThanU) + v.AuxInt = opToAuxInt(OpARM64LessThanU) v0 := b.NewValue0(v.Pos, OpARM64SLL, t) v1 := b.NewValue0(v.Pos, OpZeroExt16to64, typ.UInt64) v1.AddArg(y) @@ -22962,13 +22962,13 @@ func rewriteValueARM64_OpLsh64x32(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Lsh64x32 <t> x y) - // result: (CSEL {OpARM64LessThanU} (SLL <t> x (ZeroExt32to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt32to64 y))) + // result: (CSEL [OpARM64LessThanU] (SLL <t> x (ZeroExt32to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt32to64 y))) for { t := v.Type x := v_0 y := v_1 v.reset(OpARM64CSEL) - v.Aux = cCopToAux(OpARM64LessThanU) + v.AuxInt = opToAuxInt(OpARM64LessThanU) v0 := b.NewValue0(v.Pos, OpARM64SLL, t) v1 := b.NewValue0(v.Pos, OpZeroExt32to64, typ.UInt64) v1.AddArg(y) @@ -22987,13 +22987,13 @@ func rewriteValueARM64_OpLsh64x64(v *Value) bool { v_0 := v.Args[0] b := v.Block // match: (Lsh64x64 <t> x y) - // result: (CSEL {OpARM64LessThanU} (SLL <t> x y) (Const64 <t> [0]) (CMPconst [64] y)) + // result: (CSEL [OpARM64LessThanU] (SLL <t> x y) (Const64 <t> [0]) (CMPconst [64] y)) for { t := v.Type x := v_0 y := v_1 v.reset(OpARM64CSEL) - v.Aux = cCopToAux(OpARM64LessThanU) + v.AuxInt = opToAuxInt(OpARM64LessThanU) v0 := b.NewValue0(v.Pos, OpARM64SLL, t) v0.AddArg2(x, y) v1 := b.NewValue0(v.Pos, OpConst64, t) @@ -23011,13 +23011,13 @@ func rewriteValueARM64_OpLsh64x8(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Lsh64x8 <t> x y) - // result: (CSEL {OpARM64LessThanU} (SLL <t> x (ZeroExt8to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt8to64 y))) + // result: (CSEL [OpARM64LessThanU] (SLL <t> x (ZeroExt8to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt8to64 y))) for { t := v.Type x := v_0 y := v_1 v.reset(OpARM64CSEL) - v.Aux = cCopToAux(OpARM64LessThanU) + v.AuxInt = opToAuxInt(OpARM64LessThanU) v0 := b.NewValue0(v.Pos, OpARM64SLL, t) v1 := b.NewValue0(v.Pos, OpZeroExt8to64, typ.UInt64) v1.AddArg(y) @@ -23037,13 +23037,13 @@ func rewriteValueARM64_OpLsh8x16(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Lsh8x16 <t> x y) - // result: (CSEL {OpARM64LessThanU} (SLL <t> x (ZeroExt16to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt16to64 y))) + // result: (CSEL [OpARM64LessThanU] (SLL <t> x (ZeroExt16to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt16to64 y))) for { t := v.Type x := v_0 y := v_1 v.reset(OpARM64CSEL) - v.Aux = cCopToAux(OpARM64LessThanU) + v.AuxInt = opToAuxInt(OpARM64LessThanU) v0 := b.NewValue0(v.Pos, OpARM64SLL, t) v1 := b.NewValue0(v.Pos, OpZeroExt16to64, typ.UInt64) v1.AddArg(y) @@ -23063,13 +23063,13 @@ func rewriteValueARM64_OpLsh8x32(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Lsh8x32 <t> x y) - // result: (CSEL {OpARM64LessThanU} (SLL <t> x (ZeroExt32to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt32to64 y))) + // result: (CSEL [OpARM64LessThanU] (SLL <t> x (ZeroExt32to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt32to64 y))) for { t := v.Type x := v_0 y := v_1 v.reset(OpARM64CSEL) - v.Aux = cCopToAux(OpARM64LessThanU) + v.AuxInt = opToAuxInt(OpARM64LessThanU) v0 := b.NewValue0(v.Pos, OpARM64SLL, t) v1 := b.NewValue0(v.Pos, OpZeroExt32to64, typ.UInt64) v1.AddArg(y) @@ -23088,13 +23088,13 @@ func rewriteValueARM64_OpLsh8x64(v *Value) bool { v_0 := v.Args[0] b := v.Block // match: (Lsh8x64 <t> x y) - // result: (CSEL {OpARM64LessThanU} (SLL <t> x y) (Const64 <t> [0]) (CMPconst [64] y)) + // result: (CSEL [OpARM64LessThanU] (SLL <t> x y) (Const64 <t> [0]) (CMPconst [64] y)) for { t := v.Type x := v_0 y := v_1 v.reset(OpARM64CSEL) - v.Aux = cCopToAux(OpARM64LessThanU) + v.AuxInt = opToAuxInt(OpARM64LessThanU) v0 := b.NewValue0(v.Pos, OpARM64SLL, t) v0.AddArg2(x, y) v1 := b.NewValue0(v.Pos, OpConst64, t) @@ -23112,13 +23112,13 @@ func rewriteValueARM64_OpLsh8x8(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Lsh8x8 <t> x y) - // result: (CSEL {OpARM64LessThanU} (SLL <t> x (ZeroExt8to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt8to64 y))) + // result: (CSEL [OpARM64LessThanU] (SLL <t> x (ZeroExt8to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt8to64 y))) for { t := v.Type x := v_0 y := v_1 v.reset(OpARM64CSEL) - v.Aux = cCopToAux(OpARM64LessThanU) + v.AuxInt = opToAuxInt(OpARM64LessThanU) v0 := b.NewValue0(v.Pos, OpARM64SLL, t) v1 := b.NewValue0(v.Pos, OpZeroExt8to64, typ.UInt64) v1.AddArg(y) @@ -23932,13 +23932,13 @@ func rewriteValueARM64_OpRsh16Ux16(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Rsh16Ux16 <t> x y) - // result: (CSEL {OpARM64LessThanU} (SRL <t> (ZeroExt16to64 x) (ZeroExt16to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt16to64 y))) + // result: (CSEL [OpARM64LessThanU] (SRL <t> (ZeroExt16to64 x) (ZeroExt16to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt16to64 y))) for { t := v.Type x := v_0 y := v_1 v.reset(OpARM64CSEL) - v.Aux = cCopToAux(OpARM64LessThanU) + v.AuxInt = opToAuxInt(OpARM64LessThanU) v0 := b.NewValue0(v.Pos, OpARM64SRL, t) v1 := b.NewValue0(v.Pos, OpZeroExt16to64, typ.UInt64) v1.AddArg(x) @@ -23960,13 +23960,13 @@ func rewriteValueARM64_OpRsh16Ux32(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Rsh16Ux32 <t> x y) - // result: (CSEL {OpARM64LessThanU} (SRL <t> (ZeroExt16to64 x) (ZeroExt32to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt32to64 y))) + // result: (CSEL [OpARM64LessThanU] (SRL <t> (ZeroExt16to64 x) (ZeroExt32to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt32to64 y))) for { t := v.Type x := v_0 y := v_1 v.reset(OpARM64CSEL) - v.Aux = cCopToAux(OpARM64LessThanU) + v.AuxInt = opToAuxInt(OpARM64LessThanU) v0 := b.NewValue0(v.Pos, OpARM64SRL, t) v1 := b.NewValue0(v.Pos, OpZeroExt16to64, typ.UInt64) v1.AddArg(x) @@ -23988,13 +23988,13 @@ func rewriteValueARM64_OpRsh16Ux64(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Rsh16Ux64 <t> x y) - // result: (CSEL {OpARM64LessThanU} (SRL <t> (ZeroExt16to64 x) y) (Const64 <t> [0]) (CMPconst [64] y)) + // result: (CSEL [OpARM64LessThanU] (SRL <t> (ZeroExt16to64 x) y) (Const64 <t> [0]) (CMPconst [64] y)) for { t := v.Type x := v_0 y := v_1 v.reset(OpARM64CSEL) - v.Aux = cCopToAux(OpARM64LessThanU) + v.AuxInt = opToAuxInt(OpARM64LessThanU) v0 := b.NewValue0(v.Pos, OpARM64SRL, t) v1 := b.NewValue0(v.Pos, OpZeroExt16to64, typ.UInt64) v1.AddArg(x) @@ -24014,13 +24014,13 @@ func rewriteValueARM64_OpRsh16Ux8(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Rsh16Ux8 <t> x y) - // result: (CSEL {OpARM64LessThanU} (SRL <t> (ZeroExt16to64 x) (ZeroExt8to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt8to64 y))) + // result: (CSEL [OpARM64LessThanU] (SRL <t> (ZeroExt16to64 x) (ZeroExt8to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt8to64 y))) for { t := v.Type x := v_0 y := v_1 v.reset(OpARM64CSEL) - v.Aux = cCopToAux(OpARM64LessThanU) + v.AuxInt = opToAuxInt(OpARM64LessThanU) v0 := b.NewValue0(v.Pos, OpARM64SRL, t) v1 := b.NewValue0(v.Pos, OpZeroExt16to64, typ.UInt64) v1.AddArg(x) @@ -24042,7 +24042,7 @@ func rewriteValueARM64_OpRsh16x16(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Rsh16x16 x y) - // result: (SRA (SignExt16to64 x) (CSEL {OpARM64LessThanU} <y.Type> (ZeroExt16to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt16to64 y)))) + // result: (SRA (SignExt16to64 x) (CSEL [OpARM64LessThanU] <y.Type> (ZeroExt16to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt16to64 y)))) for { x := v_0 y := v_1 @@ -24050,7 +24050,7 @@ func rewriteValueARM64_OpRsh16x16(v *Value) bool { v0 := b.NewValue0(v.Pos, OpSignExt16to64, typ.Int64) v0.AddArg(x) v1 := b.NewValue0(v.Pos, OpARM64CSEL, y.Type) - v1.Aux = cCopToAux(OpARM64LessThanU) + v1.AuxInt = opToAuxInt(OpARM64LessThanU) v2 := b.NewValue0(v.Pos, OpZeroExt16to64, typ.UInt64) v2.AddArg(y) v3 := b.NewValue0(v.Pos, OpConst64, y.Type) @@ -24069,7 +24069,7 @@ func rewriteValueARM64_OpRsh16x32(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Rsh16x32 x y) - // result: (SRA (SignExt16to64 x) (CSEL {OpARM64LessThanU} <y.Type> (ZeroExt32to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt32to64 y)))) + // result: (SRA (SignExt16to64 x) (CSEL [OpARM64LessThanU] <y.Type> (ZeroExt32to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt32to64 y)))) for { x := v_0 y := v_1 @@ -24077,7 +24077,7 @@ func rewriteValueARM64_OpRsh16x32(v *Value) bool { v0 := b.NewValue0(v.Pos, OpSignExt16to64, typ.Int64) v0.AddArg(x) v1 := b.NewValue0(v.Pos, OpARM64CSEL, y.Type) - v1.Aux = cCopToAux(OpARM64LessThanU) + v1.AuxInt = opToAuxInt(OpARM64LessThanU) v2 := b.NewValue0(v.Pos, OpZeroExt32to64, typ.UInt64) v2.AddArg(y) v3 := b.NewValue0(v.Pos, OpConst64, y.Type) @@ -24096,7 +24096,7 @@ func rewriteValueARM64_OpRsh16x64(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Rsh16x64 x y) - // result: (SRA (SignExt16to64 x) (CSEL {OpARM64LessThanU} <y.Type> y (Const64 <y.Type> [63]) (CMPconst [64] y))) + // result: (SRA (SignExt16to64 x) (CSEL [OpARM64LessThanU] <y.Type> y (Const64 <y.Type> [63]) (CMPconst [64] y))) for { x := v_0 y := v_1 @@ -24104,7 +24104,7 @@ func rewriteValueARM64_OpRsh16x64(v *Value) bool { v0 := b.NewValue0(v.Pos, OpSignExt16to64, typ.Int64) v0.AddArg(x) v1 := b.NewValue0(v.Pos, OpARM64CSEL, y.Type) - v1.Aux = cCopToAux(OpARM64LessThanU) + v1.AuxInt = opToAuxInt(OpARM64LessThanU) v2 := b.NewValue0(v.Pos, OpConst64, y.Type) v2.AuxInt = int64ToAuxInt(63) v3 := b.NewValue0(v.Pos, OpARM64CMPconst, types.TypeFlags) @@ -24121,7 +24121,7 @@ func rewriteValueARM64_OpRsh16x8(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Rsh16x8 x y) - // result: (SRA (SignExt16to64 x) (CSEL {OpARM64LessThanU} <y.Type> (ZeroExt8to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt8to64 y)))) + // result: (SRA (SignExt16to64 x) (CSEL [OpARM64LessThanU] <y.Type> (ZeroExt8to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt8to64 y)))) for { x := v_0 y := v_1 @@ -24129,7 +24129,7 @@ func rewriteValueARM64_OpRsh16x8(v *Value) bool { v0 := b.NewValue0(v.Pos, OpSignExt16to64, typ.Int64) v0.AddArg(x) v1 := b.NewValue0(v.Pos, OpARM64CSEL, y.Type) - v1.Aux = cCopToAux(OpARM64LessThanU) + v1.AuxInt = opToAuxInt(OpARM64LessThanU) v2 := b.NewValue0(v.Pos, OpZeroExt8to64, typ.UInt64) v2.AddArg(y) v3 := b.NewValue0(v.Pos, OpConst64, y.Type) @@ -24148,13 +24148,13 @@ func rewriteValueARM64_OpRsh32Ux16(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Rsh32Ux16 <t> x y) - // result: (CSEL {OpARM64LessThanU} (SRL <t> (ZeroExt32to64 x) (ZeroExt16to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt16to64 y))) + // result: (CSEL [OpARM64LessThanU] (SRL <t> (ZeroExt32to64 x) (ZeroExt16to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt16to64 y))) for { t := v.Type x := v_0 y := v_1 v.reset(OpARM64CSEL) - v.Aux = cCopToAux(OpARM64LessThanU) + v.AuxInt = opToAuxInt(OpARM64LessThanU) v0 := b.NewValue0(v.Pos, OpARM64SRL, t) v1 := b.NewValue0(v.Pos, OpZeroExt32to64, typ.UInt64) v1.AddArg(x) @@ -24176,13 +24176,13 @@ func rewriteValueARM64_OpRsh32Ux32(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Rsh32Ux32 <t> x y) - // result: (CSEL {OpARM64LessThanU} (SRL <t> (ZeroExt32to64 x) (ZeroExt32to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt32to64 y))) + // result: (CSEL [OpARM64LessThanU] (SRL <t> (ZeroExt32to64 x) (ZeroExt32to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt32to64 y))) for { t := v.Type x := v_0 y := v_1 v.reset(OpARM64CSEL) - v.Aux = cCopToAux(OpARM64LessThanU) + v.AuxInt = opToAuxInt(OpARM64LessThanU) v0 := b.NewValue0(v.Pos, OpARM64SRL, t) v1 := b.NewValue0(v.Pos, OpZeroExt32to64, typ.UInt64) v1.AddArg(x) @@ -24204,13 +24204,13 @@ func rewriteValueARM64_OpRsh32Ux64(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Rsh32Ux64 <t> x y) - // result: (CSEL {OpARM64LessThanU} (SRL <t> (ZeroExt32to64 x) y) (Const64 <t> [0]) (CMPconst [64] y)) + // result: (CSEL [OpARM64LessThanU] (SRL <t> (ZeroExt32to64 x) y) (Const64 <t> [0]) (CMPconst [64] y)) for { t := v.Type x := v_0 y := v_1 v.reset(OpARM64CSEL) - v.Aux = cCopToAux(OpARM64LessThanU) + v.AuxInt = opToAuxInt(OpARM64LessThanU) v0 := b.NewValue0(v.Pos, OpARM64SRL, t) v1 := b.NewValue0(v.Pos, OpZeroExt32to64, typ.UInt64) v1.AddArg(x) @@ -24230,13 +24230,13 @@ func rewriteValueARM64_OpRsh32Ux8(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Rsh32Ux8 <t> x y) - // result: (CSEL {OpARM64LessThanU} (SRL <t> (ZeroExt32to64 x) (ZeroExt8to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt8to64 y))) + // result: (CSEL [OpARM64LessThanU] (SRL <t> (ZeroExt32to64 x) (ZeroExt8to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt8to64 y))) for { t := v.Type x := v_0 y := v_1 v.reset(OpARM64CSEL) - v.Aux = cCopToAux(OpARM64LessThanU) + v.AuxInt = opToAuxInt(OpARM64LessThanU) v0 := b.NewValue0(v.Pos, OpARM64SRL, t) v1 := b.NewValue0(v.Pos, OpZeroExt32to64, typ.UInt64) v1.AddArg(x) @@ -24258,7 +24258,7 @@ func rewriteValueARM64_OpRsh32x16(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Rsh32x16 x y) - // result: (SRA (SignExt32to64 x) (CSEL {OpARM64LessThanU} <y.Type> (ZeroExt16to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt16to64 y)))) + // result: (SRA (SignExt32to64 x) (CSEL [OpARM64LessThanU] <y.Type> (ZeroExt16to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt16to64 y)))) for { x := v_0 y := v_1 @@ -24266,7 +24266,7 @@ func rewriteValueARM64_OpRsh32x16(v *Value) bool { v0 := b.NewValue0(v.Pos, OpSignExt32to64, typ.Int64) v0.AddArg(x) v1 := b.NewValue0(v.Pos, OpARM64CSEL, y.Type) - v1.Aux = cCopToAux(OpARM64LessThanU) + v1.AuxInt = opToAuxInt(OpARM64LessThanU) v2 := b.NewValue0(v.Pos, OpZeroExt16to64, typ.UInt64) v2.AddArg(y) v3 := b.NewValue0(v.Pos, OpConst64, y.Type) @@ -24285,7 +24285,7 @@ func rewriteValueARM64_OpRsh32x32(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Rsh32x32 x y) - // result: (SRA (SignExt32to64 x) (CSEL {OpARM64LessThanU} <y.Type> (ZeroExt32to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt32to64 y)))) + // result: (SRA (SignExt32to64 x) (CSEL [OpARM64LessThanU] <y.Type> (ZeroExt32to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt32to64 y)))) for { x := v_0 y := v_1 @@ -24293,7 +24293,7 @@ func rewriteValueARM64_OpRsh32x32(v *Value) bool { v0 := b.NewValue0(v.Pos, OpSignExt32to64, typ.Int64) v0.AddArg(x) v1 := b.NewValue0(v.Pos, OpARM64CSEL, y.Type) - v1.Aux = cCopToAux(OpARM64LessThanU) + v1.AuxInt = opToAuxInt(OpARM64LessThanU) v2 := b.NewValue0(v.Pos, OpZeroExt32to64, typ.UInt64) v2.AddArg(y) v3 := b.NewValue0(v.Pos, OpConst64, y.Type) @@ -24312,7 +24312,7 @@ func rewriteValueARM64_OpRsh32x64(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Rsh32x64 x y) - // result: (SRA (SignExt32to64 x) (CSEL {OpARM64LessThanU} <y.Type> y (Const64 <y.Type> [63]) (CMPconst [64] y))) + // result: (SRA (SignExt32to64 x) (CSEL [OpARM64LessThanU] <y.Type> y (Const64 <y.Type> [63]) (CMPconst [64] y))) for { x := v_0 y := v_1 @@ -24320,7 +24320,7 @@ func rewriteValueARM64_OpRsh32x64(v *Value) bool { v0 := b.NewValue0(v.Pos, OpSignExt32to64, typ.Int64) v0.AddArg(x) v1 := b.NewValue0(v.Pos, OpARM64CSEL, y.Type) - v1.Aux = cCopToAux(OpARM64LessThanU) + v1.AuxInt = opToAuxInt(OpARM64LessThanU) v2 := b.NewValue0(v.Pos, OpConst64, y.Type) v2.AuxInt = int64ToAuxInt(63) v3 := b.NewValue0(v.Pos, OpARM64CMPconst, types.TypeFlags) @@ -24337,7 +24337,7 @@ func rewriteValueARM64_OpRsh32x8(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Rsh32x8 x y) - // result: (SRA (SignExt32to64 x) (CSEL {OpARM64LessThanU} <y.Type> (ZeroExt8to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt8to64 y)))) + // result: (SRA (SignExt32to64 x) (CSEL [OpARM64LessThanU] <y.Type> (ZeroExt8to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt8to64 y)))) for { x := v_0 y := v_1 @@ -24345,7 +24345,7 @@ func rewriteValueARM64_OpRsh32x8(v *Value) bool { v0 := b.NewValue0(v.Pos, OpSignExt32to64, typ.Int64) v0.AddArg(x) v1 := b.NewValue0(v.Pos, OpARM64CSEL, y.Type) - v1.Aux = cCopToAux(OpARM64LessThanU) + v1.AuxInt = opToAuxInt(OpARM64LessThanU) v2 := b.NewValue0(v.Pos, OpZeroExt8to64, typ.UInt64) v2.AddArg(y) v3 := b.NewValue0(v.Pos, OpConst64, y.Type) @@ -24364,13 +24364,13 @@ func rewriteValueARM64_OpRsh64Ux16(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Rsh64Ux16 <t> x y) - // result: (CSEL {OpARM64LessThanU} (SRL <t> x (ZeroExt16to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt16to64 y))) + // result: (CSEL [OpARM64LessThanU] (SRL <t> x (ZeroExt16to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt16to64 y))) for { t := v.Type x := v_0 y := v_1 v.reset(OpARM64CSEL) - v.Aux = cCopToAux(OpARM64LessThanU) + v.AuxInt = opToAuxInt(OpARM64LessThanU) v0 := b.NewValue0(v.Pos, OpARM64SRL, t) v1 := b.NewValue0(v.Pos, OpZeroExt16to64, typ.UInt64) v1.AddArg(y) @@ -24390,13 +24390,13 @@ func rewriteValueARM64_OpRsh64Ux32(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Rsh64Ux32 <t> x y) - // result: (CSEL {OpARM64LessThanU} (SRL <t> x (ZeroExt32to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt32to64 y))) + // result: (CSEL [OpARM64LessThanU] (SRL <t> x (ZeroExt32to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt32to64 y))) for { t := v.Type x := v_0 y := v_1 v.reset(OpARM64CSEL) - v.Aux = cCopToAux(OpARM64LessThanU) + v.AuxInt = opToAuxInt(OpARM64LessThanU) v0 := b.NewValue0(v.Pos, OpARM64SRL, t) v1 := b.NewValue0(v.Pos, OpZeroExt32to64, typ.UInt64) v1.AddArg(y) @@ -24415,13 +24415,13 @@ func rewriteValueARM64_OpRsh64Ux64(v *Value) bool { v_0 := v.Args[0] b := v.Block // match: (Rsh64Ux64 <t> x y) - // result: (CSEL {OpARM64LessThanU} (SRL <t> x y) (Const64 <t> [0]) (CMPconst [64] y)) + // result: (CSEL [OpARM64LessThanU] (SRL <t> x y) (Const64 <t> [0]) (CMPconst [64] y)) for { t := v.Type x := v_0 y := v_1 v.reset(OpARM64CSEL) - v.Aux = cCopToAux(OpARM64LessThanU) + v.AuxInt = opToAuxInt(OpARM64LessThanU) v0 := b.NewValue0(v.Pos, OpARM64SRL, t) v0.AddArg2(x, y) v1 := b.NewValue0(v.Pos, OpConst64, t) @@ -24439,13 +24439,13 @@ func rewriteValueARM64_OpRsh64Ux8(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Rsh64Ux8 <t> x y) - // result: (CSEL {OpARM64LessThanU} (SRL <t> x (ZeroExt8to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt8to64 y))) + // result: (CSEL [OpARM64LessThanU] (SRL <t> x (ZeroExt8to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt8to64 y))) for { t := v.Type x := v_0 y := v_1 v.reset(OpARM64CSEL) - v.Aux = cCopToAux(OpARM64LessThanU) + v.AuxInt = opToAuxInt(OpARM64LessThanU) v0 := b.NewValue0(v.Pos, OpARM64SRL, t) v1 := b.NewValue0(v.Pos, OpZeroExt8to64, typ.UInt64) v1.AddArg(y) @@ -24465,13 +24465,13 @@ func rewriteValueARM64_OpRsh64x16(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Rsh64x16 x y) - // result: (SRA x (CSEL {OpARM64LessThanU} <y.Type> (ZeroExt16to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt16to64 y)))) + // result: (SRA x (CSEL [OpARM64LessThanU] <y.Type> (ZeroExt16to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt16to64 y)))) for { x := v_0 y := v_1 v.reset(OpARM64SRA) v0 := b.NewValue0(v.Pos, OpARM64CSEL, y.Type) - v0.Aux = cCopToAux(OpARM64LessThanU) + v0.AuxInt = opToAuxInt(OpARM64LessThanU) v1 := b.NewValue0(v.Pos, OpZeroExt16to64, typ.UInt64) v1.AddArg(y) v2 := b.NewValue0(v.Pos, OpConst64, y.Type) @@ -24490,13 +24490,13 @@ func rewriteValueARM64_OpRsh64x32(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Rsh64x32 x y) - // result: (SRA x (CSEL {OpARM64LessThanU} <y.Type> (ZeroExt32to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt32to64 y)))) + // result: (SRA x (CSEL [OpARM64LessThanU] <y.Type> (ZeroExt32to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt32to64 y)))) for { x := v_0 y := v_1 v.reset(OpARM64SRA) v0 := b.NewValue0(v.Pos, OpARM64CSEL, y.Type) - v0.Aux = cCopToAux(OpARM64LessThanU) + v0.AuxInt = opToAuxInt(OpARM64LessThanU) v1 := b.NewValue0(v.Pos, OpZeroExt32to64, typ.UInt64) v1.AddArg(y) v2 := b.NewValue0(v.Pos, OpConst64, y.Type) @@ -24514,13 +24514,13 @@ func rewriteValueARM64_OpRsh64x64(v *Value) bool { v_0 := v.Args[0] b := v.Block // match: (Rsh64x64 x y) - // result: (SRA x (CSEL {OpARM64LessThanU} <y.Type> y (Const64 <y.Type> [63]) (CMPconst [64] y))) + // result: (SRA x (CSEL [OpARM64LessThanU] <y.Type> y (Const64 <y.Type> [63]) (CMPconst [64] y))) for { x := v_0 y := v_1 v.reset(OpARM64SRA) v0 := b.NewValue0(v.Pos, OpARM64CSEL, y.Type) - v0.Aux = cCopToAux(OpARM64LessThanU) + v0.AuxInt = opToAuxInt(OpARM64LessThanU) v1 := b.NewValue0(v.Pos, OpConst64, y.Type) v1.AuxInt = int64ToAuxInt(63) v2 := b.NewValue0(v.Pos, OpARM64CMPconst, types.TypeFlags) @@ -24537,13 +24537,13 @@ func rewriteValueARM64_OpRsh64x8(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Rsh64x8 x y) - // result: (SRA x (CSEL {OpARM64LessThanU} <y.Type> (ZeroExt8to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt8to64 y)))) + // result: (SRA x (CSEL [OpARM64LessThanU] <y.Type> (ZeroExt8to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt8to64 y)))) for { x := v_0 y := v_1 v.reset(OpARM64SRA) v0 := b.NewValue0(v.Pos, OpARM64CSEL, y.Type) - v0.Aux = cCopToAux(OpARM64LessThanU) + v0.AuxInt = opToAuxInt(OpARM64LessThanU) v1 := b.NewValue0(v.Pos, OpZeroExt8to64, typ.UInt64) v1.AddArg(y) v2 := b.NewValue0(v.Pos, OpConst64, y.Type) @@ -24562,13 +24562,13 @@ func rewriteValueARM64_OpRsh8Ux16(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Rsh8Ux16 <t> x y) - // result: (CSEL {OpARM64LessThanU} (SRL <t> (ZeroExt8to64 x) (ZeroExt16to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt16to64 y))) + // result: (CSEL [OpARM64LessThanU] (SRL <t> (ZeroExt8to64 x) (ZeroExt16to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt16to64 y))) for { t := v.Type x := v_0 y := v_1 v.reset(OpARM64CSEL) - v.Aux = cCopToAux(OpARM64LessThanU) + v.AuxInt = opToAuxInt(OpARM64LessThanU) v0 := b.NewValue0(v.Pos, OpARM64SRL, t) v1 := b.NewValue0(v.Pos, OpZeroExt8to64, typ.UInt64) v1.AddArg(x) @@ -24590,13 +24590,13 @@ func rewriteValueARM64_OpRsh8Ux32(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Rsh8Ux32 <t> x y) - // result: (CSEL {OpARM64LessThanU} (SRL <t> (ZeroExt8to64 x) (ZeroExt32to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt32to64 y))) + // result: (CSEL [OpARM64LessThanU] (SRL <t> (ZeroExt8to64 x) (ZeroExt32to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt32to64 y))) for { t := v.Type x := v_0 y := v_1 v.reset(OpARM64CSEL) - v.Aux = cCopToAux(OpARM64LessThanU) + v.AuxInt = opToAuxInt(OpARM64LessThanU) v0 := b.NewValue0(v.Pos, OpARM64SRL, t) v1 := b.NewValue0(v.Pos, OpZeroExt8to64, typ.UInt64) v1.AddArg(x) @@ -24618,13 +24618,13 @@ func rewriteValueARM64_OpRsh8Ux64(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Rsh8Ux64 <t> x y) - // result: (CSEL {OpARM64LessThanU} (SRL <t> (ZeroExt8to64 x) y) (Const64 <t> [0]) (CMPconst [64] y)) + // result: (CSEL [OpARM64LessThanU] (SRL <t> (ZeroExt8to64 x) y) (Const64 <t> [0]) (CMPconst [64] y)) for { t := v.Type x := v_0 y := v_1 v.reset(OpARM64CSEL) - v.Aux = cCopToAux(OpARM64LessThanU) + v.AuxInt = opToAuxInt(OpARM64LessThanU) v0 := b.NewValue0(v.Pos, OpARM64SRL, t) v1 := b.NewValue0(v.Pos, OpZeroExt8to64, typ.UInt64) v1.AddArg(x) @@ -24644,13 +24644,13 @@ func rewriteValueARM64_OpRsh8Ux8(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Rsh8Ux8 <t> x y) - // result: (CSEL {OpARM64LessThanU} (SRL <t> (ZeroExt8to64 x) (ZeroExt8to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt8to64 y))) + // result: (CSEL [OpARM64LessThanU] (SRL <t> (ZeroExt8to64 x) (ZeroExt8to64 y)) (Const64 <t> [0]) (CMPconst [64] (ZeroExt8to64 y))) for { t := v.Type x := v_0 y := v_1 v.reset(OpARM64CSEL) - v.Aux = cCopToAux(OpARM64LessThanU) + v.AuxInt = opToAuxInt(OpARM64LessThanU) v0 := b.NewValue0(v.Pos, OpARM64SRL, t) v1 := b.NewValue0(v.Pos, OpZeroExt8to64, typ.UInt64) v1.AddArg(x) @@ -24672,7 +24672,7 @@ func rewriteValueARM64_OpRsh8x16(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Rsh8x16 x y) - // result: (SRA (SignExt8to64 x) (CSEL {OpARM64LessThanU} <y.Type> (ZeroExt16to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt16to64 y)))) + // result: (SRA (SignExt8to64 x) (CSEL [OpARM64LessThanU] <y.Type> (ZeroExt16to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt16to64 y)))) for { x := v_0 y := v_1 @@ -24680,7 +24680,7 @@ func rewriteValueARM64_OpRsh8x16(v *Value) bool { v0 := b.NewValue0(v.Pos, OpSignExt8to64, typ.Int64) v0.AddArg(x) v1 := b.NewValue0(v.Pos, OpARM64CSEL, y.Type) - v1.Aux = cCopToAux(OpARM64LessThanU) + v1.AuxInt = opToAuxInt(OpARM64LessThanU) v2 := b.NewValue0(v.Pos, OpZeroExt16to64, typ.UInt64) v2.AddArg(y) v3 := b.NewValue0(v.Pos, OpConst64, y.Type) @@ -24699,7 +24699,7 @@ func rewriteValueARM64_OpRsh8x32(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Rsh8x32 x y) - // result: (SRA (SignExt8to64 x) (CSEL {OpARM64LessThanU} <y.Type> (ZeroExt32to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt32to64 y)))) + // result: (SRA (SignExt8to64 x) (CSEL [OpARM64LessThanU] <y.Type> (ZeroExt32to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt32to64 y)))) for { x := v_0 y := v_1 @@ -24707,7 +24707,7 @@ func rewriteValueARM64_OpRsh8x32(v *Value) bool { v0 := b.NewValue0(v.Pos, OpSignExt8to64, typ.Int64) v0.AddArg(x) v1 := b.NewValue0(v.Pos, OpARM64CSEL, y.Type) - v1.Aux = cCopToAux(OpARM64LessThanU) + v1.AuxInt = opToAuxInt(OpARM64LessThanU) v2 := b.NewValue0(v.Pos, OpZeroExt32to64, typ.UInt64) v2.AddArg(y) v3 := b.NewValue0(v.Pos, OpConst64, y.Type) @@ -24726,7 +24726,7 @@ func rewriteValueARM64_OpRsh8x64(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Rsh8x64 x y) - // result: (SRA (SignExt8to64 x) (CSEL {OpARM64LessThanU} <y.Type> y (Const64 <y.Type> [63]) (CMPconst [64] y))) + // result: (SRA (SignExt8to64 x) (CSEL [OpARM64LessThanU] <y.Type> y (Const64 <y.Type> [63]) (CMPconst [64] y))) for { x := v_0 y := v_1 @@ -24734,7 +24734,7 @@ func rewriteValueARM64_OpRsh8x64(v *Value) bool { v0 := b.NewValue0(v.Pos, OpSignExt8to64, typ.Int64) v0.AddArg(x) v1 := b.NewValue0(v.Pos, OpARM64CSEL, y.Type) - v1.Aux = cCopToAux(OpARM64LessThanU) + v1.AuxInt = opToAuxInt(OpARM64LessThanU) v2 := b.NewValue0(v.Pos, OpConst64, y.Type) v2.AuxInt = int64ToAuxInt(63) v3 := b.NewValue0(v.Pos, OpARM64CMPconst, types.TypeFlags) @@ -24751,7 +24751,7 @@ func rewriteValueARM64_OpRsh8x8(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (Rsh8x8 x y) - // result: (SRA (SignExt8to64 x) (CSEL {OpARM64LessThanU} <y.Type> (ZeroExt8to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt8to64 y)))) + // result: (SRA (SignExt8to64 x) (CSEL [OpARM64LessThanU] <y.Type> (ZeroExt8to64 y) (Const64 <y.Type> [63]) (CMPconst [64] (ZeroExt8to64 y)))) for { x := v_0 y := v_1 @@ -24759,7 +24759,7 @@ func rewriteValueARM64_OpRsh8x8(v *Value) bool { v0 := b.NewValue0(v.Pos, OpSignExt8to64, typ.Int64) v0.AddArg(x) v1 := b.NewValue0(v.Pos, OpARM64CSEL, y.Type) - v1.Aux = cCopToAux(OpARM64LessThanU) + v1.AuxInt = opToAuxInt(OpARM64LessThanU) v2 := b.NewValue0(v.Pos, OpZeroExt8to64, typ.UInt64) v2.AddArg(y) v3 := b.NewValue0(v.Pos, OpConst64, y.Type) diff --git a/src/cmd/compile/internal/ssa/rewritePPC64.go b/src/cmd/compile/internal/ssa/rewritePPC64.go index 7704b80dc6..152cdfdf4d 100644 --- a/src/cmd/compile/internal/ssa/rewritePPC64.go +++ b/src/cmd/compile/internal/ssa/rewritePPC64.go @@ -428,8 +428,6 @@ func rewriteValuePPC64(v *Value) bool { return rewriteValuePPC64_OpPPC64ADD(v) case OpPPC64ADDconst: return rewriteValuePPC64_OpPPC64ADDconst(v) - case OpPPC64ADDconstForCarry: - return rewriteValuePPC64_OpPPC64ADDconstForCarry(v) case OpPPC64AND: return rewriteValuePPC64_OpPPC64AND(v) case OpPPC64ANDN: @@ -570,8 +568,8 @@ func rewriteValuePPC64(v *Value) bool { return rewriteValuePPC64_OpPPC64MOVWstorezero(v) case OpPPC64MTVSRD: return rewriteValuePPC64_OpPPC64MTVSRD(v) - case OpPPC64MaskIfNotCarry: - return rewriteValuePPC64_OpPPC64MaskIfNotCarry(v) + case OpPPC64NEG: + return rewriteValuePPC64_OpPPC64NEG(v) case OpPPC64NOR: return rewriteValuePPC64_OpPPC64NOR(v) case OpPPC64NotEqual: @@ -600,6 +598,8 @@ func rewriteValuePPC64(v *Value) bool { return rewriteValuePPC64_OpPPC64SRW(v) case OpPPC64SUB: return rewriteValuePPC64_OpPPC64SUB(v) + case OpPPC64SUBFCconst: + return rewriteValuePPC64_OpPPC64SUBFCconst(v) case OpPPC64XOR: return rewriteValuePPC64_OpPPC64XOR(v) case OpPPC64XORconst: @@ -1025,15 +1025,14 @@ func rewriteValuePPC64_OpBitLen32(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (BitLen32 x) - // result: (SUB (MOVDconst [32]) (CNTLZW <typ.Int> x)) + // result: (SUBFCconst [32] (CNTLZW <typ.Int> x)) for { x := v_0 - v.reset(OpPPC64SUB) - v0 := b.NewValue0(v.Pos, OpPPC64MOVDconst, typ.Int64) - v0.AuxInt = int64ToAuxInt(32) - v1 := b.NewValue0(v.Pos, OpPPC64CNTLZW, typ.Int) - v1.AddArg(x) - v.AddArg2(v0, v1) + v.reset(OpPPC64SUBFCconst) + v.AuxInt = int64ToAuxInt(32) + v0 := b.NewValue0(v.Pos, OpPPC64CNTLZW, typ.Int) + v0.AddArg(x) + v.AddArg(v0) return true } } @@ -1042,15 +1041,14 @@ func rewriteValuePPC64_OpBitLen64(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (BitLen64 x) - // result: (SUB (MOVDconst [64]) (CNTLZD <typ.Int> x)) + // result: (SUBFCconst [64] (CNTLZD <typ.Int> x)) for { x := v_0 - v.reset(OpPPC64SUB) - v0 := b.NewValue0(v.Pos, OpPPC64MOVDconst, typ.Int64) - v0.AuxInt = int64ToAuxInt(64) - v1 := b.NewValue0(v.Pos, OpPPC64CNTLZD, typ.Int) - v1.AddArg(x) - v.AddArg2(v0, v1) + v.reset(OpPPC64SUBFCconst) + v.AuxInt = int64ToAuxInt(64) + v0 := b.NewValue0(v.Pos, OpPPC64CNTLZD, typ.Int) + v0.AddArg(x) + v.AddArg(v0) return true } } @@ -3961,6 +3959,76 @@ func rewriteValuePPC64_OpPPC64ADD(v *Value) bool { } break } + // match: (ADD (SLD x (ANDconst <typ.Int64> [63] y)) (SRD x (SUBFCconst <typ.UInt> [64] (ANDconst <typ.UInt> [63] y)))) + // result: (ROTL x y) + for { + for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { + if v_0.Op != OpPPC64SLD { + continue + } + _ = v_0.Args[1] + x := v_0.Args[0] + v_0_1 := v_0.Args[1] + if v_0_1.Op != OpPPC64ANDconst || v_0_1.Type != typ.Int64 || auxIntToInt64(v_0_1.AuxInt) != 63 { + continue + } + y := v_0_1.Args[0] + if v_1.Op != OpPPC64SRD { + continue + } + _ = v_1.Args[1] + if x != v_1.Args[0] { + continue + } + v_1_1 := v_1.Args[1] + if v_1_1.Op != OpPPC64SUBFCconst || v_1_1.Type != typ.UInt || auxIntToInt64(v_1_1.AuxInt) != 64 { + continue + } + v_1_1_0 := v_1_1.Args[0] + if v_1_1_0.Op != OpPPC64ANDconst || v_1_1_0.Type != typ.UInt || auxIntToInt64(v_1_1_0.AuxInt) != 63 || y != v_1_1_0.Args[0] { + continue + } + v.reset(OpPPC64ROTL) + v.AddArg2(x, y) + return true + } + break + } + // match: (ADD (SLW x (ANDconst <typ.Int32> [31] y)) (SRW x (SUBFCconst <typ.UInt> [32] (ANDconst <typ.UInt> [31] y)))) + // result: (ROTLW x y) + for { + for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { + if v_0.Op != OpPPC64SLW { + continue + } + _ = v_0.Args[1] + x := v_0.Args[0] + v_0_1 := v_0.Args[1] + if v_0_1.Op != OpPPC64ANDconst || v_0_1.Type != typ.Int32 || auxIntToInt64(v_0_1.AuxInt) != 31 { + continue + } + y := v_0_1.Args[0] + if v_1.Op != OpPPC64SRW { + continue + } + _ = v_1.Args[1] + if x != v_1.Args[0] { + continue + } + v_1_1 := v_1.Args[1] + if v_1_1.Op != OpPPC64SUBFCconst || v_1_1.Type != typ.UInt || auxIntToInt64(v_1_1.AuxInt) != 32 { + continue + } + v_1_1_0 := v_1_1.Args[0] + if v_1_1_0.Op != OpPPC64ANDconst || v_1_1_0.Type != typ.UInt || auxIntToInt64(v_1_1_0.AuxInt) != 31 || y != v_1_1_0.Args[0] { + continue + } + v.reset(OpPPC64ROTLW) + v.AddArg2(x, y) + return true + } + break + } // match: (ADD (SLW x (ANDconst <typ.Int32> [31] y)) (SRW x (SUB <typ.UInt> (MOVDconst [32]) (ANDconst <typ.UInt> [31] y)))) // result: (ROTLW x y) for { @@ -4073,38 +4141,22 @@ func rewriteValuePPC64_OpPPC64ADDconst(v *Value) bool { v.AddArg(x) return true } - return false -} -func rewriteValuePPC64_OpPPC64ADDconstForCarry(v *Value) bool { - v_0 := v.Args[0] - // match: (ADDconstForCarry [c] (MOVDconst [d])) - // cond: c < 0 && (c < 0 || int64(c) + d >= 0) - // result: (FlagCarryClear) - for { - c := auxIntToInt16(v.AuxInt) - if v_0.Op != OpPPC64MOVDconst { - break - } - d := auxIntToInt64(v_0.AuxInt) - if !(c < 0 && (c < 0 || int64(c)+d >= 0)) { - break - } - v.reset(OpPPC64FlagCarryClear) - return true - } - // match: (ADDconstForCarry [c] (MOVDconst [d])) - // cond: c < 0 && c >= 0 && int64(c) + d < 0 - // result: (FlagCarrySet) + // match: (ADDconst [c] (SUBFCconst [d] x)) + // cond: is32Bit(c+d) + // result: (SUBFCconst [c+d] x) for { - c := auxIntToInt16(v.AuxInt) - if v_0.Op != OpPPC64MOVDconst { + c := auxIntToInt64(v.AuxInt) + if v_0.Op != OpPPC64SUBFCconst { break } d := auxIntToInt64(v_0.AuxInt) - if !(c < 0 && c >= 0 && int64(c)+d < 0) { + x := v_0.Args[0] + if !(is32Bit(c + d)) { break } - v.reset(OpPPC64FlagCarrySet) + v.reset(OpPPC64SUBFCconst) + v.AuxInt = int64ToAuxInt(c + d) + v.AddArg(x) return true } return false @@ -10374,46 +10426,40 @@ func rewriteValuePPC64_OpPPC64MTVSRD(v *Value) bool { } return false } -func rewriteValuePPC64_OpPPC64MaskIfNotCarry(v *Value) bool { +func rewriteValuePPC64_OpPPC64NEG(v *Value) bool { v_0 := v.Args[0] - // match: (MaskIfNotCarry (ADDconstForCarry [c] (ANDconst [d] _))) - // cond: c < 0 && d > 0 && int64(c) + d < 0 - // result: (MOVDconst [-1]) + // match: (NEG (ADDconst [c] x)) + // cond: is32Bit(-c) + // result: (SUBFCconst [-c] x) for { - if v_0.Op != OpPPC64ADDconstForCarry { - break - } - c := auxIntToInt16(v_0.AuxInt) - v_0_0 := v_0.Args[0] - if v_0_0.Op != OpPPC64ANDconst { + if v_0.Op != OpPPC64ADDconst { break } - d := auxIntToInt64(v_0_0.AuxInt) - if !(c < 0 && d > 0 && int64(c)+d < 0) { + c := auxIntToInt64(v_0.AuxInt) + x := v_0.Args[0] + if !(is32Bit(-c)) { break } - v.reset(OpPPC64MOVDconst) - v.AuxInt = int64ToAuxInt(-1) + v.reset(OpPPC64SUBFCconst) + v.AuxInt = int64ToAuxInt(-c) + v.AddArg(x) return true } - // match: (MaskIfNotCarry (FlagCarrySet)) - // result: (MOVDconst [0]) + // match: (NEG (SUBFCconst [c] x)) + // cond: is32Bit(-c) + // result: (ADDconst [-c] x) for { - if v_0.Op != OpPPC64FlagCarrySet { + if v_0.Op != OpPPC64SUBFCconst { break } - v.reset(OpPPC64MOVDconst) - v.AuxInt = int64ToAuxInt(0) - return true - } - // match: (MaskIfNotCarry (FlagCarryClear)) - // result: (MOVDconst [-1]) - for { - if v_0.Op != OpPPC64FlagCarryClear { + c := auxIntToInt64(v_0.AuxInt) + x := v_0.Args[0] + if !(is32Bit(-c)) { break } - v.reset(OpPPC64MOVDconst) - v.AuxInt = int64ToAuxInt(-1) + v.reset(OpPPC64ADDconst) + v.AuxInt = int64ToAuxInt(-c) + v.AddArg(x) return true } return false @@ -10592,6 +10638,76 @@ func rewriteValuePPC64_OpPPC64OR(v *Value) bool { } break } + // match: ( OR (SLD x (ANDconst <typ.Int64> [63] y)) (SRD x (SUBFCconst <typ.UInt> [64] (ANDconst <typ.UInt> [63] y)))) + // result: (ROTL x y) + for { + for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { + if v_0.Op != OpPPC64SLD { + continue + } + _ = v_0.Args[1] + x := v_0.Args[0] + v_0_1 := v_0.Args[1] + if v_0_1.Op != OpPPC64ANDconst || v_0_1.Type != typ.Int64 || auxIntToInt64(v_0_1.AuxInt) != 63 { + continue + } + y := v_0_1.Args[0] + if v_1.Op != OpPPC64SRD { + continue + } + _ = v_1.Args[1] + if x != v_1.Args[0] { + continue + } + v_1_1 := v_1.Args[1] + if v_1_1.Op != OpPPC64SUBFCconst || v_1_1.Type != typ.UInt || auxIntToInt64(v_1_1.AuxInt) != 64 { + continue + } + v_1_1_0 := v_1_1.Args[0] + if v_1_1_0.Op != OpPPC64ANDconst || v_1_1_0.Type != typ.UInt || auxIntToInt64(v_1_1_0.AuxInt) != 63 || y != v_1_1_0.Args[0] { + continue + } + v.reset(OpPPC64ROTL) + v.AddArg2(x, y) + return true + } + break + } + // match: ( OR (SLW x (ANDconst <typ.Int32> [31] y)) (SRW x (SUBFCconst <typ.UInt> [32] (ANDconst <typ.UInt> [31] y)))) + // result: (ROTLW x y) + for { + for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { + if v_0.Op != OpPPC64SLW { + continue + } + _ = v_0.Args[1] + x := v_0.Args[0] + v_0_1 := v_0.Args[1] + if v_0_1.Op != OpPPC64ANDconst || v_0_1.Type != typ.Int32 || auxIntToInt64(v_0_1.AuxInt) != 31 { + continue + } + y := v_0_1.Args[0] + if v_1.Op != OpPPC64SRW { + continue + } + _ = v_1.Args[1] + if x != v_1.Args[0] { + continue + } + v_1_1 := v_1.Args[1] + if v_1_1.Op != OpPPC64SUBFCconst || v_1_1.Type != typ.UInt || auxIntToInt64(v_1_1.AuxInt) != 32 { + continue + } + v_1_1_0 := v_1_1.Args[0] + if v_1_1_0.Op != OpPPC64ANDconst || v_1_1_0.Type != typ.UInt || auxIntToInt64(v_1_1_0.AuxInt) != 31 || y != v_1_1_0.Args[0] { + continue + } + v.reset(OpPPC64ROTLW) + v.AddArg2(x, y) + return true + } + break + } // match: ( OR (SLW x (ANDconst <typ.Int32> [31] y)) (SRW x (SUB <typ.UInt> (MOVDconst [32]) (ANDconst <typ.UInt> [31] y)))) // result: (ROTLW x y) for { @@ -12191,6 +12307,69 @@ func rewriteValuePPC64_OpPPC64SUB(v *Value) bool { v.AddArg(x) return true } + // match: (SUB (MOVDconst [c]) x) + // cond: is32Bit(c) + // result: (SUBFCconst [c] x) + for { + if v_0.Op != OpPPC64MOVDconst { + break + } + c := auxIntToInt64(v_0.AuxInt) + x := v_1 + if !(is32Bit(c)) { + break + } + v.reset(OpPPC64SUBFCconst) + v.AuxInt = int64ToAuxInt(c) + v.AddArg(x) + return true + } + return false +} +func rewriteValuePPC64_OpPPC64SUBFCconst(v *Value) bool { + v_0 := v.Args[0] + // match: (SUBFCconst [c] (NEG x)) + // result: (ADDconst [c] x) + for { + c := auxIntToInt64(v.AuxInt) + if v_0.Op != OpPPC64NEG { + break + } + x := v_0.Args[0] + v.reset(OpPPC64ADDconst) + v.AuxInt = int64ToAuxInt(c) + v.AddArg(x) + return true + } + // match: (SUBFCconst [c] (SUBFCconst [d] x)) + // cond: is32Bit(c-d) + // result: (ADDconst [c-d] x) + for { + c := auxIntToInt64(v.AuxInt) + if v_0.Op != OpPPC64SUBFCconst { + break + } + d := auxIntToInt64(v_0.AuxInt) + x := v_0.Args[0] + if !(is32Bit(c - d)) { + break + } + v.reset(OpPPC64ADDconst) + v.AuxInt = int64ToAuxInt(c - d) + v.AddArg(x) + return true + } + // match: (SUBFCconst [0] x) + // result: (NEG x) + for { + if auxIntToInt64(v.AuxInt) != 0 { + break + } + x := v_0 + v.reset(OpPPC64NEG) + v.AddArg(x) + return true + } return false } func rewriteValuePPC64_OpPPC64XOR(v *Value) bool { @@ -12286,6 +12465,76 @@ func rewriteValuePPC64_OpPPC64XOR(v *Value) bool { } break } + // match: (XOR (SLD x (ANDconst <typ.Int64> [63] y)) (SRD x (SUBFCconst <typ.UInt> [64] (ANDconst <typ.UInt> [63] y)))) + // result: (ROTL x y) + for { + for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { + if v_0.Op != OpPPC64SLD { + continue + } + _ = v_0.Args[1] + x := v_0.Args[0] + v_0_1 := v_0.Args[1] + if v_0_1.Op != OpPPC64ANDconst || v_0_1.Type != typ.Int64 || auxIntToInt64(v_0_1.AuxInt) != 63 { + continue + } + y := v_0_1.Args[0] + if v_1.Op != OpPPC64SRD { + continue + } + _ = v_1.Args[1] + if x != v_1.Args[0] { + continue + } + v_1_1 := v_1.Args[1] + if v_1_1.Op != OpPPC64SUBFCconst || v_1_1.Type != typ.UInt || auxIntToInt64(v_1_1.AuxInt) != 64 { + continue + } + v_1_1_0 := v_1_1.Args[0] + if v_1_1_0.Op != OpPPC64ANDconst || v_1_1_0.Type != typ.UInt || auxIntToInt64(v_1_1_0.AuxInt) != 63 || y != v_1_1_0.Args[0] { + continue + } + v.reset(OpPPC64ROTL) + v.AddArg2(x, y) + return true + } + break + } + // match: (XOR (SLW x (ANDconst <typ.Int32> [31] y)) (SRW x (SUBFCconst <typ.UInt> [32] (ANDconst <typ.UInt> [31] y)))) + // result: (ROTLW x y) + for { + for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { + if v_0.Op != OpPPC64SLW { + continue + } + _ = v_0.Args[1] + x := v_0.Args[0] + v_0_1 := v_0.Args[1] + if v_0_1.Op != OpPPC64ANDconst || v_0_1.Type != typ.Int32 || auxIntToInt64(v_0_1.AuxInt) != 31 { + continue + } + y := v_0_1.Args[0] + if v_1.Op != OpPPC64SRW { + continue + } + _ = v_1.Args[1] + if x != v_1.Args[0] { + continue + } + v_1_1 := v_1.Args[1] + if v_1_1.Op != OpPPC64SUBFCconst || v_1_1.Type != typ.UInt || auxIntToInt64(v_1_1.AuxInt) != 32 { + continue + } + v_1_1_0 := v_1_1.Args[0] + if v_1_1_0.Op != OpPPC64ANDconst || v_1_1_0.Type != typ.UInt || auxIntToInt64(v_1_1_0.AuxInt) != 31 || y != v_1_1_0.Args[0] { + continue + } + v.reset(OpPPC64ROTLW) + v.AddArg2(x, y) + return true + } + break + } // match: (XOR (SLW x (ANDconst <typ.Int32> [31] y)) (SRW x (SUB <typ.UInt> (MOVDconst [32]) (ANDconst <typ.UInt> [31] y)))) // result: (ROTLW x y) for { @@ -13257,6 +13506,28 @@ func rewriteValuePPC64_OpRsh32Ux64(v *Value) bool { v.AddArg2(x, v0) return true } + // match: (Rsh32Ux64 x (SUBFCconst <typ.UInt> [32] (ANDconst <typ.UInt> [31] y))) + // result: (SRW x (SUBFCconst <typ.UInt> [32] (ANDconst <typ.UInt> [31] y))) + for { + x := v_0 + if v_1.Op != OpPPC64SUBFCconst || v_1.Type != typ.UInt || auxIntToInt64(v_1.AuxInt) != 32 { + break + } + v_1_0 := v_1.Args[0] + if v_1_0.Op != OpPPC64ANDconst || v_1_0.Type != typ.UInt || auxIntToInt64(v_1_0.AuxInt) != 31 { + break + } + y := v_1_0.Args[0] + v.reset(OpPPC64SRW) + v0 := b.NewValue0(v.Pos, OpPPC64SUBFCconst, typ.UInt) + v0.AuxInt = int64ToAuxInt(32) + v1 := b.NewValue0(v.Pos, OpPPC64ANDconst, typ.UInt) + v1.AuxInt = int64ToAuxInt(31) + v1.AddArg(y) + v0.AddArg(v1) + v.AddArg2(x, v0) + return true + } // match: (Rsh32Ux64 x (SUB <typ.UInt> (MOVDconst [32]) (AND <typ.UInt> y (MOVDconst [31])))) // result: (SRW x (SUB <typ.UInt> (MOVDconst [32]) (ANDconst <typ.UInt> [31] y))) for { @@ -13294,6 +13565,37 @@ func rewriteValuePPC64_OpRsh32Ux64(v *Value) bool { } break } + // match: (Rsh32Ux64 x (SUBFCconst <typ.UInt> [32] (AND <typ.UInt> y (MOVDconst [31])))) + // result: (SRW x (SUBFCconst <typ.UInt> [32] (ANDconst <typ.UInt> [31] y))) + for { + x := v_0 + if v_1.Op != OpPPC64SUBFCconst || v_1.Type != typ.UInt || auxIntToInt64(v_1.AuxInt) != 32 { + break + } + v_1_0 := v_1.Args[0] + if v_1_0.Op != OpPPC64AND || v_1_0.Type != typ.UInt { + break + } + _ = v_1_0.Args[1] + v_1_0_0 := v_1_0.Args[0] + v_1_0_1 := v_1_0.Args[1] + for _i0 := 0; _i0 <= 1; _i0, v_1_0_0, v_1_0_1 = _i0+1, v_1_0_1, v_1_0_0 { + y := v_1_0_0 + if v_1_0_1.Op != OpPPC64MOVDconst || auxIntToInt64(v_1_0_1.AuxInt) != 31 { + continue + } + v.reset(OpPPC64SRW) + v0 := b.NewValue0(v.Pos, OpPPC64SUBFCconst, typ.UInt) + v0.AuxInt = int64ToAuxInt(32) + v1 := b.NewValue0(v.Pos, OpPPC64ANDconst, typ.UInt) + v1.AuxInt = int64ToAuxInt(31) + v1.AddArg(y) + v0.AddArg(v1) + v.AddArg2(x, v0) + return true + } + break + } // match: (Rsh32Ux64 x y) // result: (SRW x (ISEL [0] y (MOVDconst [-1]) (CMPU y (MOVDconst [32])))) for { @@ -13564,6 +13866,28 @@ func rewriteValuePPC64_OpRsh32x64(v *Value) bool { v.AddArg2(x, v0) return true } + // match: (Rsh32x64 x (SUBFCconst <typ.UInt> [32] (ANDconst <typ.UInt> [31] y))) + // result: (SRAW x (SUBFCconst <typ.UInt> [32] (ANDconst <typ.UInt> [31] y))) + for { + x := v_0 + if v_1.Op != OpPPC64SUBFCconst || v_1.Type != typ.UInt || auxIntToInt64(v_1.AuxInt) != 32 { + break + } + v_1_0 := v_1.Args[0] + if v_1_0.Op != OpPPC64ANDconst || v_1_0.Type != typ.UInt || auxIntToInt64(v_1_0.AuxInt) != 31 { + break + } + y := v_1_0.Args[0] + v.reset(OpPPC64SRAW) + v0 := b.NewValue0(v.Pos, OpPPC64SUBFCconst, typ.UInt) + v0.AuxInt = int64ToAuxInt(32) + v1 := b.NewValue0(v.Pos, OpPPC64ANDconst, typ.UInt) + v1.AuxInt = int64ToAuxInt(31) + v1.AddArg(y) + v0.AddArg(v1) + v.AddArg2(x, v0) + return true + } // match: (Rsh32x64 x (SUB <typ.UInt> (MOVDconst [32]) (AND <typ.UInt> y (MOVDconst [31])))) // result: (SRAW x (SUB <typ.UInt> (MOVDconst [32]) (ANDconst <typ.UInt> [31] y))) for { @@ -13601,6 +13925,37 @@ func rewriteValuePPC64_OpRsh32x64(v *Value) bool { } break } + // match: (Rsh32x64 x (SUBFCconst <typ.UInt> [32] (AND <typ.UInt> y (MOVDconst [31])))) + // result: (SRAW x (SUBFCconst <typ.UInt> [32] (ANDconst <typ.UInt> [31] y))) + for { + x := v_0 + if v_1.Op != OpPPC64SUBFCconst || v_1.Type != typ.UInt || auxIntToInt64(v_1.AuxInt) != 32 { + break + } + v_1_0 := v_1.Args[0] + if v_1_0.Op != OpPPC64AND || v_1_0.Type != typ.UInt { + break + } + _ = v_1_0.Args[1] + v_1_0_0 := v_1_0.Args[0] + v_1_0_1 := v_1_0.Args[1] + for _i0 := 0; _i0 <= 1; _i0, v_1_0_0, v_1_0_1 = _i0+1, v_1_0_1, v_1_0_0 { + y := v_1_0_0 + if v_1_0_1.Op != OpPPC64MOVDconst || auxIntToInt64(v_1_0_1.AuxInt) != 31 { + continue + } + v.reset(OpPPC64SRAW) + v0 := b.NewValue0(v.Pos, OpPPC64SUBFCconst, typ.UInt) + v0.AuxInt = int64ToAuxInt(32) + v1 := b.NewValue0(v.Pos, OpPPC64ANDconst, typ.UInt) + v1.AuxInt = int64ToAuxInt(31) + v1.AddArg(y) + v0.AddArg(v1) + v.AddArg2(x, v0) + return true + } + break + } // match: (Rsh32x64 x y) // result: (SRAW x (ISEL [0] y (MOVDconst [-1]) (CMPU y (MOVDconst [32])))) for { @@ -13869,6 +14224,28 @@ func rewriteValuePPC64_OpRsh64Ux64(v *Value) bool { v.AddArg2(x, v0) return true } + // match: (Rsh64Ux64 x (SUBFCconst <typ.UInt> [64] (ANDconst <typ.UInt> [63] y))) + // result: (SRD x (SUBFCconst <typ.UInt> [64] (ANDconst <typ.UInt> [63] y))) + for { + x := v_0 + if v_1.Op != OpPPC64SUBFCconst || v_1.Type != typ.UInt || auxIntToInt64(v_1.AuxInt) != 64 { + break + } + v_1_0 := v_1.Args[0] + if v_1_0.Op != OpPPC64ANDconst || v_1_0.Type != typ.UInt || auxIntToInt64(v_1_0.AuxInt) != 63 { + break + } + y := v_1_0.Args[0] + v.reset(OpPPC64SRD) + v0 := b.NewValue0(v.Pos, OpPPC64SUBFCconst, typ.UInt) + v0.AuxInt = int64ToAuxInt(64) + v1 := b.NewValue0(v.Pos, OpPPC64ANDconst, typ.UInt) + v1.AuxInt = int64ToAuxInt(63) + v1.AddArg(y) + v0.AddArg(v1) + v.AddArg2(x, v0) + return true + } // match: (Rsh64Ux64 x (SUB <typ.UInt> (MOVDconst [64]) (AND <typ.UInt> y (MOVDconst [63])))) // result: (SRD x (SUB <typ.UInt> (MOVDconst [64]) (ANDconst <typ.UInt> [63] y))) for { @@ -13906,6 +14283,37 @@ func rewriteValuePPC64_OpRsh64Ux64(v *Value) bool { } break } + // match: (Rsh64Ux64 x (SUBFCconst <typ.UInt> [64] (AND <typ.UInt> y (MOVDconst [63])))) + // result: (SRD x (SUBFCconst <typ.UInt> [64] (ANDconst <typ.UInt> [63] y))) + for { + x := v_0 + if v_1.Op != OpPPC64SUBFCconst || v_1.Type != typ.UInt || auxIntToInt64(v_1.AuxInt) != 64 { + break + } + v_1_0 := v_1.Args[0] + if v_1_0.Op != OpPPC64AND || v_1_0.Type != typ.UInt { + break + } + _ = v_1_0.Args[1] + v_1_0_0 := v_1_0.Args[0] + v_1_0_1 := v_1_0.Args[1] + for _i0 := 0; _i0 <= 1; _i0, v_1_0_0, v_1_0_1 = _i0+1, v_1_0_1, v_1_0_0 { + y := v_1_0_0 + if v_1_0_1.Op != OpPPC64MOVDconst || auxIntToInt64(v_1_0_1.AuxInt) != 63 { + continue + } + v.reset(OpPPC64SRD) + v0 := b.NewValue0(v.Pos, OpPPC64SUBFCconst, typ.UInt) + v0.AuxInt = int64ToAuxInt(64) + v1 := b.NewValue0(v.Pos, OpPPC64ANDconst, typ.UInt) + v1.AuxInt = int64ToAuxInt(63) + v1.AddArg(y) + v0.AddArg(v1) + v.AddArg2(x, v0) + return true + } + break + } // match: (Rsh64Ux64 x y) // result: (SRD x (ISEL [0] y (MOVDconst [-1]) (CMPU y (MOVDconst [64])))) for { @@ -14176,6 +14584,28 @@ func rewriteValuePPC64_OpRsh64x64(v *Value) bool { v.AddArg2(x, v0) return true } + // match: (Rsh64x64 x (SUBFCconst <typ.UInt> [64] (ANDconst <typ.UInt> [63] y))) + // result: (SRAD x (SUBFCconst <typ.UInt> [64] (ANDconst <typ.UInt> [63] y))) + for { + x := v_0 + if v_1.Op != OpPPC64SUBFCconst || v_1.Type != typ.UInt || auxIntToInt64(v_1.AuxInt) != 64 { + break + } + v_1_0 := v_1.Args[0] + if v_1_0.Op != OpPPC64ANDconst || v_1_0.Type != typ.UInt || auxIntToInt64(v_1_0.AuxInt) != 63 { + break + } + y := v_1_0.Args[0] + v.reset(OpPPC64SRAD) + v0 := b.NewValue0(v.Pos, OpPPC64SUBFCconst, typ.UInt) + v0.AuxInt = int64ToAuxInt(64) + v1 := b.NewValue0(v.Pos, OpPPC64ANDconst, typ.UInt) + v1.AuxInt = int64ToAuxInt(63) + v1.AddArg(y) + v0.AddArg(v1) + v.AddArg2(x, v0) + return true + } // match: (Rsh64x64 x (SUB <typ.UInt> (MOVDconst [64]) (AND <typ.UInt> y (MOVDconst [63])))) // result: (SRAD x (SUB <typ.UInt> (MOVDconst [64]) (ANDconst <typ.UInt> [63] y))) for { @@ -14213,6 +14643,37 @@ func rewriteValuePPC64_OpRsh64x64(v *Value) bool { } break } + // match: (Rsh64x64 x (SUBFCconst <typ.UInt> [64] (AND <typ.UInt> y (MOVDconst [63])))) + // result: (SRAD x (SUBFCconst <typ.UInt> [64] (ANDconst <typ.UInt> [63] y))) + for { + x := v_0 + if v_1.Op != OpPPC64SUBFCconst || v_1.Type != typ.UInt || auxIntToInt64(v_1.AuxInt) != 64 { + break + } + v_1_0 := v_1.Args[0] + if v_1_0.Op != OpPPC64AND || v_1_0.Type != typ.UInt { + break + } + _ = v_1_0.Args[1] + v_1_0_0 := v_1_0.Args[0] + v_1_0_1 := v_1_0.Args[1] + for _i0 := 0; _i0 <= 1; _i0, v_1_0_0, v_1_0_1 = _i0+1, v_1_0_1, v_1_0_0 { + y := v_1_0_0 + if v_1_0_1.Op != OpPPC64MOVDconst || auxIntToInt64(v_1_0_1.AuxInt) != 63 { + continue + } + v.reset(OpPPC64SRAD) + v0 := b.NewValue0(v.Pos, OpPPC64SUBFCconst, typ.UInt) + v0.AuxInt = int64ToAuxInt(64) + v1 := b.NewValue0(v.Pos, OpPPC64ANDconst, typ.UInt) + v1.AuxInt = int64ToAuxInt(63) + v1.AddArg(y) + v0.AddArg(v1) + v.AddArg2(x, v0) + return true + } + break + } // match: (Rsh64x64 x y) // result: (SRAD x (ISEL [0] y (MOVDconst [-1]) (CMPU y (MOVDconst [64])))) for { diff --git a/src/cmd/compile/internal/ssa/rewriteS390X.go b/src/cmd/compile/internal/ssa/rewriteS390X.go index 536f8db320..78a57c2388 100644 --- a/src/cmd/compile/internal/ssa/rewriteS390X.go +++ b/src/cmd/compile/internal/ssa/rewriteS390X.go @@ -3,6 +3,7 @@ package ssa +import "math" import "cmd/compile/internal/types" import "cmd/internal/obj/s390x" @@ -586,20 +587,12 @@ func rewriteValueS390X(v *Value) bool { return rewriteValueS390X_OpS390XFCMPS(v) case OpS390XFMOVDload: return rewriteValueS390X_OpS390XFMOVDload(v) - case OpS390XFMOVDloadidx: - return rewriteValueS390X_OpS390XFMOVDloadidx(v) case OpS390XFMOVDstore: return rewriteValueS390X_OpS390XFMOVDstore(v) - case OpS390XFMOVDstoreidx: - return rewriteValueS390X_OpS390XFMOVDstoreidx(v) case OpS390XFMOVSload: return rewriteValueS390X_OpS390XFMOVSload(v) - case OpS390XFMOVSloadidx: - return rewriteValueS390X_OpS390XFMOVSloadidx(v) case OpS390XFMOVSstore: return rewriteValueS390X_OpS390XFMOVSstore(v) - case OpS390XFMOVSstoreidx: - return rewriteValueS390X_OpS390XFMOVSstoreidx(v) case OpS390XFNEG: return rewriteValueS390X_OpS390XFNEG(v) case OpS390XFNEGS: @@ -622,78 +615,52 @@ func rewriteValueS390X(v *Value) bool { return rewriteValueS390X_OpS390XLoweredRound64F(v) case OpS390XMOVBZload: return rewriteValueS390X_OpS390XMOVBZload(v) - case OpS390XMOVBZloadidx: - return rewriteValueS390X_OpS390XMOVBZloadidx(v) case OpS390XMOVBZreg: return rewriteValueS390X_OpS390XMOVBZreg(v) case OpS390XMOVBload: return rewriteValueS390X_OpS390XMOVBload(v) - case OpS390XMOVBloadidx: - return rewriteValueS390X_OpS390XMOVBloadidx(v) case OpS390XMOVBreg: return rewriteValueS390X_OpS390XMOVBreg(v) case OpS390XMOVBstore: return rewriteValueS390X_OpS390XMOVBstore(v) case OpS390XMOVBstoreconst: return rewriteValueS390X_OpS390XMOVBstoreconst(v) - case OpS390XMOVBstoreidx: - return rewriteValueS390X_OpS390XMOVBstoreidx(v) case OpS390XMOVDaddridx: return rewriteValueS390X_OpS390XMOVDaddridx(v) case OpS390XMOVDload: return rewriteValueS390X_OpS390XMOVDload(v) - case OpS390XMOVDloadidx: - return rewriteValueS390X_OpS390XMOVDloadidx(v) case OpS390XMOVDstore: return rewriteValueS390X_OpS390XMOVDstore(v) case OpS390XMOVDstoreconst: return rewriteValueS390X_OpS390XMOVDstoreconst(v) - case OpS390XMOVDstoreidx: - return rewriteValueS390X_OpS390XMOVDstoreidx(v) case OpS390XMOVHBRstore: return rewriteValueS390X_OpS390XMOVHBRstore(v) - case OpS390XMOVHBRstoreidx: - return rewriteValueS390X_OpS390XMOVHBRstoreidx(v) case OpS390XMOVHZload: return rewriteValueS390X_OpS390XMOVHZload(v) - case OpS390XMOVHZloadidx: - return rewriteValueS390X_OpS390XMOVHZloadidx(v) case OpS390XMOVHZreg: return rewriteValueS390X_OpS390XMOVHZreg(v) case OpS390XMOVHload: return rewriteValueS390X_OpS390XMOVHload(v) - case OpS390XMOVHloadidx: - return rewriteValueS390X_OpS390XMOVHloadidx(v) case OpS390XMOVHreg: return rewriteValueS390X_OpS390XMOVHreg(v) case OpS390XMOVHstore: return rewriteValueS390X_OpS390XMOVHstore(v) case OpS390XMOVHstoreconst: return rewriteValueS390X_OpS390XMOVHstoreconst(v) - case OpS390XMOVHstoreidx: - return rewriteValueS390X_OpS390XMOVHstoreidx(v) case OpS390XMOVWBRstore: return rewriteValueS390X_OpS390XMOVWBRstore(v) - case OpS390XMOVWBRstoreidx: - return rewriteValueS390X_OpS390XMOVWBRstoreidx(v) case OpS390XMOVWZload: return rewriteValueS390X_OpS390XMOVWZload(v) - case OpS390XMOVWZloadidx: - return rewriteValueS390X_OpS390XMOVWZloadidx(v) case OpS390XMOVWZreg: return rewriteValueS390X_OpS390XMOVWZreg(v) case OpS390XMOVWload: return rewriteValueS390X_OpS390XMOVWload(v) - case OpS390XMOVWloadidx: - return rewriteValueS390X_OpS390XMOVWloadidx(v) case OpS390XMOVWreg: return rewriteValueS390X_OpS390XMOVWreg(v) case OpS390XMOVWstore: return rewriteValueS390X_OpS390XMOVWstore(v) case OpS390XMOVWstoreconst: return rewriteValueS390X_OpS390XMOVWstoreconst(v) - case OpS390XMOVWstoreidx: - return rewriteValueS390X_OpS390XMOVWstoreidx(v) case OpS390XMULLD: return rewriteValueS390X_OpS390XMULLD(v) case OpS390XMULLDconst: @@ -5281,19 +5248,19 @@ func rewriteValueS390X_OpS390XADD(v *Value) bool { v_0 := v.Args[0] // match: (ADD x (MOVDconst [c])) // cond: is32Bit(c) - // result: (ADDconst [c] x) + // result: (ADDconst [int32(c)] x) for { for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { x := v_0 if v_1.Op != OpS390XMOVDconst { continue } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) if !(is32Bit(c)) { continue } v.reset(OpS390XADDconst) - v.AuxInt = c + v.AuxInt = int32ToAuxInt(int32(c)) v.AddArg(x) return true } @@ -5324,7 +5291,7 @@ func rewriteValueS390X_OpS390XADD(v *Value) bool { break } // match: (ADD idx (MOVDaddr [c] {s} ptr)) - // cond: ptr.Op != OpSB && idx.Op != OpSB + // cond: ptr.Op != OpSB // result: (MOVDaddridx [c] {s} ptr idx) for { for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { @@ -5335,7 +5302,7 @@ func rewriteValueS390X_OpS390XADD(v *Value) bool { c := auxIntToInt32(v_1.AuxInt) s := auxToSym(v_1.Aux) ptr := v_1.Args[0] - if !(ptr.Op != OpSB && idx.Op != OpSB) { + if !(ptr.Op != OpSB) { continue } v.reset(OpS390XMOVDaddridx) @@ -5362,7 +5329,7 @@ func rewriteValueS390X_OpS390XADD(v *Value) bool { break } // match: (ADD <t> x g:(MOVDload [off] {sym} ptr mem)) - // cond: ptr.Op != OpSB && is20Bit(off) && canMergeLoadClobber(v, g, x) && clobber(g) + // cond: ptr.Op != OpSB && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g) // result: (ADDload <t> [off] {sym} x ptr mem) for { t := v.Type @@ -5372,17 +5339,17 @@ func rewriteValueS390X_OpS390XADD(v *Value) bool { if g.Op != OpS390XMOVDload { continue } - off := g.AuxInt - sym := g.Aux + off := auxIntToInt32(g.AuxInt) + sym := auxToSym(g.Aux) mem := g.Args[1] ptr := g.Args[0] - if !(ptr.Op != OpSB && is20Bit(off) && canMergeLoadClobber(v, g, x) && clobber(g)) { + if !(ptr.Op != OpSB && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g)) { continue } v.reset(OpS390XADDload) v.Type = t - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(x, ptr, mem) return true } @@ -5395,19 +5362,19 @@ func rewriteValueS390X_OpS390XADDC(v *Value) bool { v_0 := v.Args[0] // match: (ADDC x (MOVDconst [c])) // cond: is16Bit(c) - // result: (ADDCconst x [c]) + // result: (ADDCconst x [int16(c)]) for { for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { x := v_0 if v_1.Op != OpS390XMOVDconst { continue } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) if !(is16Bit(c)) { continue } v.reset(OpS390XADDCconst) - v.AuxInt = c + v.AuxInt = int16ToAuxInt(int16(c)) v.AddArg(x) return true } @@ -5482,16 +5449,16 @@ func rewriteValueS390X_OpS390XADDW(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (ADDW x (MOVDconst [c])) - // result: (ADDWconst [int64(int32(c))] x) + // result: (ADDWconst [int32(c)] x) for { for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { x := v_0 if v_1.Op != OpS390XMOVDconst { continue } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) v.reset(OpS390XADDWconst) - v.AuxInt = int64(int32(c)) + v.AuxInt = int32ToAuxInt(int32(c)) v.AddArg(x) return true } @@ -5537,7 +5504,7 @@ func rewriteValueS390X_OpS390XADDW(v *Value) bool { break } // match: (ADDW <t> x g:(MOVWload [off] {sym} ptr mem)) - // cond: ptr.Op != OpSB && is20Bit(off) && canMergeLoadClobber(v, g, x) && clobber(g) + // cond: ptr.Op != OpSB && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g) // result: (ADDWload <t> [off] {sym} x ptr mem) for { t := v.Type @@ -5547,24 +5514,24 @@ func rewriteValueS390X_OpS390XADDW(v *Value) bool { if g.Op != OpS390XMOVWload { continue } - off := g.AuxInt - sym := g.Aux + off := auxIntToInt32(g.AuxInt) + sym := auxToSym(g.Aux) mem := g.Args[1] ptr := g.Args[0] - if !(ptr.Op != OpSB && is20Bit(off) && canMergeLoadClobber(v, g, x) && clobber(g)) { + if !(ptr.Op != OpSB && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g)) { continue } v.reset(OpS390XADDWload) v.Type = t - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(x, ptr, mem) return true } break } // match: (ADDW <t> x g:(MOVWZload [off] {sym} ptr mem)) - // cond: ptr.Op != OpSB && is20Bit(off) && canMergeLoadClobber(v, g, x) && clobber(g) + // cond: ptr.Op != OpSB && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g) // result: (ADDWload <t> [off] {sym} x ptr mem) for { t := v.Type @@ -5574,17 +5541,17 @@ func rewriteValueS390X_OpS390XADDW(v *Value) bool { if g.Op != OpS390XMOVWZload { continue } - off := g.AuxInt - sym := g.Aux + off := auxIntToInt32(g.AuxInt) + sym := auxToSym(g.Aux) mem := g.Args[1] ptr := g.Args[0] - if !(ptr.Op != OpSB && is20Bit(off) && canMergeLoadClobber(v, g, x) && clobber(g)) { + if !(ptr.Op != OpSB && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g)) { continue } v.reset(OpS390XADDWload) v.Type = t - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(x, ptr, mem) return true } @@ -5607,28 +5574,28 @@ func rewriteValueS390X_OpS390XADDWconst(v *Value) bool { return true } // match: (ADDWconst [c] (MOVDconst [d])) - // result: (MOVDconst [int64(int32(c+d))]) + // result: (MOVDconst [int64(c)+d]) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) if v_0.Op != OpS390XMOVDconst { break } - d := v_0.AuxInt + d := auxIntToInt64(v_0.AuxInt) v.reset(OpS390XMOVDconst) - v.AuxInt = int64(int32(c + d)) + v.AuxInt = int64ToAuxInt(int64(c) + d) return true } // match: (ADDWconst [c] (ADDWconst [d] x)) - // result: (ADDWconst [int64(int32(c+d))] x) + // result: (ADDWconst [int32(c+d)] x) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) if v_0.Op != OpS390XADDWconst { break } - d := v_0.AuxInt + d := auxIntToInt32(v_0.AuxInt) x := v_0.Args[0] v.reset(OpS390XADDWconst) - v.AuxInt = int64(int32(c + d)) + v.AuxInt = int32ToAuxInt(int32(c + d)) v.AddArg(x) return true } @@ -5639,47 +5606,47 @@ func rewriteValueS390X_OpS390XADDWload(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (ADDWload [off1] {sym} x (ADDconst [off2] ptr) mem) - // cond: ptr.Op != OpSB && is20Bit(off1+off2) + // cond: ptr.Op != OpSB && is20Bit(int64(off1)+int64(off2)) // result: (ADDWload [off1+off2] {sym} x ptr mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) x := v_0 if v_1.Op != OpS390XADDconst { break } - off2 := v_1.AuxInt + off2 := auxIntToInt32(v_1.AuxInt) ptr := v_1.Args[0] mem := v_2 - if !(ptr.Op != OpSB && is20Bit(off1+off2)) { + if !(ptr.Op != OpSB && is20Bit(int64(off1)+int64(off2))) { break } v.reset(OpS390XADDWload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(x, ptr, mem) return true } // match: (ADDWload [o1] {s1} x (MOVDaddr [o2] {s2} ptr) mem) - // cond: ptr.Op != OpSB && is20Bit(o1+o2) && canMergeSym(s1, s2) - // result: (ADDWload [o1+o2] {mergeSym(s1, s2)} x ptr mem) + // cond: ptr.Op != OpSB && is20Bit(int64(o1)+int64(o2)) && canMergeSym(s1, s2) + // result: (ADDWload [o1+o2] {mergeSymTyped(s1, s2)} x ptr mem) for { - o1 := v.AuxInt - s1 := v.Aux + o1 := auxIntToInt32(v.AuxInt) + s1 := auxToSym(v.Aux) x := v_0 if v_1.Op != OpS390XMOVDaddr { break } - o2 := v_1.AuxInt - s2 := v_1.Aux + o2 := auxIntToInt32(v_1.AuxInt) + s2 := auxToSym(v_1.Aux) ptr := v_1.Args[0] mem := v_2 - if !(ptr.Op != OpSB && is20Bit(o1+o2) && canMergeSym(s1, s2)) { + if !(ptr.Op != OpSB && is20Bit(int64(o1)+int64(o2)) && canMergeSym(s1, s2)) { break } v.reset(OpS390XADDWload) - v.AuxInt = o1 + o2 - v.Aux = mergeSym(s1, s2) + v.AuxInt = int32ToAuxInt(o1 + o2) + v.Aux = symToAux(mergeSymTyped(s1, s2)) v.AddArg3(x, ptr, mem) return true } @@ -5688,63 +5655,63 @@ func rewriteValueS390X_OpS390XADDWload(v *Value) bool { func rewriteValueS390X_OpS390XADDconst(v *Value) bool { v_0 := v.Args[0] // match: (ADDconst [c] (MOVDaddr [d] {s} x:(SB))) - // cond: ((c+d)&1 == 0) && is32Bit(c+d) + // cond: ((c+d)&1 == 0) && is32Bit(int64(c)+int64(d)) // result: (MOVDaddr [c+d] {s} x) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) if v_0.Op != OpS390XMOVDaddr { break } - d := v_0.AuxInt - s := v_0.Aux + d := auxIntToInt32(v_0.AuxInt) + s := auxToSym(v_0.Aux) x := v_0.Args[0] - if x.Op != OpSB || !(((c+d)&1 == 0) && is32Bit(c+d)) { + if x.Op != OpSB || !(((c+d)&1 == 0) && is32Bit(int64(c)+int64(d))) { break } v.reset(OpS390XMOVDaddr) - v.AuxInt = c + d - v.Aux = s + v.AuxInt = int32ToAuxInt(c + d) + v.Aux = symToAux(s) v.AddArg(x) return true } // match: (ADDconst [c] (MOVDaddr [d] {s} x)) - // cond: x.Op != OpSB && is20Bit(c+d) + // cond: x.Op != OpSB && is20Bit(int64(c)+int64(d)) // result: (MOVDaddr [c+d] {s} x) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) if v_0.Op != OpS390XMOVDaddr { break } - d := v_0.AuxInt - s := v_0.Aux + d := auxIntToInt32(v_0.AuxInt) + s := auxToSym(v_0.Aux) x := v_0.Args[0] - if !(x.Op != OpSB && is20Bit(c+d)) { + if !(x.Op != OpSB && is20Bit(int64(c)+int64(d))) { break } v.reset(OpS390XMOVDaddr) - v.AuxInt = c + d - v.Aux = s + v.AuxInt = int32ToAuxInt(c + d) + v.Aux = symToAux(s) v.AddArg(x) return true } // match: (ADDconst [c] (MOVDaddridx [d] {s} x y)) - // cond: is20Bit(c+d) + // cond: is20Bit(int64(c)+int64(d)) // result: (MOVDaddridx [c+d] {s} x y) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) if v_0.Op != OpS390XMOVDaddridx { break } - d := v_0.AuxInt - s := v_0.Aux + d := auxIntToInt32(v_0.AuxInt) + s := auxToSym(v_0.Aux) y := v_0.Args[1] x := v_0.Args[0] - if !(is20Bit(c + d)) { + if !(is20Bit(int64(c) + int64(d))) { break } v.reset(OpS390XMOVDaddridx) - v.AuxInt = c + d - v.Aux = s + v.AuxInt = int32ToAuxInt(c + d) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } @@ -5759,32 +5726,32 @@ func rewriteValueS390X_OpS390XADDconst(v *Value) bool { return true } // match: (ADDconst [c] (MOVDconst [d])) - // result: (MOVDconst [c+d]) + // result: (MOVDconst [int64(c)+d]) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) if v_0.Op != OpS390XMOVDconst { break } - d := v_0.AuxInt + d := auxIntToInt64(v_0.AuxInt) v.reset(OpS390XMOVDconst) - v.AuxInt = c + d + v.AuxInt = int64ToAuxInt(int64(c) + d) return true } // match: (ADDconst [c] (ADDconst [d] x)) - // cond: is32Bit(c+d) + // cond: is32Bit(int64(c)+int64(d)) // result: (ADDconst [c+d] x) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) if v_0.Op != OpS390XADDconst { break } - d := v_0.AuxInt + d := auxIntToInt32(v_0.AuxInt) x := v_0.Args[0] - if !(is32Bit(c + d)) { + if !(is32Bit(int64(c) + int64(d))) { break } v.reset(OpS390XADDconst) - v.AuxInt = c + d + v.AuxInt = int32ToAuxInt(c + d) v.AddArg(x) return true } @@ -5819,47 +5786,47 @@ func rewriteValueS390X_OpS390XADDload(v *Value) bool { return true } // match: (ADDload [off1] {sym} x (ADDconst [off2] ptr) mem) - // cond: ptr.Op != OpSB && is20Bit(off1+off2) + // cond: ptr.Op != OpSB && is20Bit(int64(off1)+int64(off2)) // result: (ADDload [off1+off2] {sym} x ptr mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) x := v_0 if v_1.Op != OpS390XADDconst { break } - off2 := v_1.AuxInt + off2 := auxIntToInt32(v_1.AuxInt) ptr := v_1.Args[0] mem := v_2 - if !(ptr.Op != OpSB && is20Bit(off1+off2)) { + if !(ptr.Op != OpSB && is20Bit(int64(off1)+int64(off2))) { break } v.reset(OpS390XADDload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(x, ptr, mem) return true } // match: (ADDload [o1] {s1} x (MOVDaddr [o2] {s2} ptr) mem) - // cond: ptr.Op != OpSB && is20Bit(o1+o2) && canMergeSym(s1, s2) - // result: (ADDload [o1+o2] {mergeSym(s1, s2)} x ptr mem) + // cond: ptr.Op != OpSB && is20Bit(int64(o1)+int64(o2)) && canMergeSym(s1, s2) + // result: (ADDload [o1+o2] {mergeSymTyped(s1, s2)} x ptr mem) for { - o1 := v.AuxInt - s1 := v.Aux + o1 := auxIntToInt32(v.AuxInt) + s1 := auxToSym(v.Aux) x := v_0 if v_1.Op != OpS390XMOVDaddr { break } - o2 := v_1.AuxInt - s2 := v_1.Aux + o2 := auxIntToInt32(v_1.AuxInt) + s2 := auxToSym(v_1.Aux) ptr := v_1.Args[0] mem := v_2 - if !(ptr.Op != OpSB && is20Bit(o1+o2) && canMergeSym(s1, s2)) { + if !(ptr.Op != OpSB && is20Bit(int64(o1)+int64(o2)) && canMergeSym(s1, s2)) { break } v.reset(OpS390XADDload) - v.AuxInt = o1 + o2 - v.Aux = mergeSym(s1, s2) + v.AuxInt = int32ToAuxInt(o1 + o2) + v.Aux = symToAux(mergeSymTyped(s1, s2)) v.AddArg3(x, ptr, mem) return true } @@ -5892,20 +5859,20 @@ func rewriteValueS390X_OpS390XAND(v *Value) bool { } // match: (AND x (MOVDconst [c])) // cond: is32Bit(c) && c >= 0 - // result: (MOVWZreg (ANDWconst <typ.UInt32> [int64(int32(c))] x)) + // result: (MOVWZreg (ANDWconst <typ.UInt32> [int32(c)] x)) for { for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { x := v_0 if v_1.Op != OpS390XMOVDconst { continue } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) if !(is32Bit(c) && c >= 0) { continue } v.reset(OpS390XMOVWZreg) v0 := b.NewValue0(v.Pos, OpS390XANDWconst, typ.UInt32) - v0.AuxInt = int64(int32(c)) + v0.AuxInt = int32ToAuxInt(int32(c)) v0.AddArg(x) v.AddArg(v0) return true @@ -6001,7 +5968,7 @@ func rewriteValueS390X_OpS390XAND(v *Value) bool { return true } // match: (AND <t> x g:(MOVDload [off] {sym} ptr mem)) - // cond: ptr.Op != OpSB && is20Bit(off) && canMergeLoadClobber(v, g, x) && clobber(g) + // cond: ptr.Op != OpSB && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g) // result: (ANDload <t> [off] {sym} x ptr mem) for { t := v.Type @@ -6011,17 +5978,17 @@ func rewriteValueS390X_OpS390XAND(v *Value) bool { if g.Op != OpS390XMOVDload { continue } - off := g.AuxInt - sym := g.Aux + off := auxIntToInt32(g.AuxInt) + sym := auxToSym(g.Aux) mem := g.Args[1] ptr := g.Args[0] - if !(ptr.Op != OpSB && is20Bit(off) && canMergeLoadClobber(v, g, x) && clobber(g)) { + if !(ptr.Op != OpSB && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g)) { continue } v.reset(OpS390XANDload) v.Type = t - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(x, ptr, mem) return true } @@ -6033,16 +6000,16 @@ func rewriteValueS390X_OpS390XANDW(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (ANDW x (MOVDconst [c])) - // result: (ANDWconst [int64(int32(c))] x) + // result: (ANDWconst [int32(c)] x) for { for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { x := v_0 if v_1.Op != OpS390XMOVDconst { continue } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) v.reset(OpS390XANDWconst) - v.AuxInt = int64(int32(c)) + v.AuxInt = int32ToAuxInt(int32(c)) v.AddArg(x) return true } @@ -6059,7 +6026,7 @@ func rewriteValueS390X_OpS390XANDW(v *Value) bool { return true } // match: (ANDW <t> x g:(MOVWload [off] {sym} ptr mem)) - // cond: ptr.Op != OpSB && is20Bit(off) && canMergeLoadClobber(v, g, x) && clobber(g) + // cond: ptr.Op != OpSB && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g) // result: (ANDWload <t> [off] {sym} x ptr mem) for { t := v.Type @@ -6069,24 +6036,24 @@ func rewriteValueS390X_OpS390XANDW(v *Value) bool { if g.Op != OpS390XMOVWload { continue } - off := g.AuxInt - sym := g.Aux + off := auxIntToInt32(g.AuxInt) + sym := auxToSym(g.Aux) mem := g.Args[1] ptr := g.Args[0] - if !(ptr.Op != OpSB && is20Bit(off) && canMergeLoadClobber(v, g, x) && clobber(g)) { + if !(ptr.Op != OpSB && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g)) { continue } v.reset(OpS390XANDWload) v.Type = t - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(x, ptr, mem) return true } break } // match: (ANDW <t> x g:(MOVWZload [off] {sym} ptr mem)) - // cond: ptr.Op != OpSB && is20Bit(off) && canMergeLoadClobber(v, g, x) && clobber(g) + // cond: ptr.Op != OpSB && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g) // result: (ANDWload <t> [off] {sym} x ptr mem) for { t := v.Type @@ -6096,17 +6063,17 @@ func rewriteValueS390X_OpS390XANDW(v *Value) bool { if g.Op != OpS390XMOVWZload { continue } - off := g.AuxInt - sym := g.Aux + off := auxIntToInt32(g.AuxInt) + sym := auxToSym(g.Aux) mem := g.Args[1] ptr := g.Args[0] - if !(ptr.Op != OpSB && is20Bit(off) && canMergeLoadClobber(v, g, x) && clobber(g)) { + if !(ptr.Op != OpSB && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g)) { continue } v.reset(OpS390XANDWload) v.Type = t - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(x, ptr, mem) return true } @@ -6117,7 +6084,7 @@ func rewriteValueS390X_OpS390XANDW(v *Value) bool { func rewriteValueS390X_OpS390XANDWconst(v *Value) bool { v_0 := v.Args[0] // match: (ANDWconst [c] (ANDWconst [d] x)) - // result: (ANDWconst [c & d] x) + // result: (ANDWconst [c&d] x) for { c := auxIntToInt32(v.AuxInt) if v_0.Op != OpS390XANDWconst { @@ -6177,15 +6144,15 @@ func rewriteValueS390X_OpS390XANDWconst(v *Value) bool { return true } // match: (ANDWconst [c] (MOVDconst [d])) - // result: (MOVDconst [c&d]) + // result: (MOVDconst [int64(c)&d]) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) if v_0.Op != OpS390XMOVDconst { break } - d := v_0.AuxInt + d := auxIntToInt64(v_0.AuxInt) v.reset(OpS390XMOVDconst) - v.AuxInt = c & d + v.AuxInt = int64ToAuxInt(int64(c) & d) return true } return false @@ -6195,47 +6162,47 @@ func rewriteValueS390X_OpS390XANDWload(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (ANDWload [off1] {sym} x (ADDconst [off2] ptr) mem) - // cond: ptr.Op != OpSB && is20Bit(off1+off2) + // cond: ptr.Op != OpSB && is20Bit(int64(off1)+int64(off2)) // result: (ANDWload [off1+off2] {sym} x ptr mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) x := v_0 if v_1.Op != OpS390XADDconst { break } - off2 := v_1.AuxInt + off2 := auxIntToInt32(v_1.AuxInt) ptr := v_1.Args[0] mem := v_2 - if !(ptr.Op != OpSB && is20Bit(off1+off2)) { + if !(ptr.Op != OpSB && is20Bit(int64(off1)+int64(off2))) { break } v.reset(OpS390XANDWload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(x, ptr, mem) return true } // match: (ANDWload [o1] {s1} x (MOVDaddr [o2] {s2} ptr) mem) - // cond: ptr.Op != OpSB && is20Bit(o1+o2) && canMergeSym(s1, s2) - // result: (ANDWload [o1+o2] {mergeSym(s1, s2)} x ptr mem) + // cond: ptr.Op != OpSB && is20Bit(int64(o1)+int64(o2)) && canMergeSym(s1, s2) + // result: (ANDWload [o1+o2] {mergeSymTyped(s1, s2)} x ptr mem) for { - o1 := v.AuxInt - s1 := v.Aux + o1 := auxIntToInt32(v.AuxInt) + s1 := auxToSym(v.Aux) x := v_0 if v_1.Op != OpS390XMOVDaddr { break } - o2 := v_1.AuxInt - s2 := v_1.Aux + o2 := auxIntToInt32(v_1.AuxInt) + s2 := auxToSym(v_1.Aux) ptr := v_1.Args[0] mem := v_2 - if !(ptr.Op != OpSB && is20Bit(o1+o2) && canMergeSym(s1, s2)) { + if !(ptr.Op != OpSB && is20Bit(int64(o1)+int64(o2)) && canMergeSym(s1, s2)) { break } v.reset(OpS390XANDWload) - v.AuxInt = o1 + o2 - v.Aux = mergeSym(s1, s2) + v.AuxInt = int32ToAuxInt(o1 + o2) + v.Aux = symToAux(mergeSymTyped(s1, s2)) v.AddArg3(x, ptr, mem) return true } @@ -6244,7 +6211,7 @@ func rewriteValueS390X_OpS390XANDWload(v *Value) bool { func rewriteValueS390X_OpS390XANDconst(v *Value) bool { v_0 := v.Args[0] // match: (ANDconst [c] (ANDconst [d] x)) - // result: (ANDconst [c & d] x) + // result: (ANDconst [c&d] x) for { c := auxIntToInt64(v.AuxInt) if v_0.Op != OpS390XANDconst { @@ -6320,47 +6287,47 @@ func rewriteValueS390X_OpS390XANDload(v *Value) bool { return true } // match: (ANDload [off1] {sym} x (ADDconst [off2] ptr) mem) - // cond: ptr.Op != OpSB && is20Bit(off1+off2) + // cond: ptr.Op != OpSB && is20Bit(int64(off1)+int64(off2)) // result: (ANDload [off1+off2] {sym} x ptr mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) x := v_0 if v_1.Op != OpS390XADDconst { break } - off2 := v_1.AuxInt + off2 := auxIntToInt32(v_1.AuxInt) ptr := v_1.Args[0] mem := v_2 - if !(ptr.Op != OpSB && is20Bit(off1+off2)) { + if !(ptr.Op != OpSB && is20Bit(int64(off1)+int64(off2))) { break } v.reset(OpS390XANDload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(x, ptr, mem) return true } // match: (ANDload [o1] {s1} x (MOVDaddr [o2] {s2} ptr) mem) - // cond: ptr.Op != OpSB && is20Bit(o1+o2) && canMergeSym(s1, s2) - // result: (ANDload [o1+o2] {mergeSym(s1, s2)} x ptr mem) + // cond: ptr.Op != OpSB && is20Bit(int64(o1)+int64(o2)) && canMergeSym(s1, s2) + // result: (ANDload [o1+o2] {mergeSymTyped(s1, s2)} x ptr mem) for { - o1 := v.AuxInt - s1 := v.Aux + o1 := auxIntToInt32(v.AuxInt) + s1 := auxToSym(v.Aux) x := v_0 if v_1.Op != OpS390XMOVDaddr { break } - o2 := v_1.AuxInt - s2 := v_1.Aux + o2 := auxIntToInt32(v_1.AuxInt) + s2 := auxToSym(v_1.Aux) ptr := v_1.Args[0] mem := v_2 - if !(ptr.Op != OpSB && is20Bit(o1+o2) && canMergeSym(s1, s2)) { + if !(ptr.Op != OpSB && is20Bit(int64(o1)+int64(o2)) && canMergeSym(s1, s2)) { break } v.reset(OpS390XANDload) - v.AuxInt = o1 + o2 - v.Aux = mergeSym(s1, s2) + v.AuxInt = int32ToAuxInt(o1 + o2) + v.Aux = symToAux(mergeSymTyped(s1, s2)) v.AddArg3(x, ptr, mem) return true } @@ -6372,36 +6339,36 @@ func rewriteValueS390X_OpS390XCMP(v *Value) bool { b := v.Block // match: (CMP x (MOVDconst [c])) // cond: is32Bit(c) - // result: (CMPconst x [c]) + // result: (CMPconst x [int32(c)]) for { x := v_0 if v_1.Op != OpS390XMOVDconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) if !(is32Bit(c)) { break } v.reset(OpS390XCMPconst) - v.AuxInt = c + v.AuxInt = int32ToAuxInt(int32(c)) v.AddArg(x) return true } // match: (CMP (MOVDconst [c]) x) // cond: is32Bit(c) - // result: (InvertFlags (CMPconst x [c])) + // result: (InvertFlags (CMPconst x [int32(c)])) for { if v_0.Op != OpS390XMOVDconst { break } - c := v_0.AuxInt + c := auxIntToInt64(v_0.AuxInt) x := v_1 if !(is32Bit(c)) { break } v.reset(OpS390XInvertFlags) v0 := b.NewValue0(v.Pos, OpS390XCMPconst, types.TypeFlags) - v0.AuxInt = c + v0.AuxInt = int32ToAuxInt(int32(c)) v0.AddArg(x) v.AddArg(v0) return true @@ -6429,36 +6396,36 @@ func rewriteValueS390X_OpS390XCMPU(v *Value) bool { b := v.Block // match: (CMPU x (MOVDconst [c])) // cond: isU32Bit(c) - // result: (CMPUconst x [int64(int32(c))]) + // result: (CMPUconst x [int32(c)]) for { x := v_0 if v_1.Op != OpS390XMOVDconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) if !(isU32Bit(c)) { break } v.reset(OpS390XCMPUconst) - v.AuxInt = int64(int32(c)) + v.AuxInt = int32ToAuxInt(int32(c)) v.AddArg(x) return true } // match: (CMPU (MOVDconst [c]) x) // cond: isU32Bit(c) - // result: (InvertFlags (CMPUconst x [int64(int32(c))])) + // result: (InvertFlags (CMPUconst x [int32(c)])) for { if v_0.Op != OpS390XMOVDconst { break } - c := v_0.AuxInt + c := auxIntToInt64(v_0.AuxInt) x := v_1 if !(isU32Bit(c)) { break } v.reset(OpS390XInvertFlags) v0 := b.NewValue0(v.Pos, OpS390XCMPUconst, types.TypeFlags) - v0.AuxInt = int64(int32(c)) + v0.AuxInt = int32ToAuxInt(int32(c)) v0.AddArg(x) v.AddArg(v0) return true @@ -6656,29 +6623,29 @@ func rewriteValueS390X_OpS390XCMPW(v *Value) bool { v_0 := v.Args[0] b := v.Block // match: (CMPW x (MOVDconst [c])) - // result: (CMPWconst x [int64(int32(c))]) + // result: (CMPWconst x [int32(c)]) for { x := v_0 if v_1.Op != OpS390XMOVDconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) v.reset(OpS390XCMPWconst) - v.AuxInt = int64(int32(c)) + v.AuxInt = int32ToAuxInt(int32(c)) v.AddArg(x) return true } // match: (CMPW (MOVDconst [c]) x) - // result: (InvertFlags (CMPWconst x [int64(int32(c))])) + // result: (InvertFlags (CMPWconst x [int32(c)])) for { if v_0.Op != OpS390XMOVDconst { break } - c := v_0.AuxInt + c := auxIntToInt64(v_0.AuxInt) x := v_1 v.reset(OpS390XInvertFlags) v0 := b.NewValue0(v.Pos, OpS390XCMPWconst, types.TypeFlags) - v0.AuxInt = int64(int32(c)) + v0.AuxInt = int32ToAuxInt(int32(c)) v0.AddArg(x) v.AddArg(v0) return true @@ -6753,29 +6720,29 @@ func rewriteValueS390X_OpS390XCMPWU(v *Value) bool { v_0 := v.Args[0] b := v.Block // match: (CMPWU x (MOVDconst [c])) - // result: (CMPWUconst x [int64(int32(c))]) + // result: (CMPWUconst x [int32(c)]) for { x := v_0 if v_1.Op != OpS390XMOVDconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) v.reset(OpS390XCMPWUconst) - v.AuxInt = int64(int32(c)) + v.AuxInt = int32ToAuxInt(int32(c)) v.AddArg(x) return true } // match: (CMPWU (MOVDconst [c]) x) - // result: (InvertFlags (CMPWUconst x [int64(int32(c))])) + // result: (InvertFlags (CMPWUconst x [int32(c)])) for { if v_0.Op != OpS390XMOVDconst { break } - c := v_0.AuxInt + c := auxIntToInt64(v_0.AuxInt) x := v_1 v.reset(OpS390XInvertFlags) v0 := b.NewValue0(v.Pos, OpS390XCMPWUconst, types.TypeFlags) - v0.AuxInt = int64(int32(c)) + v0.AuxInt = int32ToAuxInt(int32(c)) v0.AddArg(x) v.AddArg(v0) return true @@ -7120,45 +7087,45 @@ func rewriteValueS390X_OpS390XCMPWconst(v *Value) bool { func rewriteValueS390X_OpS390XCMPconst(v *Value) bool { v_0 := v.Args[0] // match: (CMPconst (MOVDconst [x]) [y]) - // cond: x==y + // cond: x==int64(y) // result: (FlagEQ) for { - y := v.AuxInt + y := auxIntToInt32(v.AuxInt) if v_0.Op != OpS390XMOVDconst { break } - x := v_0.AuxInt - if !(x == y) { + x := auxIntToInt64(v_0.AuxInt) + if !(x == int64(y)) { break } v.reset(OpS390XFlagEQ) return true } // match: (CMPconst (MOVDconst [x]) [y]) - // cond: x<y + // cond: x<int64(y) // result: (FlagLT) for { - y := v.AuxInt + y := auxIntToInt32(v.AuxInt) if v_0.Op != OpS390XMOVDconst { break } - x := v_0.AuxInt - if !(x < y) { + x := auxIntToInt64(v_0.AuxInt) + if !(x < int64(y)) { break } v.reset(OpS390XFlagLT) return true } // match: (CMPconst (MOVDconst [x]) [y]) - // cond: x>y + // cond: x>int64(y) // result: (FlagGT) for { - y := v.AuxInt + y := auxIntToInt32(v.AuxInt) if v_0.Op != OpS390XMOVDconst { break } - x := v_0.AuxInt - if !(x > y) { + x := auxIntToInt64(v_0.AuxInt) + if !(x > int64(y)) { break } v.reset(OpS390XFlagGT) @@ -7310,15 +7277,15 @@ func rewriteValueS390X_OpS390XCPSDR(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (CPSDR y (FMOVDconst [c])) - // cond: c & -1<<63 == 0 + // cond: !math.Signbit(c) // result: (LPDFR y) for { y := v_0 if v_1.Op != OpS390XFMOVDconst { break } - c := v_1.AuxInt - if !(c&-1<<63 == 0) { + c := auxIntToFloat64(v_1.AuxInt) + if !(!math.Signbit(c)) { break } v.reset(OpS390XLPDFR) @@ -7326,15 +7293,15 @@ func rewriteValueS390X_OpS390XCPSDR(v *Value) bool { return true } // match: (CPSDR y (FMOVDconst [c])) - // cond: c & -1<<63 != 0 + // cond: math.Signbit(c) // result: (LNDFR y) for { y := v_0 if v_1.Op != OpS390XFMOVDconst { break } - c := v_1.AuxInt - if !(c&-1<<63 != 0) { + c := auxIntToFloat64(v_1.AuxInt) + if !(math.Signbit(c)) { break } v.reset(OpS390XLNDFR) @@ -7347,34 +7314,24 @@ func rewriteValueS390X_OpS390XFCMP(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] b := v.Block - // match: (FCMP x (FMOVDconst [c])) - // cond: auxTo64F(c) == 0 + // match: (FCMP x (FMOVDconst [0.0])) // result: (LTDBR x) for { x := v_0 - if v_1.Op != OpS390XFMOVDconst { - break - } - c := v_1.AuxInt - if !(auxTo64F(c) == 0) { + if v_1.Op != OpS390XFMOVDconst || auxIntToFloat64(v_1.AuxInt) != 0.0 { break } v.reset(OpS390XLTDBR) v.AddArg(x) return true } - // match: (FCMP (FMOVDconst [c]) x) - // cond: auxTo64F(c) == 0 + // match: (FCMP (FMOVDconst [0.0]) x) // result: (InvertFlags (LTDBR <v.Type> x)) for { - if v_0.Op != OpS390XFMOVDconst { + if v_0.Op != OpS390XFMOVDconst || auxIntToFloat64(v_0.AuxInt) != 0.0 { break } - c := v_0.AuxInt x := v_1 - if !(auxTo64F(c) == 0) { - break - } v.reset(OpS390XInvertFlags) v0 := b.NewValue0(v.Pos, OpS390XLTDBR, v.Type) v0.AddArg(x) @@ -7387,34 +7344,24 @@ func rewriteValueS390X_OpS390XFCMPS(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] b := v.Block - // match: (FCMPS x (FMOVSconst [c])) - // cond: auxTo32F(c) == 0 + // match: (FCMPS x (FMOVSconst [0.0])) // result: (LTEBR x) for { x := v_0 - if v_1.Op != OpS390XFMOVSconst { - break - } - c := v_1.AuxInt - if !(auxTo32F(c) == 0) { + if v_1.Op != OpS390XFMOVSconst || auxIntToFloat32(v_1.AuxInt) != 0.0 { break } v.reset(OpS390XLTEBR) v.AddArg(x) return true } - // match: (FCMPS (FMOVSconst [c]) x) - // cond: auxTo32F(c) == 0 + // match: (FCMPS (FMOVSconst [0.0]) x) // result: (InvertFlags (LTEBR <v.Type> x)) for { - if v_0.Op != OpS390XFMOVSconst { + if v_0.Op != OpS390XFMOVSconst || auxIntToFloat32(v_0.AuxInt) != 0.0 { break } - c := v_0.AuxInt x := v_1 - if !(auxTo32F(c) == 0) { - break - } v.reset(OpS390XInvertFlags) v0 := b.NewValue0(v.Pos, OpS390XLTEBR, v.Type) v0.AddArg(x) @@ -7464,148 +7411,48 @@ func rewriteValueS390X_OpS390XFMOVDload(v *Value) bool { return true } // match: (FMOVDload [off1] {sym} (ADDconst [off2] ptr) mem) - // cond: is20Bit(off1+off2) + // cond: is20Bit(int64(off1)+int64(off2)) // result: (FMOVDload [off1+off2] {sym} ptr mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpS390XADDconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) ptr := v_0.Args[0] mem := v_1 - if !(is20Bit(off1 + off2)) { + if !(is20Bit(int64(off1) + int64(off2))) { break } v.reset(OpS390XFMOVDload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg2(ptr, mem) return true } // match: (FMOVDload [off1] {sym1} (MOVDaddr [off2] {sym2} base) mem) - // cond: is32Bit(off1+off2) && canMergeSym(sym1, sym2) - // result: (FMOVDload [off1+off2] {mergeSym(sym1,sym2)} base mem) + // cond: is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) + // result: (FMOVDload [off1+off2] {mergeSymTyped(sym1,sym2)} base mem) for { - off1 := v.AuxInt - sym1 := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym1 := auxToSym(v.Aux) if v_0.Op != OpS390XMOVDaddr { break } - off2 := v_0.AuxInt - sym2 := v_0.Aux + off2 := auxIntToInt32(v_0.AuxInt) + sym2 := auxToSym(v_0.Aux) base := v_0.Args[0] mem := v_1 - if !(is32Bit(off1+off2) && canMergeSym(sym1, sym2)) { + if !(is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2)) { break } v.reset(OpS390XFMOVDload) - v.AuxInt = off1 + off2 - v.Aux = mergeSym(sym1, sym2) + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(mergeSymTyped(sym1, sym2)) v.AddArg2(base, mem) return true } - // match: (FMOVDload [off1] {sym1} (MOVDaddridx [off2] {sym2} ptr idx) mem) - // cond: is32Bit(off1+off2) && canMergeSym(sym1, sym2) - // result: (FMOVDloadidx [off1+off2] {mergeSym(sym1,sym2)} ptr idx mem) - for { - off1 := v.AuxInt - sym1 := v.Aux - if v_0.Op != OpS390XMOVDaddridx { - break - } - off2 := v_0.AuxInt - sym2 := v_0.Aux - idx := v_0.Args[1] - ptr := v_0.Args[0] - mem := v_1 - if !(is32Bit(off1+off2) && canMergeSym(sym1, sym2)) { - break - } - v.reset(OpS390XFMOVDloadidx) - v.AuxInt = off1 + off2 - v.Aux = mergeSym(sym1, sym2) - v.AddArg3(ptr, idx, mem) - return true - } - // match: (FMOVDload [off] {sym} (ADD ptr idx) mem) - // cond: ptr.Op != OpSB - // result: (FMOVDloadidx [off] {sym} ptr idx mem) - for { - off := auxIntToInt32(v.AuxInt) - sym := auxToSym(v.Aux) - if v_0.Op != OpS390XADD { - break - } - _ = v_0.Args[1] - v_0_0 := v_0.Args[0] - v_0_1 := v_0.Args[1] - for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { - ptr := v_0_0 - idx := v_0_1 - mem := v_1 - if !(ptr.Op != OpSB) { - continue - } - v.reset(OpS390XFMOVDloadidx) - v.AuxInt = int32ToAuxInt(off) - v.Aux = symToAux(sym) - v.AddArg3(ptr, idx, mem) - return true - } - break - } - return false -} -func rewriteValueS390X_OpS390XFMOVDloadidx(v *Value) bool { - v_2 := v.Args[2] - v_1 := v.Args[1] - v_0 := v.Args[0] - // match: (FMOVDloadidx [c] {sym} (ADDconst [d] ptr) idx mem) - // cond: is20Bit(c+d) - // result: (FMOVDloadidx [c+d] {sym} ptr idx mem) - for { - c := v.AuxInt - sym := v.Aux - if v_0.Op != OpS390XADDconst { - break - } - d := v_0.AuxInt - ptr := v_0.Args[0] - idx := v_1 - mem := v_2 - if !(is20Bit(c + d)) { - break - } - v.reset(OpS390XFMOVDloadidx) - v.AuxInt = c + d - v.Aux = sym - v.AddArg3(ptr, idx, mem) - return true - } - // match: (FMOVDloadidx [c] {sym} ptr (ADDconst [d] idx) mem) - // cond: is20Bit(c+d) - // result: (FMOVDloadidx [c+d] {sym} ptr idx mem) - for { - c := v.AuxInt - sym := v.Aux - ptr := v_0 - if v_1.Op != OpS390XADDconst { - break - } - d := v_1.AuxInt - idx := v_1.Args[0] - mem := v_2 - if !(is20Bit(c + d)) { - break - } - v.reset(OpS390XFMOVDloadidx) - v.AuxInt = c + d - v.Aux = sym - v.AddArg3(ptr, idx, mem) - return true - } return false } func rewriteValueS390X_OpS390XFMOVDstore(v *Value) bool { @@ -7613,155 +7460,50 @@ func rewriteValueS390X_OpS390XFMOVDstore(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (FMOVDstore [off1] {sym} (ADDconst [off2] ptr) val mem) - // cond: is20Bit(off1+off2) + // cond: is20Bit(int64(off1)+int64(off2)) // result: (FMOVDstore [off1+off2] {sym} ptr val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpS390XADDconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) ptr := v_0.Args[0] val := v_1 mem := v_2 - if !(is20Bit(off1 + off2)) { + if !(is20Bit(int64(off1) + int64(off2))) { break } v.reset(OpS390XFMOVDstore) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(ptr, val, mem) return true } // match: (FMOVDstore [off1] {sym1} (MOVDaddr [off2] {sym2} base) val mem) - // cond: is32Bit(off1+off2) && canMergeSym(sym1, sym2) - // result: (FMOVDstore [off1+off2] {mergeSym(sym1,sym2)} base val mem) + // cond: is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) + // result: (FMOVDstore [off1+off2] {mergeSymTyped(sym1,sym2)} base val mem) for { - off1 := v.AuxInt - sym1 := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym1 := auxToSym(v.Aux) if v_0.Op != OpS390XMOVDaddr { break } - off2 := v_0.AuxInt - sym2 := v_0.Aux + off2 := auxIntToInt32(v_0.AuxInt) + sym2 := auxToSym(v_0.Aux) base := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1+off2) && canMergeSym(sym1, sym2)) { + if !(is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2)) { break } v.reset(OpS390XFMOVDstore) - v.AuxInt = off1 + off2 - v.Aux = mergeSym(sym1, sym2) + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(mergeSymTyped(sym1, sym2)) v.AddArg3(base, val, mem) return true } - // match: (FMOVDstore [off1] {sym1} (MOVDaddridx [off2] {sym2} ptr idx) val mem) - // cond: is32Bit(off1+off2) && canMergeSym(sym1, sym2) - // result: (FMOVDstoreidx [off1+off2] {mergeSym(sym1,sym2)} ptr idx val mem) - for { - off1 := v.AuxInt - sym1 := v.Aux - if v_0.Op != OpS390XMOVDaddridx { - break - } - off2 := v_0.AuxInt - sym2 := v_0.Aux - idx := v_0.Args[1] - ptr := v_0.Args[0] - val := v_1 - mem := v_2 - if !(is32Bit(off1+off2) && canMergeSym(sym1, sym2)) { - break - } - v.reset(OpS390XFMOVDstoreidx) - v.AuxInt = off1 + off2 - v.Aux = mergeSym(sym1, sym2) - v.AddArg4(ptr, idx, val, mem) - return true - } - // match: (FMOVDstore [off] {sym} (ADD ptr idx) val mem) - // cond: ptr.Op != OpSB - // result: (FMOVDstoreidx [off] {sym} ptr idx val mem) - for { - off := auxIntToInt32(v.AuxInt) - sym := auxToSym(v.Aux) - if v_0.Op != OpS390XADD { - break - } - _ = v_0.Args[1] - v_0_0 := v_0.Args[0] - v_0_1 := v_0.Args[1] - for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { - ptr := v_0_0 - idx := v_0_1 - val := v_1 - mem := v_2 - if !(ptr.Op != OpSB) { - continue - } - v.reset(OpS390XFMOVDstoreidx) - v.AuxInt = int32ToAuxInt(off) - v.Aux = symToAux(sym) - v.AddArg4(ptr, idx, val, mem) - return true - } - break - } - return false -} -func rewriteValueS390X_OpS390XFMOVDstoreidx(v *Value) bool { - v_3 := v.Args[3] - v_2 := v.Args[2] - v_1 := v.Args[1] - v_0 := v.Args[0] - // match: (FMOVDstoreidx [c] {sym} (ADDconst [d] ptr) idx val mem) - // cond: is20Bit(c+d) - // result: (FMOVDstoreidx [c+d] {sym} ptr idx val mem) - for { - c := v.AuxInt - sym := v.Aux - if v_0.Op != OpS390XADDconst { - break - } - d := v_0.AuxInt - ptr := v_0.Args[0] - idx := v_1 - val := v_2 - mem := v_3 - if !(is20Bit(c + d)) { - break - } - v.reset(OpS390XFMOVDstoreidx) - v.AuxInt = c + d - v.Aux = sym - v.AddArg4(ptr, idx, val, mem) - return true - } - // match: (FMOVDstoreidx [c] {sym} ptr (ADDconst [d] idx) val mem) - // cond: is20Bit(c+d) - // result: (FMOVDstoreidx [c+d] {sym} ptr idx val mem) - for { - c := v.AuxInt - sym := v.Aux - ptr := v_0 - if v_1.Op != OpS390XADDconst { - break - } - d := v_1.AuxInt - idx := v_1.Args[0] - val := v_2 - mem := v_3 - if !(is20Bit(c + d)) { - break - } - v.reset(OpS390XFMOVDstoreidx) - v.AuxInt = c + d - v.Aux = sym - v.AddArg4(ptr, idx, val, mem) - return true - } return false } func rewriteValueS390X_OpS390XFMOVSload(v *Value) bool { @@ -7786,148 +7528,48 @@ func rewriteValueS390X_OpS390XFMOVSload(v *Value) bool { return true } // match: (FMOVSload [off1] {sym} (ADDconst [off2] ptr) mem) - // cond: is20Bit(off1+off2) + // cond: is20Bit(int64(off1)+int64(off2)) // result: (FMOVSload [off1+off2] {sym} ptr mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpS390XADDconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) ptr := v_0.Args[0] mem := v_1 - if !(is20Bit(off1 + off2)) { + if !(is20Bit(int64(off1) + int64(off2))) { break } v.reset(OpS390XFMOVSload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg2(ptr, mem) return true } // match: (FMOVSload [off1] {sym1} (MOVDaddr [off2] {sym2} base) mem) - // cond: is32Bit(off1+off2) && canMergeSym(sym1, sym2) - // result: (FMOVSload [off1+off2] {mergeSym(sym1,sym2)} base mem) + // cond: is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) + // result: (FMOVSload [off1+off2] {mergeSymTyped(sym1,sym2)} base mem) for { - off1 := v.AuxInt - sym1 := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym1 := auxToSym(v.Aux) if v_0.Op != OpS390XMOVDaddr { break } - off2 := v_0.AuxInt - sym2 := v_0.Aux + off2 := auxIntToInt32(v_0.AuxInt) + sym2 := auxToSym(v_0.Aux) base := v_0.Args[0] mem := v_1 - if !(is32Bit(off1+off2) && canMergeSym(sym1, sym2)) { + if !(is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2)) { break } v.reset(OpS390XFMOVSload) - v.AuxInt = off1 + off2 - v.Aux = mergeSym(sym1, sym2) + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(mergeSymTyped(sym1, sym2)) v.AddArg2(base, mem) return true } - // match: (FMOVSload [off1] {sym1} (MOVDaddridx [off2] {sym2} ptr idx) mem) - // cond: is32Bit(off1+off2) && canMergeSym(sym1, sym2) - // result: (FMOVSloadidx [off1+off2] {mergeSym(sym1,sym2)} ptr idx mem) - for { - off1 := v.AuxInt - sym1 := v.Aux - if v_0.Op != OpS390XMOVDaddridx { - break - } - off2 := v_0.AuxInt - sym2 := v_0.Aux - idx := v_0.Args[1] - ptr := v_0.Args[0] - mem := v_1 - if !(is32Bit(off1+off2) && canMergeSym(sym1, sym2)) { - break - } - v.reset(OpS390XFMOVSloadidx) - v.AuxInt = off1 + off2 - v.Aux = mergeSym(sym1, sym2) - v.AddArg3(ptr, idx, mem) - return true - } - // match: (FMOVSload [off] {sym} (ADD ptr idx) mem) - // cond: ptr.Op != OpSB - // result: (FMOVSloadidx [off] {sym} ptr idx mem) - for { - off := auxIntToInt32(v.AuxInt) - sym := auxToSym(v.Aux) - if v_0.Op != OpS390XADD { - break - } - _ = v_0.Args[1] - v_0_0 := v_0.Args[0] - v_0_1 := v_0.Args[1] - for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { - ptr := v_0_0 - idx := v_0_1 - mem := v_1 - if !(ptr.Op != OpSB) { - continue - } - v.reset(OpS390XFMOVSloadidx) - v.AuxInt = int32ToAuxInt(off) - v.Aux = symToAux(sym) - v.AddArg3(ptr, idx, mem) - return true - } - break - } - return false -} -func rewriteValueS390X_OpS390XFMOVSloadidx(v *Value) bool { - v_2 := v.Args[2] - v_1 := v.Args[1] - v_0 := v.Args[0] - // match: (FMOVSloadidx [c] {sym} (ADDconst [d] ptr) idx mem) - // cond: is20Bit(c+d) - // result: (FMOVSloadidx [c+d] {sym} ptr idx mem) - for { - c := v.AuxInt - sym := v.Aux - if v_0.Op != OpS390XADDconst { - break - } - d := v_0.AuxInt - ptr := v_0.Args[0] - idx := v_1 - mem := v_2 - if !(is20Bit(c + d)) { - break - } - v.reset(OpS390XFMOVSloadidx) - v.AuxInt = c + d - v.Aux = sym - v.AddArg3(ptr, idx, mem) - return true - } - // match: (FMOVSloadidx [c] {sym} ptr (ADDconst [d] idx) mem) - // cond: is20Bit(c+d) - // result: (FMOVSloadidx [c+d] {sym} ptr idx mem) - for { - c := v.AuxInt - sym := v.Aux - ptr := v_0 - if v_1.Op != OpS390XADDconst { - break - } - d := v_1.AuxInt - idx := v_1.Args[0] - mem := v_2 - if !(is20Bit(c + d)) { - break - } - v.reset(OpS390XFMOVSloadidx) - v.AuxInt = c + d - v.Aux = sym - v.AddArg3(ptr, idx, mem) - return true - } return false } func rewriteValueS390X_OpS390XFMOVSstore(v *Value) bool { @@ -7935,155 +7577,50 @@ func rewriteValueS390X_OpS390XFMOVSstore(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (FMOVSstore [off1] {sym} (ADDconst [off2] ptr) val mem) - // cond: is20Bit(off1+off2) + // cond: is20Bit(int64(off1)+int64(off2)) // result: (FMOVSstore [off1+off2] {sym} ptr val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpS390XADDconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) ptr := v_0.Args[0] val := v_1 mem := v_2 - if !(is20Bit(off1 + off2)) { + if !(is20Bit(int64(off1) + int64(off2))) { break } v.reset(OpS390XFMOVSstore) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(ptr, val, mem) return true } // match: (FMOVSstore [off1] {sym1} (MOVDaddr [off2] {sym2} base) val mem) - // cond: is32Bit(off1+off2) && canMergeSym(sym1, sym2) - // result: (FMOVSstore [off1+off2] {mergeSym(sym1,sym2)} base val mem) + // cond: is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) + // result: (FMOVSstore [off1+off2] {mergeSymTyped(sym1,sym2)} base val mem) for { - off1 := v.AuxInt - sym1 := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym1 := auxToSym(v.Aux) if v_0.Op != OpS390XMOVDaddr { break } - off2 := v_0.AuxInt - sym2 := v_0.Aux + off2 := auxIntToInt32(v_0.AuxInt) + sym2 := auxToSym(v_0.Aux) base := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1+off2) && canMergeSym(sym1, sym2)) { + if !(is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2)) { break } v.reset(OpS390XFMOVSstore) - v.AuxInt = off1 + off2 - v.Aux = mergeSym(sym1, sym2) + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(mergeSymTyped(sym1, sym2)) v.AddArg3(base, val, mem) return true } - // match: (FMOVSstore [off1] {sym1} (MOVDaddridx [off2] {sym2} ptr idx) val mem) - // cond: is32Bit(off1+off2) && canMergeSym(sym1, sym2) - // result: (FMOVSstoreidx [off1+off2] {mergeSym(sym1,sym2)} ptr idx val mem) - for { - off1 := v.AuxInt - sym1 := v.Aux - if v_0.Op != OpS390XMOVDaddridx { - break - } - off2 := v_0.AuxInt - sym2 := v_0.Aux - idx := v_0.Args[1] - ptr := v_0.Args[0] - val := v_1 - mem := v_2 - if !(is32Bit(off1+off2) && canMergeSym(sym1, sym2)) { - break - } - v.reset(OpS390XFMOVSstoreidx) - v.AuxInt = off1 + off2 - v.Aux = mergeSym(sym1, sym2) - v.AddArg4(ptr, idx, val, mem) - return true - } - // match: (FMOVSstore [off] {sym} (ADD ptr idx) val mem) - // cond: ptr.Op != OpSB - // result: (FMOVSstoreidx [off] {sym} ptr idx val mem) - for { - off := auxIntToInt32(v.AuxInt) - sym := auxToSym(v.Aux) - if v_0.Op != OpS390XADD { - break - } - _ = v_0.Args[1] - v_0_0 := v_0.Args[0] - v_0_1 := v_0.Args[1] - for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { - ptr := v_0_0 - idx := v_0_1 - val := v_1 - mem := v_2 - if !(ptr.Op != OpSB) { - continue - } - v.reset(OpS390XFMOVSstoreidx) - v.AuxInt = int32ToAuxInt(off) - v.Aux = symToAux(sym) - v.AddArg4(ptr, idx, val, mem) - return true - } - break - } - return false -} -func rewriteValueS390X_OpS390XFMOVSstoreidx(v *Value) bool { - v_3 := v.Args[3] - v_2 := v.Args[2] - v_1 := v.Args[1] - v_0 := v.Args[0] - // match: (FMOVSstoreidx [c] {sym} (ADDconst [d] ptr) idx val mem) - // cond: is20Bit(c+d) - // result: (FMOVSstoreidx [c+d] {sym} ptr idx val mem) - for { - c := v.AuxInt - sym := v.Aux - if v_0.Op != OpS390XADDconst { - break - } - d := v_0.AuxInt - ptr := v_0.Args[0] - idx := v_1 - val := v_2 - mem := v_3 - if !(is20Bit(c + d)) { - break - } - v.reset(OpS390XFMOVSstoreidx) - v.AuxInt = c + d - v.Aux = sym - v.AddArg4(ptr, idx, val, mem) - return true - } - // match: (FMOVSstoreidx [c] {sym} ptr (ADDconst [d] idx) val mem) - // cond: is20Bit(c+d) - // result: (FMOVSstoreidx [c+d] {sym} ptr idx val mem) - for { - c := v.AuxInt - sym := v.Aux - ptr := v_0 - if v_1.Op != OpS390XADDconst { - break - } - d := v_1.AuxInt - idx := v_1.Args[0] - val := v_2 - mem := v_3 - if !(is20Bit(c + d)) { - break - } - v.reset(OpS390XFMOVSstoreidx) - v.AuxInt = c + d - v.Aux = sym - v.AddArg4(ptr, idx, val, mem) - return true - } return false } func rewriteValueS390X_OpS390XFNEG(v *Value) bool { @@ -8536,154 +8073,48 @@ func rewriteValueS390X_OpS390XMOVBZload(v *Value) bool { return true } // match: (MOVBZload [off1] {sym} (ADDconst [off2] ptr) mem) - // cond: is20Bit(off1+off2) + // cond: is20Bit(int64(off1)+int64(off2)) // result: (MOVBZload [off1+off2] {sym} ptr mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpS390XADDconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) ptr := v_0.Args[0] mem := v_1 - if !(is20Bit(off1 + off2)) { + if !(is20Bit(int64(off1) + int64(off2))) { break } v.reset(OpS390XMOVBZload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg2(ptr, mem) return true } // match: (MOVBZload [off1] {sym1} (MOVDaddr [off2] {sym2} base) mem) - // cond: is32Bit(off1+off2) && canMergeSym(sym1, sym2) - // result: (MOVBZload [off1+off2] {mergeSym(sym1,sym2)} base mem) + // cond: is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) + // result: (MOVBZload [off1+off2] {mergeSymTyped(sym1,sym2)} base mem) for { - off1 := v.AuxInt - sym1 := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym1 := auxToSym(v.Aux) if v_0.Op != OpS390XMOVDaddr { break } - off2 := v_0.AuxInt - sym2 := v_0.Aux + off2 := auxIntToInt32(v_0.AuxInt) + sym2 := auxToSym(v_0.Aux) base := v_0.Args[0] mem := v_1 - if !(is32Bit(off1+off2) && canMergeSym(sym1, sym2)) { + if !(is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2)) { break } v.reset(OpS390XMOVBZload) - v.AuxInt = off1 + off2 - v.Aux = mergeSym(sym1, sym2) + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(mergeSymTyped(sym1, sym2)) v.AddArg2(base, mem) return true } - // match: (MOVBZload [off1] {sym1} (MOVDaddridx [off2] {sym2} ptr idx) mem) - // cond: is32Bit(off1+off2) && canMergeSym(sym1, sym2) - // result: (MOVBZloadidx [off1+off2] {mergeSym(sym1,sym2)} ptr idx mem) - for { - off1 := v.AuxInt - sym1 := v.Aux - if v_0.Op != OpS390XMOVDaddridx { - break - } - off2 := v_0.AuxInt - sym2 := v_0.Aux - idx := v_0.Args[1] - ptr := v_0.Args[0] - mem := v_1 - if !(is32Bit(off1+off2) && canMergeSym(sym1, sym2)) { - break - } - v.reset(OpS390XMOVBZloadidx) - v.AuxInt = off1 + off2 - v.Aux = mergeSym(sym1, sym2) - v.AddArg3(ptr, idx, mem) - return true - } - // match: (MOVBZload [off] {sym} (ADD ptr idx) mem) - // cond: ptr.Op != OpSB - // result: (MOVBZloadidx [off] {sym} ptr idx mem) - for { - off := auxIntToInt32(v.AuxInt) - sym := auxToSym(v.Aux) - if v_0.Op != OpS390XADD { - break - } - _ = v_0.Args[1] - v_0_0 := v_0.Args[0] - v_0_1 := v_0.Args[1] - for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { - ptr := v_0_0 - idx := v_0_1 - mem := v_1 - if !(ptr.Op != OpSB) { - continue - } - v.reset(OpS390XMOVBZloadidx) - v.AuxInt = int32ToAuxInt(off) - v.Aux = symToAux(sym) - v.AddArg3(ptr, idx, mem) - return true - } - break - } - return false -} -func rewriteValueS390X_OpS390XMOVBZloadidx(v *Value) bool { - v_2 := v.Args[2] - v_1 := v.Args[1] - v_0 := v.Args[0] - // match: (MOVBZloadidx [c] {sym} (ADDconst [d] ptr) idx mem) - // cond: is20Bit(c+d) - // result: (MOVBZloadidx [c+d] {sym} ptr idx mem) - for { - c := v.AuxInt - sym := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - if v_0.Op != OpS390XADDconst { - continue - } - d := v_0.AuxInt - ptr := v_0.Args[0] - idx := v_1 - mem := v_2 - if !(is20Bit(c + d)) { - continue - } - v.reset(OpS390XMOVBZloadidx) - v.AuxInt = c + d - v.Aux = sym - v.AddArg3(ptr, idx, mem) - return true - } - break - } - // match: (MOVBZloadidx [c] {sym} ptr (ADDconst [d] idx) mem) - // cond: is20Bit(c+d) - // result: (MOVBZloadidx [c+d] {sym} ptr idx mem) - for { - c := v.AuxInt - sym := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - ptr := v_0 - if v_1.Op != OpS390XADDconst { - continue - } - d := v_1.AuxInt - idx := v_1.Args[0] - mem := v_2 - if !(is20Bit(c + d)) { - continue - } - v.reset(OpS390XMOVBZloadidx) - v.AuxInt = c + d - v.Aux = sym - v.AddArg3(ptr, idx, mem) - return true - } - break - } return false } func rewriteValueS390X_OpS390XMOVBZreg(v *Value) bool { @@ -8797,17 +8228,6 @@ func rewriteValueS390X_OpS390XMOVBZreg(v *Value) bool { v.copyOf(x) return true } - // match: (MOVBZreg x:(MOVBZloadidx _ _ _)) - // cond: (!x.Type.IsSigned() || x.Type.Size() > 1) - // result: x - for { - x := v_0 - if x.Op != OpS390XMOVBZloadidx || !(!x.Type.IsSigned() || x.Type.Size() > 1) { - break - } - v.copyOf(x) - return true - } // match: (MOVBZreg <t> x:(MOVBload [o] {s} p mem)) // cond: x.Uses == 1 && clobber(x) // result: @x.Block (MOVBZload <t> [o] {s} p mem) @@ -8832,31 +8252,6 @@ func rewriteValueS390X_OpS390XMOVBZreg(v *Value) bool { v0.AddArg2(p, mem) return true } - // match: (MOVBZreg <t> x:(MOVBloadidx [o] {s} p i mem)) - // cond: x.Uses == 1 && clobber(x) - // result: @x.Block (MOVBZloadidx <t> [o] {s} p i mem) - for { - t := v.Type - x := v_0 - if x.Op != OpS390XMOVBloadidx { - break - } - o := auxIntToInt32(x.AuxInt) - s := auxToSym(x.Aux) - mem := x.Args[2] - p := x.Args[0] - i := x.Args[1] - if !(x.Uses == 1 && clobber(x)) { - break - } - b = x.Block - v0 := b.NewValue0(v.Pos, OpS390XMOVBZloadidx, t) - v.copyOf(v0) - v0.AuxInt = int32ToAuxInt(o) - v0.Aux = symToAux(s) - v0.AddArg3(p, i, mem) - return true - } // match: (MOVBZreg x:(Arg <t>)) // cond: !t.IsSigned() && t.Size() == 1 // result: x @@ -8909,16 +8304,16 @@ func rewriteValueS390X_OpS390XMOVBZreg(v *Value) bool { return true } // match: (MOVBZreg (ANDWconst [m] x)) - // result: (MOVWZreg (ANDWconst <typ.UInt32> [int64( uint8(m))] x)) + // result: (MOVWZreg (ANDWconst <typ.UInt32> [int32( uint8(m))] x)) for { if v_0.Op != OpS390XANDWconst { break } - m := v_0.AuxInt + m := auxIntToInt32(v_0.AuxInt) x := v_0.Args[0] v.reset(OpS390XMOVWZreg) v0 := b.NewValue0(v.Pos, OpS390XANDWconst, typ.UInt32) - v0.AuxInt = int64(uint8(m)) + v0.AuxInt = int32ToAuxInt(int32(uint8(m))) v0.AddArg(x) v.AddArg(v0) return true @@ -8948,154 +8343,48 @@ func rewriteValueS390X_OpS390XMOVBload(v *Value) bool { return true } // match: (MOVBload [off1] {sym} (ADDconst [off2] ptr) mem) - // cond: is20Bit(off1+off2) + // cond: is20Bit(int64(off1)+int64(off2)) // result: (MOVBload [off1+off2] {sym} ptr mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpS390XADDconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) ptr := v_0.Args[0] mem := v_1 - if !(is20Bit(off1 + off2)) { + if !(is20Bit(int64(off1) + int64(off2))) { break } v.reset(OpS390XMOVBload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg2(ptr, mem) return true } // match: (MOVBload [off1] {sym1} (MOVDaddr [off2] {sym2} base) mem) - // cond: is32Bit(off1+off2) && canMergeSym(sym1, sym2) - // result: (MOVBload [off1+off2] {mergeSym(sym1,sym2)} base mem) + // cond: is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) + // result: (MOVBload [off1+off2] {mergeSymTyped(sym1,sym2)} base mem) for { - off1 := v.AuxInt - sym1 := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym1 := auxToSym(v.Aux) if v_0.Op != OpS390XMOVDaddr { break } - off2 := v_0.AuxInt - sym2 := v_0.Aux + off2 := auxIntToInt32(v_0.AuxInt) + sym2 := auxToSym(v_0.Aux) base := v_0.Args[0] mem := v_1 - if !(is32Bit(off1+off2) && canMergeSym(sym1, sym2)) { + if !(is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2)) { break } v.reset(OpS390XMOVBload) - v.AuxInt = off1 + off2 - v.Aux = mergeSym(sym1, sym2) + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(mergeSymTyped(sym1, sym2)) v.AddArg2(base, mem) return true } - // match: (MOVBload [off1] {sym1} (MOVDaddridx [off2] {sym2} ptr idx) mem) - // cond: is32Bit(off1+off2) && canMergeSym(sym1, sym2) - // result: (MOVBloadidx [off1+off2] {mergeSym(sym1,sym2)} ptr idx mem) - for { - off1 := v.AuxInt - sym1 := v.Aux - if v_0.Op != OpS390XMOVDaddridx { - break - } - off2 := v_0.AuxInt - sym2 := v_0.Aux - idx := v_0.Args[1] - ptr := v_0.Args[0] - mem := v_1 - if !(is32Bit(off1+off2) && canMergeSym(sym1, sym2)) { - break - } - v.reset(OpS390XMOVBloadidx) - v.AuxInt = off1 + off2 - v.Aux = mergeSym(sym1, sym2) - v.AddArg3(ptr, idx, mem) - return true - } - // match: (MOVBload [off] {sym} (ADD ptr idx) mem) - // cond: ptr.Op != OpSB - // result: (MOVBloadidx [off] {sym} ptr idx mem) - for { - off := auxIntToInt32(v.AuxInt) - sym := auxToSym(v.Aux) - if v_0.Op != OpS390XADD { - break - } - _ = v_0.Args[1] - v_0_0 := v_0.Args[0] - v_0_1 := v_0.Args[1] - for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { - ptr := v_0_0 - idx := v_0_1 - mem := v_1 - if !(ptr.Op != OpSB) { - continue - } - v.reset(OpS390XMOVBloadidx) - v.AuxInt = int32ToAuxInt(off) - v.Aux = symToAux(sym) - v.AddArg3(ptr, idx, mem) - return true - } - break - } - return false -} -func rewriteValueS390X_OpS390XMOVBloadidx(v *Value) bool { - v_2 := v.Args[2] - v_1 := v.Args[1] - v_0 := v.Args[0] - // match: (MOVBloadidx [c] {sym} (ADDconst [d] ptr) idx mem) - // cond: is20Bit(c+d) - // result: (MOVBloadidx [c+d] {sym} ptr idx mem) - for { - c := v.AuxInt - sym := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - if v_0.Op != OpS390XADDconst { - continue - } - d := v_0.AuxInt - ptr := v_0.Args[0] - idx := v_1 - mem := v_2 - if !(is20Bit(c + d)) { - continue - } - v.reset(OpS390XMOVBloadidx) - v.AuxInt = c + d - v.Aux = sym - v.AddArg3(ptr, idx, mem) - return true - } - break - } - // match: (MOVBloadidx [c] {sym} ptr (ADDconst [d] idx) mem) - // cond: is20Bit(c+d) - // result: (MOVBloadidx [c+d] {sym} ptr idx mem) - for { - c := v.AuxInt - sym := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - ptr := v_0 - if v_1.Op != OpS390XADDconst { - continue - } - d := v_1.AuxInt - idx := v_1.Args[0] - mem := v_2 - if !(is20Bit(c + d)) { - continue - } - v.reset(OpS390XMOVBloadidx) - v.AuxInt = c + d - v.Aux = sym - v.AddArg3(ptr, idx, mem) - return true - } - break - } return false } func rewriteValueS390X_OpS390XMOVBreg(v *Value) bool { @@ -9209,17 +8498,6 @@ func rewriteValueS390X_OpS390XMOVBreg(v *Value) bool { v.copyOf(x) return true } - // match: (MOVBreg x:(MOVBloadidx _ _ _)) - // cond: (x.Type.IsSigned() || x.Type.Size() == 8) - // result: x - for { - x := v_0 - if x.Op != OpS390XMOVBloadidx || !(x.Type.IsSigned() || x.Type.Size() == 8) { - break - } - v.copyOf(x) - return true - } // match: (MOVBreg <t> x:(MOVBZload [o] {s} p mem)) // cond: x.Uses == 1 && clobber(x) // result: @x.Block (MOVBload <t> [o] {s} p mem) @@ -9244,31 +8522,6 @@ func rewriteValueS390X_OpS390XMOVBreg(v *Value) bool { v0.AddArg2(p, mem) return true } - // match: (MOVBreg <t> x:(MOVBZloadidx [o] {s} p i mem)) - // cond: x.Uses == 1 && clobber(x) - // result: @x.Block (MOVBloadidx <t> [o] {s} p i mem) - for { - t := v.Type - x := v_0 - if x.Op != OpS390XMOVBZloadidx { - break - } - o := auxIntToInt32(x.AuxInt) - s := auxToSym(x.Aux) - mem := x.Args[2] - p := x.Args[0] - i := x.Args[1] - if !(x.Uses == 1 && clobber(x)) { - break - } - b = x.Block - v0 := b.NewValue0(v.Pos, OpS390XMOVBloadidx, t) - v.copyOf(v0) - v0.AuxInt = int32ToAuxInt(o) - v0.Aux = symToAux(s) - v0.AddArg3(p, i, mem) - return true - } // match: (MOVBreg x:(Arg <t>)) // cond: t.IsSigned() && t.Size() == 1 // result: x @@ -9297,19 +8550,19 @@ func rewriteValueS390X_OpS390XMOVBreg(v *Value) bool { } // match: (MOVBreg (ANDWconst [m] x)) // cond: int8(m) >= 0 - // result: (MOVWZreg (ANDWconst <typ.UInt32> [int64( uint8(m))] x)) + // result: (MOVWZreg (ANDWconst <typ.UInt32> [int32( uint8(m))] x)) for { if v_0.Op != OpS390XANDWconst { break } - m := v_0.AuxInt + m := auxIntToInt32(v_0.AuxInt) x := v_0.Args[0] if !(int8(m) >= 0) { break } v.reset(OpS390XMOVWZreg) v0 := b.NewValue0(v.Pos, OpS390XANDWconst, typ.UInt32) - v0.AuxInt = int64(uint8(m)) + v0.AuxInt = int32ToAuxInt(int32(uint8(m))) v0.AddArg(x) v.AddArg(v0) return true @@ -9355,133 +8608,81 @@ func rewriteValueS390X_OpS390XMOVBstore(v *Value) bool { return true } // match: (MOVBstore [off1] {sym} (ADDconst [off2] ptr) val mem) - // cond: is20Bit(off1+off2) + // cond: is20Bit(int64(off1)+int64(off2)) // result: (MOVBstore [off1+off2] {sym} ptr val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpS390XADDconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) ptr := v_0.Args[0] val := v_1 mem := v_2 - if !(is20Bit(off1 + off2)) { + if !(is20Bit(int64(off1) + int64(off2))) { break } v.reset(OpS390XMOVBstore) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(ptr, val, mem) return true } // match: (MOVBstore [off] {sym} ptr (MOVDconst [c]) mem) - // cond: is20Bit(off) && ptr.Op != OpSB - // result: (MOVBstoreconst [makeValAndOff(int64(int8(c)),off)] {sym} ptr mem) + // cond: is20Bit(int64(off)) && ptr.Op != OpSB + // result: (MOVBstoreconst [makeValAndOff32(int32(int8(c)),off)] {sym} ptr mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpS390XMOVDconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) mem := v_2 - if !(is20Bit(off) && ptr.Op != OpSB) { + if !(is20Bit(int64(off)) && ptr.Op != OpSB) { break } v.reset(OpS390XMOVBstoreconst) - v.AuxInt = makeValAndOff(int64(int8(c)), off) - v.Aux = sym + v.AuxInt = valAndOffToAuxInt(makeValAndOff32(int32(int8(c)), off)) + v.Aux = symToAux(sym) v.AddArg2(ptr, mem) return true } // match: (MOVBstore [off1] {sym1} (MOVDaddr [off2] {sym2} base) val mem) - // cond: is32Bit(off1+off2) && canMergeSym(sym1, sym2) - // result: (MOVBstore [off1+off2] {mergeSym(sym1,sym2)} base val mem) + // cond: is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) + // result: (MOVBstore [off1+off2] {mergeSymTyped(sym1,sym2)} base val mem) for { - off1 := v.AuxInt - sym1 := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym1 := auxToSym(v.Aux) if v_0.Op != OpS390XMOVDaddr { break } - off2 := v_0.AuxInt - sym2 := v_0.Aux + off2 := auxIntToInt32(v_0.AuxInt) + sym2 := auxToSym(v_0.Aux) base := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1+off2) && canMergeSym(sym1, sym2)) { + if !(is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2)) { break } v.reset(OpS390XMOVBstore) - v.AuxInt = off1 + off2 - v.Aux = mergeSym(sym1, sym2) + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(mergeSymTyped(sym1, sym2)) v.AddArg3(base, val, mem) return true } - // match: (MOVBstore [off1] {sym1} (MOVDaddridx [off2] {sym2} ptr idx) val mem) - // cond: is32Bit(off1+off2) && canMergeSym(sym1, sym2) - // result: (MOVBstoreidx [off1+off2] {mergeSym(sym1,sym2)} ptr idx val mem) - for { - off1 := v.AuxInt - sym1 := v.Aux - if v_0.Op != OpS390XMOVDaddridx { - break - } - off2 := v_0.AuxInt - sym2 := v_0.Aux - idx := v_0.Args[1] - ptr := v_0.Args[0] - val := v_1 - mem := v_2 - if !(is32Bit(off1+off2) && canMergeSym(sym1, sym2)) { - break - } - v.reset(OpS390XMOVBstoreidx) - v.AuxInt = off1 + off2 - v.Aux = mergeSym(sym1, sym2) - v.AddArg4(ptr, idx, val, mem) - return true - } - // match: (MOVBstore [off] {sym} (ADD ptr idx) val mem) - // cond: ptr.Op != OpSB - // result: (MOVBstoreidx [off] {sym} ptr idx val mem) - for { - off := auxIntToInt32(v.AuxInt) - sym := auxToSym(v.Aux) - if v_0.Op != OpS390XADD { - break - } - _ = v_0.Args[1] - v_0_0 := v_0.Args[0] - v_0_1 := v_0.Args[1] - for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { - ptr := v_0_0 - idx := v_0_1 - val := v_1 - mem := v_2 - if !(ptr.Op != OpSB) { - continue - } - v.reset(OpS390XMOVBstoreidx) - v.AuxInt = int32ToAuxInt(off) - v.Aux = symToAux(sym) - v.AddArg4(ptr, idx, val, mem) - return true - } - break - } // match: (MOVBstore [i] {s} p w x:(MOVBstore [i-1] {s} p (SRDconst [8] w) mem)) // cond: p.Op != OpSB && x.Uses == 1 && clobber(x) // result: (MOVHstore [i-1] {s} p w mem) for { - i := v.AuxInt - s := v.Aux + i := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) p := v_0 w := v_1 x := v_2 - if x.Op != OpS390XMOVBstore || x.AuxInt != i-1 || x.Aux != s { + if x.Op != OpS390XMOVBstore || auxIntToInt32(x.AuxInt) != i-1 || auxToSym(x.Aux) != s { break } mem := x.Args[2] @@ -9489,12 +8690,12 @@ func rewriteValueS390X_OpS390XMOVBstore(v *Value) bool { break } x_1 := x.Args[1] - if x_1.Op != OpS390XSRDconst || x_1.AuxInt != 8 || w != x_1.Args[0] || !(p.Op != OpSB && x.Uses == 1 && clobber(x)) { + if x_1.Op != OpS390XSRDconst || auxIntToInt8(x_1.AuxInt) != 8 || w != x_1.Args[0] || !(p.Op != OpSB && x.Uses == 1 && clobber(x)) { break } v.reset(OpS390XMOVHstore) - v.AuxInt = i - 1 - v.Aux = s + v.AuxInt = int32ToAuxInt(i - 1) + v.Aux = symToAux(s) v.AddArg3(p, w, mem) return true } @@ -9502,17 +8703,17 @@ func rewriteValueS390X_OpS390XMOVBstore(v *Value) bool { // cond: p.Op != OpSB && x.Uses == 1 && clobber(x) // result: (MOVHstore [i-1] {s} p w0 mem) for { - i := v.AuxInt - s := v.Aux + i := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) p := v_0 w0 := v_1 if w0.Op != OpS390XSRDconst { break } - j := w0.AuxInt + j := auxIntToInt8(w0.AuxInt) w := w0.Args[0] x := v_2 - if x.Op != OpS390XMOVBstore || x.AuxInt != i-1 || x.Aux != s { + if x.Op != OpS390XMOVBstore || auxIntToInt32(x.AuxInt) != i-1 || auxToSym(x.Aux) != s { break } mem := x.Args[2] @@ -9520,12 +8721,12 @@ func rewriteValueS390X_OpS390XMOVBstore(v *Value) bool { break } x_1 := x.Args[1] - if x_1.Op != OpS390XSRDconst || x_1.AuxInt != j+8 || w != x_1.Args[0] || !(p.Op != OpSB && x.Uses == 1 && clobber(x)) { + if x_1.Op != OpS390XSRDconst || auxIntToInt8(x_1.AuxInt) != j+8 || w != x_1.Args[0] || !(p.Op != OpSB && x.Uses == 1 && clobber(x)) { break } v.reset(OpS390XMOVHstore) - v.AuxInt = i - 1 - v.Aux = s + v.AuxInt = int32ToAuxInt(i - 1) + v.Aux = symToAux(s) v.AddArg3(p, w0, mem) return true } @@ -9533,12 +8734,12 @@ func rewriteValueS390X_OpS390XMOVBstore(v *Value) bool { // cond: p.Op != OpSB && x.Uses == 1 && clobber(x) // result: (MOVHstore [i-1] {s} p w mem) for { - i := v.AuxInt - s := v.Aux + i := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) p := v_0 w := v_1 x := v_2 - if x.Op != OpS390XMOVBstore || x.AuxInt != i-1 || x.Aux != s { + if x.Op != OpS390XMOVBstore || auxIntToInt32(x.AuxInt) != i-1 || auxToSym(x.Aux) != s { break } mem := x.Args[2] @@ -9546,12 +8747,12 @@ func rewriteValueS390X_OpS390XMOVBstore(v *Value) bool { break } x_1 := x.Args[1] - if x_1.Op != OpS390XSRWconst || x_1.AuxInt != 8 || w != x_1.Args[0] || !(p.Op != OpSB && x.Uses == 1 && clobber(x)) { + if x_1.Op != OpS390XSRWconst || auxIntToInt8(x_1.AuxInt) != 8 || w != x_1.Args[0] || !(p.Op != OpSB && x.Uses == 1 && clobber(x)) { break } v.reset(OpS390XMOVHstore) - v.AuxInt = i - 1 - v.Aux = s + v.AuxInt = int32ToAuxInt(i - 1) + v.Aux = symToAux(s) v.AddArg3(p, w, mem) return true } @@ -9559,17 +8760,17 @@ func rewriteValueS390X_OpS390XMOVBstore(v *Value) bool { // cond: p.Op != OpSB && x.Uses == 1 && clobber(x) // result: (MOVHstore [i-1] {s} p w0 mem) for { - i := v.AuxInt - s := v.Aux + i := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) p := v_0 w0 := v_1 if w0.Op != OpS390XSRWconst { break } - j := w0.AuxInt + j := auxIntToInt8(w0.AuxInt) w := w0.Args[0] x := v_2 - if x.Op != OpS390XMOVBstore || x.AuxInt != i-1 || x.Aux != s { + if x.Op != OpS390XMOVBstore || auxIntToInt32(x.AuxInt) != i-1 || auxToSym(x.Aux) != s { break } mem := x.Args[2] @@ -9577,12 +8778,12 @@ func rewriteValueS390X_OpS390XMOVBstore(v *Value) bool { break } x_1 := x.Args[1] - if x_1.Op != OpS390XSRWconst || x_1.AuxInt != j+8 || w != x_1.Args[0] || !(p.Op != OpSB && x.Uses == 1 && clobber(x)) { + if x_1.Op != OpS390XSRWconst || auxIntToInt8(x_1.AuxInt) != j+8 || w != x_1.Args[0] || !(p.Op != OpSB && x.Uses == 1 && clobber(x)) { break } v.reset(OpS390XMOVHstore) - v.AuxInt = i - 1 - v.Aux = s + v.AuxInt = int32ToAuxInt(i - 1) + v.Aux = symToAux(s) v.AddArg3(p, w0, mem) return true } @@ -9590,15 +8791,15 @@ func rewriteValueS390X_OpS390XMOVBstore(v *Value) bool { // cond: p.Op != OpSB && x.Uses == 1 && clobber(x) // result: (MOVHBRstore [i-1] {s} p w mem) for { - i := v.AuxInt - s := v.Aux + i := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) p := v_0 - if v_1.Op != OpS390XSRDconst || v_1.AuxInt != 8 { + if v_1.Op != OpS390XSRDconst || auxIntToInt8(v_1.AuxInt) != 8 { break } w := v_1.Args[0] x := v_2 - if x.Op != OpS390XMOVBstore || x.AuxInt != i-1 || x.Aux != s { + if x.Op != OpS390XMOVBstore || auxIntToInt32(x.AuxInt) != i-1 || auxToSym(x.Aux) != s { break } mem := x.Args[2] @@ -9606,8 +8807,8 @@ func rewriteValueS390X_OpS390XMOVBstore(v *Value) bool { break } v.reset(OpS390XMOVHBRstore) - v.AuxInt = i - 1 - v.Aux = s + v.AuxInt = int32ToAuxInt(i - 1) + v.Aux = symToAux(s) v.AddArg3(p, w, mem) return true } @@ -9615,16 +8816,16 @@ func rewriteValueS390X_OpS390XMOVBstore(v *Value) bool { // cond: p.Op != OpSB && x.Uses == 1 && clobber(x) // result: (MOVHBRstore [i-1] {s} p w0 mem) for { - i := v.AuxInt - s := v.Aux + i := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) p := v_0 if v_1.Op != OpS390XSRDconst { break } - j := v_1.AuxInt + j := auxIntToInt8(v_1.AuxInt) w := v_1.Args[0] x := v_2 - if x.Op != OpS390XMOVBstore || x.AuxInt != i-1 || x.Aux != s { + if x.Op != OpS390XMOVBstore || auxIntToInt32(x.AuxInt) != i-1 || auxToSym(x.Aux) != s { break } mem := x.Args[2] @@ -9632,12 +8833,12 @@ func rewriteValueS390X_OpS390XMOVBstore(v *Value) bool { break } w0 := x.Args[1] - if w0.Op != OpS390XSRDconst || w0.AuxInt != j-8 || w != w0.Args[0] || !(p.Op != OpSB && x.Uses == 1 && clobber(x)) { + if w0.Op != OpS390XSRDconst || auxIntToInt8(w0.AuxInt) != j-8 || w != w0.Args[0] || !(p.Op != OpSB && x.Uses == 1 && clobber(x)) { break } v.reset(OpS390XMOVHBRstore) - v.AuxInt = i - 1 - v.Aux = s + v.AuxInt = int32ToAuxInt(i - 1) + v.Aux = symToAux(s) v.AddArg3(p, w0, mem) return true } @@ -9645,15 +8846,15 @@ func rewriteValueS390X_OpS390XMOVBstore(v *Value) bool { // cond: p.Op != OpSB && x.Uses == 1 && clobber(x) // result: (MOVHBRstore [i-1] {s} p w mem) for { - i := v.AuxInt - s := v.Aux + i := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) p := v_0 - if v_1.Op != OpS390XSRWconst || v_1.AuxInt != 8 { + if v_1.Op != OpS390XSRWconst || auxIntToInt8(v_1.AuxInt) != 8 { break } w := v_1.Args[0] x := v_2 - if x.Op != OpS390XMOVBstore || x.AuxInt != i-1 || x.Aux != s { + if x.Op != OpS390XMOVBstore || auxIntToInt32(x.AuxInt) != i-1 || auxToSym(x.Aux) != s { break } mem := x.Args[2] @@ -9661,8 +8862,8 @@ func rewriteValueS390X_OpS390XMOVBstore(v *Value) bool { break } v.reset(OpS390XMOVHBRstore) - v.AuxInt = i - 1 - v.Aux = s + v.AuxInt = int32ToAuxInt(i - 1) + v.Aux = symToAux(s) v.AddArg3(p, w, mem) return true } @@ -9670,16 +8871,16 @@ func rewriteValueS390X_OpS390XMOVBstore(v *Value) bool { // cond: p.Op != OpSB && x.Uses == 1 && clobber(x) // result: (MOVHBRstore [i-1] {s} p w0 mem) for { - i := v.AuxInt - s := v.Aux + i := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) p := v_0 if v_1.Op != OpS390XSRWconst { break } - j := v_1.AuxInt + j := auxIntToInt8(v_1.AuxInt) w := v_1.Args[0] x := v_2 - if x.Op != OpS390XMOVBstore || x.AuxInt != i-1 || x.Aux != s { + if x.Op != OpS390XMOVBstore || auxIntToInt32(x.AuxInt) != i-1 || auxToSym(x.Aux) != s { break } mem := x.Args[2] @@ -9687,12 +8888,12 @@ func rewriteValueS390X_OpS390XMOVBstore(v *Value) bool { break } w0 := x.Args[1] - if w0.Op != OpS390XSRWconst || w0.AuxInt != j-8 || w != w0.Args[0] || !(p.Op != OpSB && x.Uses == 1 && clobber(x)) { + if w0.Op != OpS390XSRWconst || auxIntToInt8(w0.AuxInt) != j-8 || w != w0.Args[0] || !(p.Op != OpSB && x.Uses == 1 && clobber(x)) { break } v.reset(OpS390XMOVHBRstore) - v.AuxInt = i - 1 - v.Aux = s + v.AuxInt = int32ToAuxInt(i - 1) + v.Aux = symToAux(s) v.AddArg3(p, w0, mem) return true } @@ -9702,508 +8903,161 @@ func rewriteValueS390X_OpS390XMOVBstoreconst(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (MOVBstoreconst [sc] {s} (ADDconst [off] ptr) mem) - // cond: is20Bit(ValAndOff(sc).Off()+off) - // result: (MOVBstoreconst [ValAndOff(sc).add(off)] {s} ptr mem) + // cond: is20Bit(sc.Off()+int64(off)) + // result: (MOVBstoreconst [sc.addOffset32(off)] {s} ptr mem) for { - sc := v.AuxInt - s := v.Aux + sc := auxIntToValAndOff(v.AuxInt) + s := auxToSym(v.Aux) if v_0.Op != OpS390XADDconst { break } - off := v_0.AuxInt + off := auxIntToInt32(v_0.AuxInt) ptr := v_0.Args[0] mem := v_1 - if !(is20Bit(ValAndOff(sc).Off() + off)) { + if !(is20Bit(sc.Off() + int64(off))) { break } v.reset(OpS390XMOVBstoreconst) - v.AuxInt = ValAndOff(sc).add(off) - v.Aux = s + v.AuxInt = valAndOffToAuxInt(sc.addOffset32(off)) + v.Aux = symToAux(s) v.AddArg2(ptr, mem) return true } // match: (MOVBstoreconst [sc] {sym1} (MOVDaddr [off] {sym2} ptr) mem) - // cond: ptr.Op != OpSB && canMergeSym(sym1, sym2) && ValAndOff(sc).canAdd(off) - // result: (MOVBstoreconst [ValAndOff(sc).add(off)] {mergeSym(sym1, sym2)} ptr mem) + // cond: ptr.Op != OpSB && canMergeSym(sym1, sym2) && sc.canAdd32(off) + // result: (MOVBstoreconst [sc.addOffset32(off)] {mergeSymTyped(sym1, sym2)} ptr mem) for { - sc := v.AuxInt - sym1 := v.Aux + sc := auxIntToValAndOff(v.AuxInt) + sym1 := auxToSym(v.Aux) if v_0.Op != OpS390XMOVDaddr { break } - off := v_0.AuxInt - sym2 := v_0.Aux + off := auxIntToInt32(v_0.AuxInt) + sym2 := auxToSym(v_0.Aux) ptr := v_0.Args[0] mem := v_1 - if !(ptr.Op != OpSB && canMergeSym(sym1, sym2) && ValAndOff(sc).canAdd(off)) { + if !(ptr.Op != OpSB && canMergeSym(sym1, sym2) && sc.canAdd32(off)) { break } v.reset(OpS390XMOVBstoreconst) - v.AuxInt = ValAndOff(sc).add(off) - v.Aux = mergeSym(sym1, sym2) + v.AuxInt = valAndOffToAuxInt(sc.addOffset32(off)) + v.Aux = symToAux(mergeSymTyped(sym1, sym2)) v.AddArg2(ptr, mem) return true } // match: (MOVBstoreconst [c] {s} p x:(MOVBstoreconst [a] {s} p mem)) - // cond: p.Op != OpSB && x.Uses == 1 && ValAndOff(a).Off() + 1 == ValAndOff(c).Off() && clobber(x) - // result: (MOVHstoreconst [makeValAndOff(ValAndOff(c).Val()&0xff | ValAndOff(a).Val()<<8, ValAndOff(a).Off())] {s} p mem) + // cond: p.Op != OpSB && x.Uses == 1 && a.Off() + 1 == c.Off() && clobber(x) + // result: (MOVHstoreconst [makeValAndOff32(c.Val32()&0xff | a.Val32()<<8, a.Off32())] {s} p mem) for { - c := v.AuxInt - s := v.Aux + c := auxIntToValAndOff(v.AuxInt) + s := auxToSym(v.Aux) p := v_0 x := v_1 if x.Op != OpS390XMOVBstoreconst { break } - a := x.AuxInt - if x.Aux != s { + a := auxIntToValAndOff(x.AuxInt) + if auxToSym(x.Aux) != s { break } mem := x.Args[1] - if p != x.Args[0] || !(p.Op != OpSB && x.Uses == 1 && ValAndOff(a).Off()+1 == ValAndOff(c).Off() && clobber(x)) { + if p != x.Args[0] || !(p.Op != OpSB && x.Uses == 1 && a.Off()+1 == c.Off() && clobber(x)) { break } v.reset(OpS390XMOVHstoreconst) - v.AuxInt = makeValAndOff(ValAndOff(c).Val()&0xff|ValAndOff(a).Val()<<8, ValAndOff(a).Off()) - v.Aux = s + v.AuxInt = valAndOffToAuxInt(makeValAndOff32(c.Val32()&0xff|a.Val32()<<8, a.Off32())) + v.Aux = symToAux(s) v.AddArg2(p, mem) return true } return false } -func rewriteValueS390X_OpS390XMOVBstoreidx(v *Value) bool { - v_3 := v.Args[3] - v_2 := v.Args[2] - v_1 := v.Args[1] - v_0 := v.Args[0] - // match: (MOVBstoreidx [c] {sym} (ADDconst [d] ptr) idx val mem) - // cond: is20Bit(c+d) - // result: (MOVBstoreidx [c+d] {sym} ptr idx val mem) - for { - c := v.AuxInt - sym := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - if v_0.Op != OpS390XADDconst { - continue - } - d := v_0.AuxInt - ptr := v_0.Args[0] - idx := v_1 - val := v_2 - mem := v_3 - if !(is20Bit(c + d)) { - continue - } - v.reset(OpS390XMOVBstoreidx) - v.AuxInt = c + d - v.Aux = sym - v.AddArg4(ptr, idx, val, mem) - return true - } - break - } - // match: (MOVBstoreidx [c] {sym} ptr (ADDconst [d] idx) val mem) - // cond: is20Bit(c+d) - // result: (MOVBstoreidx [c+d] {sym} ptr idx val mem) - for { - c := v.AuxInt - sym := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - ptr := v_0 - if v_1.Op != OpS390XADDconst { - continue - } - d := v_1.AuxInt - idx := v_1.Args[0] - val := v_2 - mem := v_3 - if !(is20Bit(c + d)) { - continue - } - v.reset(OpS390XMOVBstoreidx) - v.AuxInt = c + d - v.Aux = sym - v.AddArg4(ptr, idx, val, mem) - return true - } - break - } - // match: (MOVBstoreidx [i] {s} p idx w x:(MOVBstoreidx [i-1] {s} p idx (SRDconst [8] w) mem)) - // cond: x.Uses == 1 && clobber(x) - // result: (MOVHstoreidx [i-1] {s} p idx w mem) - for { - i := v.AuxInt - s := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - p := v_0 - idx := v_1 - w := v_2 - x := v_3 - if x.Op != OpS390XMOVBstoreidx || x.AuxInt != i-1 || x.Aux != s { - continue - } - mem := x.Args[3] - x_0 := x.Args[0] - x_1 := x.Args[1] - for _i1 := 0; _i1 <= 1; _i1, x_0, x_1 = _i1+1, x_1, x_0 { - if p != x_0 || idx != x_1 { - continue - } - x_2 := x.Args[2] - if x_2.Op != OpS390XSRDconst || x_2.AuxInt != 8 || w != x_2.Args[0] || !(x.Uses == 1 && clobber(x)) { - continue - } - v.reset(OpS390XMOVHstoreidx) - v.AuxInt = i - 1 - v.Aux = s - v.AddArg4(p, idx, w, mem) - return true - } - } - break - } - // match: (MOVBstoreidx [i] {s} p idx w0:(SRDconst [j] w) x:(MOVBstoreidx [i-1] {s} p idx (SRDconst [j+8] w) mem)) - // cond: x.Uses == 1 && clobber(x) - // result: (MOVHstoreidx [i-1] {s} p idx w0 mem) - for { - i := v.AuxInt - s := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - p := v_0 - idx := v_1 - w0 := v_2 - if w0.Op != OpS390XSRDconst { - continue - } - j := w0.AuxInt - w := w0.Args[0] - x := v_3 - if x.Op != OpS390XMOVBstoreidx || x.AuxInt != i-1 || x.Aux != s { - continue - } - mem := x.Args[3] - x_0 := x.Args[0] - x_1 := x.Args[1] - for _i1 := 0; _i1 <= 1; _i1, x_0, x_1 = _i1+1, x_1, x_0 { - if p != x_0 || idx != x_1 { - continue - } - x_2 := x.Args[2] - if x_2.Op != OpS390XSRDconst || x_2.AuxInt != j+8 || w != x_2.Args[0] || !(x.Uses == 1 && clobber(x)) { - continue - } - v.reset(OpS390XMOVHstoreidx) - v.AuxInt = i - 1 - v.Aux = s - v.AddArg4(p, idx, w0, mem) - return true - } - } - break - } - // match: (MOVBstoreidx [i] {s} p idx w x:(MOVBstoreidx [i-1] {s} p idx (SRWconst [8] w) mem)) - // cond: x.Uses == 1 && clobber(x) - // result: (MOVHstoreidx [i-1] {s} p idx w mem) - for { - i := v.AuxInt - s := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - p := v_0 - idx := v_1 - w := v_2 - x := v_3 - if x.Op != OpS390XMOVBstoreidx || x.AuxInt != i-1 || x.Aux != s { - continue - } - mem := x.Args[3] - x_0 := x.Args[0] - x_1 := x.Args[1] - for _i1 := 0; _i1 <= 1; _i1, x_0, x_1 = _i1+1, x_1, x_0 { - if p != x_0 || idx != x_1 { - continue - } - x_2 := x.Args[2] - if x_2.Op != OpS390XSRWconst || x_2.AuxInt != 8 || w != x_2.Args[0] || !(x.Uses == 1 && clobber(x)) { - continue - } - v.reset(OpS390XMOVHstoreidx) - v.AuxInt = i - 1 - v.Aux = s - v.AddArg4(p, idx, w, mem) - return true - } - } - break - } - // match: (MOVBstoreidx [i] {s} p idx w0:(SRWconst [j] w) x:(MOVBstoreidx [i-1] {s} p idx (SRWconst [j+8] w) mem)) - // cond: x.Uses == 1 && clobber(x) - // result: (MOVHstoreidx [i-1] {s} p idx w0 mem) - for { - i := v.AuxInt - s := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - p := v_0 - idx := v_1 - w0 := v_2 - if w0.Op != OpS390XSRWconst { - continue - } - j := w0.AuxInt - w := w0.Args[0] - x := v_3 - if x.Op != OpS390XMOVBstoreidx || x.AuxInt != i-1 || x.Aux != s { - continue - } - mem := x.Args[3] - x_0 := x.Args[0] - x_1 := x.Args[1] - for _i1 := 0; _i1 <= 1; _i1, x_0, x_1 = _i1+1, x_1, x_0 { - if p != x_0 || idx != x_1 { - continue - } - x_2 := x.Args[2] - if x_2.Op != OpS390XSRWconst || x_2.AuxInt != j+8 || w != x_2.Args[0] || !(x.Uses == 1 && clobber(x)) { - continue - } - v.reset(OpS390XMOVHstoreidx) - v.AuxInt = i - 1 - v.Aux = s - v.AddArg4(p, idx, w0, mem) - return true - } - } - break - } - // match: (MOVBstoreidx [i] {s} p idx (SRDconst [8] w) x:(MOVBstoreidx [i-1] {s} p idx w mem)) - // cond: x.Uses == 1 && clobber(x) - // result: (MOVHBRstoreidx [i-1] {s} p idx w mem) - for { - i := v.AuxInt - s := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - p := v_0 - idx := v_1 - if v_2.Op != OpS390XSRDconst || v_2.AuxInt != 8 { - continue - } - w := v_2.Args[0] - x := v_3 - if x.Op != OpS390XMOVBstoreidx || x.AuxInt != i-1 || x.Aux != s { - continue - } - mem := x.Args[3] - x_0 := x.Args[0] - x_1 := x.Args[1] - for _i1 := 0; _i1 <= 1; _i1, x_0, x_1 = _i1+1, x_1, x_0 { - if p != x_0 || idx != x_1 || w != x.Args[2] || !(x.Uses == 1 && clobber(x)) { - continue - } - v.reset(OpS390XMOVHBRstoreidx) - v.AuxInt = i - 1 - v.Aux = s - v.AddArg4(p, idx, w, mem) - return true - } - } - break - } - // match: (MOVBstoreidx [i] {s} p idx (SRDconst [j] w) x:(MOVBstoreidx [i-1] {s} p idx w0:(SRDconst [j-8] w) mem)) - // cond: x.Uses == 1 && clobber(x) - // result: (MOVHBRstoreidx [i-1] {s} p idx w0 mem) - for { - i := v.AuxInt - s := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - p := v_0 - idx := v_1 - if v_2.Op != OpS390XSRDconst { - continue - } - j := v_2.AuxInt - w := v_2.Args[0] - x := v_3 - if x.Op != OpS390XMOVBstoreidx || x.AuxInt != i-1 || x.Aux != s { - continue - } - mem := x.Args[3] - x_0 := x.Args[0] - x_1 := x.Args[1] - for _i1 := 0; _i1 <= 1; _i1, x_0, x_1 = _i1+1, x_1, x_0 { - if p != x_0 || idx != x_1 { - continue - } - w0 := x.Args[2] - if w0.Op != OpS390XSRDconst || w0.AuxInt != j-8 || w != w0.Args[0] || !(x.Uses == 1 && clobber(x)) { - continue - } - v.reset(OpS390XMOVHBRstoreidx) - v.AuxInt = i - 1 - v.Aux = s - v.AddArg4(p, idx, w0, mem) - return true - } - } - break - } - // match: (MOVBstoreidx [i] {s} p idx (SRWconst [8] w) x:(MOVBstoreidx [i-1] {s} p idx w mem)) - // cond: x.Uses == 1 && clobber(x) - // result: (MOVHBRstoreidx [i-1] {s} p idx w mem) - for { - i := v.AuxInt - s := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - p := v_0 - idx := v_1 - if v_2.Op != OpS390XSRWconst || v_2.AuxInt != 8 { - continue - } - w := v_2.Args[0] - x := v_3 - if x.Op != OpS390XMOVBstoreidx || x.AuxInt != i-1 || x.Aux != s { - continue - } - mem := x.Args[3] - x_0 := x.Args[0] - x_1 := x.Args[1] - for _i1 := 0; _i1 <= 1; _i1, x_0, x_1 = _i1+1, x_1, x_0 { - if p != x_0 || idx != x_1 || w != x.Args[2] || !(x.Uses == 1 && clobber(x)) { - continue - } - v.reset(OpS390XMOVHBRstoreidx) - v.AuxInt = i - 1 - v.Aux = s - v.AddArg4(p, idx, w, mem) - return true - } - } - break - } - // match: (MOVBstoreidx [i] {s} p idx (SRWconst [j] w) x:(MOVBstoreidx [i-1] {s} p idx w0:(SRWconst [j-8] w) mem)) - // cond: x.Uses == 1 && clobber(x) - // result: (MOVHBRstoreidx [i-1] {s} p idx w0 mem) - for { - i := v.AuxInt - s := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - p := v_0 - idx := v_1 - if v_2.Op != OpS390XSRWconst { - continue - } - j := v_2.AuxInt - w := v_2.Args[0] - x := v_3 - if x.Op != OpS390XMOVBstoreidx || x.AuxInt != i-1 || x.Aux != s { - continue - } - mem := x.Args[3] - x_0 := x.Args[0] - x_1 := x.Args[1] - for _i1 := 0; _i1 <= 1; _i1, x_0, x_1 = _i1+1, x_1, x_0 { - if p != x_0 || idx != x_1 { - continue - } - w0 := x.Args[2] - if w0.Op != OpS390XSRWconst || w0.AuxInt != j-8 || w != w0.Args[0] || !(x.Uses == 1 && clobber(x)) { - continue - } - v.reset(OpS390XMOVHBRstoreidx) - v.AuxInt = i - 1 - v.Aux = s - v.AddArg4(p, idx, w0, mem) - return true - } - } - break - } - return false -} func rewriteValueS390X_OpS390XMOVDaddridx(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (MOVDaddridx [c] {s} (ADDconst [d] x) y) - // cond: is20Bit(c+d) && x.Op != OpSB + // cond: is20Bit(int64(c)+int64(d)) // result: (MOVDaddridx [c+d] {s} x y) for { - c := v.AuxInt - s := v.Aux + c := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) if v_0.Op != OpS390XADDconst { break } - d := v_0.AuxInt + d := auxIntToInt32(v_0.AuxInt) x := v_0.Args[0] y := v_1 - if !(is20Bit(c+d) && x.Op != OpSB) { + if !(is20Bit(int64(c) + int64(d))) { break } v.reset(OpS390XMOVDaddridx) - v.AuxInt = c + d - v.Aux = s + v.AuxInt = int32ToAuxInt(c + d) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } // match: (MOVDaddridx [c] {s} x (ADDconst [d] y)) - // cond: is20Bit(c+d) && y.Op != OpSB + // cond: is20Bit(int64(c)+int64(d)) // result: (MOVDaddridx [c+d] {s} x y) for { - c := v.AuxInt - s := v.Aux + c := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) x := v_0 if v_1.Op != OpS390XADDconst { break } - d := v_1.AuxInt + d := auxIntToInt32(v_1.AuxInt) y := v_1.Args[0] - if !(is20Bit(c+d) && y.Op != OpSB) { + if !(is20Bit(int64(c) + int64(d))) { break } v.reset(OpS390XMOVDaddridx) - v.AuxInt = c + d - v.Aux = s + v.AuxInt = int32ToAuxInt(c + d) + v.Aux = symToAux(s) v.AddArg2(x, y) return true } // match: (MOVDaddridx [off1] {sym1} (MOVDaddr [off2] {sym2} x) y) - // cond: is32Bit(off1+off2) && canMergeSym(sym1, sym2) && x.Op != OpSB - // result: (MOVDaddridx [off1+off2] {mergeSym(sym1,sym2)} x y) + // cond: is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) && x.Op != OpSB + // result: (MOVDaddridx [off1+off2] {mergeSymTyped(sym1,sym2)} x y) for { - off1 := v.AuxInt - sym1 := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym1 := auxToSym(v.Aux) if v_0.Op != OpS390XMOVDaddr { break } - off2 := v_0.AuxInt - sym2 := v_0.Aux + off2 := auxIntToInt32(v_0.AuxInt) + sym2 := auxToSym(v_0.Aux) x := v_0.Args[0] y := v_1 - if !(is32Bit(off1+off2) && canMergeSym(sym1, sym2) && x.Op != OpSB) { + if !(is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) && x.Op != OpSB) { break } v.reset(OpS390XMOVDaddridx) - v.AuxInt = off1 + off2 - v.Aux = mergeSym(sym1, sym2) + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(mergeSymTyped(sym1, sym2)) v.AddArg2(x, y) return true } // match: (MOVDaddridx [off1] {sym1} x (MOVDaddr [off2] {sym2} y)) - // cond: is32Bit(off1+off2) && canMergeSym(sym1, sym2) && y.Op != OpSB - // result: (MOVDaddridx [off1+off2] {mergeSym(sym1,sym2)} x y) + // cond: is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) && y.Op != OpSB + // result: (MOVDaddridx [off1+off2] {mergeSymTyped(sym1,sym2)} x y) for { - off1 := v.AuxInt - sym1 := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym1 := auxToSym(v.Aux) x := v_0 if v_1.Op != OpS390XMOVDaddr { break } - off2 := v_1.AuxInt - sym2 := v_1.Aux + off2 := auxIntToInt32(v_1.AuxInt) + sym2 := auxToSym(v_1.Aux) y := v_1.Args[0] - if !(is32Bit(off1+off2) && canMergeSym(sym1, sym2) && y.Op != OpSB) { + if !(is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) && y.Op != OpSB) { break } v.reset(OpS390XMOVDaddridx) - v.AuxInt = off1 + off2 - v.Aux = mergeSym(sym1, sym2) + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(mergeSymTyped(sym1, sym2)) v.AddArg2(x, y) return true } @@ -10250,155 +9104,49 @@ func rewriteValueS390X_OpS390XMOVDload(v *Value) bool { return true } // match: (MOVDload [off1] {sym} (ADDconst [off2] ptr) mem) - // cond: is20Bit(off1+off2) + // cond: is20Bit(int64(off1)+int64(off2)) // result: (MOVDload [off1+off2] {sym} ptr mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpS390XADDconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) ptr := v_0.Args[0] mem := v_1 - if !(is20Bit(off1 + off2)) { + if !(is20Bit(int64(off1) + int64(off2))) { break } v.reset(OpS390XMOVDload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg2(ptr, mem) return true } // match: (MOVDload [off1] {sym1} (MOVDaddr <t> [off2] {sym2} base) mem) - // cond: is32Bit(off1+off2) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%8 == 0 && (off1+off2)%8 == 0)) - // result: (MOVDload [off1+off2] {mergeSym(sym1,sym2)} base mem) + // cond: is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%8 == 0 && (off1+off2)%8 == 0)) + // result: (MOVDload [off1+off2] {mergeSymTyped(sym1,sym2)} base mem) for { - off1 := v.AuxInt - sym1 := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym1 := auxToSym(v.Aux) if v_0.Op != OpS390XMOVDaddr { break } t := v_0.Type - off2 := v_0.AuxInt - sym2 := v_0.Aux + off2 := auxIntToInt32(v_0.AuxInt) + sym2 := auxToSym(v_0.Aux) base := v_0.Args[0] mem := v_1 - if !(is32Bit(off1+off2) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%8 == 0 && (off1+off2)%8 == 0))) { + if !(is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%8 == 0 && (off1+off2)%8 == 0))) { break } v.reset(OpS390XMOVDload) - v.AuxInt = off1 + off2 - v.Aux = mergeSym(sym1, sym2) + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(mergeSymTyped(sym1, sym2)) v.AddArg2(base, mem) return true } - // match: (MOVDload [off1] {sym1} (MOVDaddridx [off2] {sym2} ptr idx) mem) - // cond: is32Bit(off1+off2) && canMergeSym(sym1, sym2) - // result: (MOVDloadidx [off1+off2] {mergeSym(sym1,sym2)} ptr idx mem) - for { - off1 := v.AuxInt - sym1 := v.Aux - if v_0.Op != OpS390XMOVDaddridx { - break - } - off2 := v_0.AuxInt - sym2 := v_0.Aux - idx := v_0.Args[1] - ptr := v_0.Args[0] - mem := v_1 - if !(is32Bit(off1+off2) && canMergeSym(sym1, sym2)) { - break - } - v.reset(OpS390XMOVDloadidx) - v.AuxInt = off1 + off2 - v.Aux = mergeSym(sym1, sym2) - v.AddArg3(ptr, idx, mem) - return true - } - // match: (MOVDload [off] {sym} (ADD ptr idx) mem) - // cond: ptr.Op != OpSB - // result: (MOVDloadidx [off] {sym} ptr idx mem) - for { - off := auxIntToInt32(v.AuxInt) - sym := auxToSym(v.Aux) - if v_0.Op != OpS390XADD { - break - } - _ = v_0.Args[1] - v_0_0 := v_0.Args[0] - v_0_1 := v_0.Args[1] - for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { - ptr := v_0_0 - idx := v_0_1 - mem := v_1 - if !(ptr.Op != OpSB) { - continue - } - v.reset(OpS390XMOVDloadidx) - v.AuxInt = int32ToAuxInt(off) - v.Aux = symToAux(sym) - v.AddArg3(ptr, idx, mem) - return true - } - break - } - return false -} -func rewriteValueS390X_OpS390XMOVDloadidx(v *Value) bool { - v_2 := v.Args[2] - v_1 := v.Args[1] - v_0 := v.Args[0] - // match: (MOVDloadidx [c] {sym} (ADDconst [d] ptr) idx mem) - // cond: is20Bit(c+d) - // result: (MOVDloadidx [c+d] {sym} ptr idx mem) - for { - c := v.AuxInt - sym := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - if v_0.Op != OpS390XADDconst { - continue - } - d := v_0.AuxInt - ptr := v_0.Args[0] - idx := v_1 - mem := v_2 - if !(is20Bit(c + d)) { - continue - } - v.reset(OpS390XMOVDloadidx) - v.AuxInt = c + d - v.Aux = sym - v.AddArg3(ptr, idx, mem) - return true - } - break - } - // match: (MOVDloadidx [c] {sym} ptr (ADDconst [d] idx) mem) - // cond: is20Bit(c+d) - // result: (MOVDloadidx [c+d] {sym} ptr idx mem) - for { - c := v.AuxInt - sym := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - ptr := v_0 - if v_1.Op != OpS390XADDconst { - continue - } - d := v_1.AuxInt - idx := v_1.Args[0] - mem := v_2 - if !(is20Bit(c + d)) { - continue - } - v.reset(OpS390XMOVDloadidx) - v.AuxInt = c + d - v.Aux = sym - v.AddArg3(ptr, idx, mem) - return true - } - break - } return false } func rewriteValueS390X_OpS390XMOVDstore(v *Value) bool { @@ -10406,134 +9154,82 @@ func rewriteValueS390X_OpS390XMOVDstore(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (MOVDstore [off1] {sym} (ADDconst [off2] ptr) val mem) - // cond: is20Bit(off1+off2) + // cond: is20Bit(int64(off1)+int64(off2)) // result: (MOVDstore [off1+off2] {sym} ptr val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpS390XADDconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) ptr := v_0.Args[0] val := v_1 mem := v_2 - if !(is20Bit(off1 + off2)) { + if !(is20Bit(int64(off1) + int64(off2))) { break } v.reset(OpS390XMOVDstore) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(ptr, val, mem) return true } // match: (MOVDstore [off] {sym} ptr (MOVDconst [c]) mem) - // cond: is16Bit(c) && isU12Bit(off) && ptr.Op != OpSB - // result: (MOVDstoreconst [makeValAndOff(c,off)] {sym} ptr mem) + // cond: is16Bit(c) && isU12Bit(int64(off)) && ptr.Op != OpSB + // result: (MOVDstoreconst [makeValAndOff32(int32(c),off)] {sym} ptr mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpS390XMOVDconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) mem := v_2 - if !(is16Bit(c) && isU12Bit(off) && ptr.Op != OpSB) { + if !(is16Bit(c) && isU12Bit(int64(off)) && ptr.Op != OpSB) { break } v.reset(OpS390XMOVDstoreconst) - v.AuxInt = makeValAndOff(c, off) - v.Aux = sym + v.AuxInt = valAndOffToAuxInt(makeValAndOff32(int32(c), off)) + v.Aux = symToAux(sym) v.AddArg2(ptr, mem) return true } // match: (MOVDstore [off1] {sym1} (MOVDaddr <t> [off2] {sym2} base) val mem) - // cond: is32Bit(off1+off2) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%8 == 0 && (off1+off2)%8 == 0)) - // result: (MOVDstore [off1+off2] {mergeSym(sym1,sym2)} base val mem) + // cond: is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%8 == 0 && (off1+off2)%8 == 0)) + // result: (MOVDstore [off1+off2] {mergeSymTyped(sym1,sym2)} base val mem) for { - off1 := v.AuxInt - sym1 := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym1 := auxToSym(v.Aux) if v_0.Op != OpS390XMOVDaddr { break } t := v_0.Type - off2 := v_0.AuxInt - sym2 := v_0.Aux + off2 := auxIntToInt32(v_0.AuxInt) + sym2 := auxToSym(v_0.Aux) base := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1+off2) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%8 == 0 && (off1+off2)%8 == 0))) { + if !(is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%8 == 0 && (off1+off2)%8 == 0))) { break } v.reset(OpS390XMOVDstore) - v.AuxInt = off1 + off2 - v.Aux = mergeSym(sym1, sym2) + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(mergeSymTyped(sym1, sym2)) v.AddArg3(base, val, mem) return true } - // match: (MOVDstore [off1] {sym1} (MOVDaddridx [off2] {sym2} ptr idx) val mem) - // cond: is32Bit(off1+off2) && canMergeSym(sym1, sym2) - // result: (MOVDstoreidx [off1+off2] {mergeSym(sym1,sym2)} ptr idx val mem) - for { - off1 := v.AuxInt - sym1 := v.Aux - if v_0.Op != OpS390XMOVDaddridx { - break - } - off2 := v_0.AuxInt - sym2 := v_0.Aux - idx := v_0.Args[1] - ptr := v_0.Args[0] - val := v_1 - mem := v_2 - if !(is32Bit(off1+off2) && canMergeSym(sym1, sym2)) { - break - } - v.reset(OpS390XMOVDstoreidx) - v.AuxInt = off1 + off2 - v.Aux = mergeSym(sym1, sym2) - v.AddArg4(ptr, idx, val, mem) - return true - } - // match: (MOVDstore [off] {sym} (ADD ptr idx) val mem) - // cond: ptr.Op != OpSB - // result: (MOVDstoreidx [off] {sym} ptr idx val mem) - for { - off := auxIntToInt32(v.AuxInt) - sym := auxToSym(v.Aux) - if v_0.Op != OpS390XADD { - break - } - _ = v_0.Args[1] - v_0_0 := v_0.Args[0] - v_0_1 := v_0.Args[1] - for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { - ptr := v_0_0 - idx := v_0_1 - val := v_1 - mem := v_2 - if !(ptr.Op != OpSB) { - continue - } - v.reset(OpS390XMOVDstoreidx) - v.AuxInt = int32ToAuxInt(off) - v.Aux = symToAux(sym) - v.AddArg4(ptr, idx, val, mem) - return true - } - break - } // match: (MOVDstore [i] {s} p w1 x:(MOVDstore [i-8] {s} p w0 mem)) - // cond: p.Op != OpSB && x.Uses == 1 && is20Bit(i-8) && clobber(x) + // cond: p.Op != OpSB && x.Uses == 1 && is20Bit(int64(i)-8) && clobber(x) // result: (STMG2 [i-8] {s} p w0 w1 mem) for { - i := v.AuxInt - s := v.Aux + i := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) p := v_0 w1 := v_1 x := v_2 - if x.Op != OpS390XMOVDstore || x.AuxInt != i-8 || x.Aux != s { + if x.Op != OpS390XMOVDstore || auxIntToInt32(x.AuxInt) != i-8 || auxToSym(x.Aux) != s { break } mem := x.Args[2] @@ -10541,25 +9237,25 @@ func rewriteValueS390X_OpS390XMOVDstore(v *Value) bool { break } w0 := x.Args[1] - if !(p.Op != OpSB && x.Uses == 1 && is20Bit(i-8) && clobber(x)) { + if !(p.Op != OpSB && x.Uses == 1 && is20Bit(int64(i)-8) && clobber(x)) { break } v.reset(OpS390XSTMG2) - v.AuxInt = i - 8 - v.Aux = s + v.AuxInt = int32ToAuxInt(i - 8) + v.Aux = symToAux(s) v.AddArg4(p, w0, w1, mem) return true } // match: (MOVDstore [i] {s} p w2 x:(STMG2 [i-16] {s} p w0 w1 mem)) - // cond: x.Uses == 1 && is20Bit(i-16) && clobber(x) + // cond: x.Uses == 1 && is20Bit(int64(i)-16) && clobber(x) // result: (STMG3 [i-16] {s} p w0 w1 w2 mem) for { - i := v.AuxInt - s := v.Aux + i := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) p := v_0 w2 := v_1 x := v_2 - if x.Op != OpS390XSTMG2 || x.AuxInt != i-16 || x.Aux != s { + if x.Op != OpS390XSTMG2 || auxIntToInt32(x.AuxInt) != i-16 || auxToSym(x.Aux) != s { break } mem := x.Args[3] @@ -10568,25 +9264,25 @@ func rewriteValueS390X_OpS390XMOVDstore(v *Value) bool { } w0 := x.Args[1] w1 := x.Args[2] - if !(x.Uses == 1 && is20Bit(i-16) && clobber(x)) { + if !(x.Uses == 1 && is20Bit(int64(i)-16) && clobber(x)) { break } v.reset(OpS390XSTMG3) - v.AuxInt = i - 16 - v.Aux = s + v.AuxInt = int32ToAuxInt(i - 16) + v.Aux = symToAux(s) v.AddArg5(p, w0, w1, w2, mem) return true } // match: (MOVDstore [i] {s} p w3 x:(STMG3 [i-24] {s} p w0 w1 w2 mem)) - // cond: x.Uses == 1 && is20Bit(i-24) && clobber(x) + // cond: x.Uses == 1 && is20Bit(int64(i)-24) && clobber(x) // result: (STMG4 [i-24] {s} p w0 w1 w2 w3 mem) for { - i := v.AuxInt - s := v.Aux + i := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) p := v_0 w3 := v_1 x := v_2 - if x.Op != OpS390XSTMG3 || x.AuxInt != i-24 || x.Aux != s { + if x.Op != OpS390XSTMG3 || auxIntToInt32(x.AuxInt) != i-24 || auxToSym(x.Aux) != s { break } mem := x.Args[4] @@ -10596,12 +9292,12 @@ func rewriteValueS390X_OpS390XMOVDstore(v *Value) bool { w0 := x.Args[1] w1 := x.Args[2] w2 := x.Args[3] - if !(x.Uses == 1 && is20Bit(i-24) && clobber(x)) { + if !(x.Uses == 1 && is20Bit(int64(i)-24) && clobber(x)) { break } v.reset(OpS390XSTMG4) - v.AuxInt = i - 24 - v.Aux = s + v.AuxInt = int32ToAuxInt(i - 24) + v.Aux = symToAux(s) v.AddArg6(p, w0, w1, w2, w3, mem) return true } @@ -10611,109 +9307,50 @@ func rewriteValueS390X_OpS390XMOVDstoreconst(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (MOVDstoreconst [sc] {s} (ADDconst [off] ptr) mem) - // cond: isU12Bit(ValAndOff(sc).Off()+off) - // result: (MOVDstoreconst [ValAndOff(sc).add(off)] {s} ptr mem) + // cond: isU12Bit(sc.Off()+int64(off)) + // result: (MOVDstoreconst [sc.addOffset32(off)] {s} ptr mem) for { - sc := v.AuxInt - s := v.Aux + sc := auxIntToValAndOff(v.AuxInt) + s := auxToSym(v.Aux) if v_0.Op != OpS390XADDconst { break } - off := v_0.AuxInt + off := auxIntToInt32(v_0.AuxInt) ptr := v_0.Args[0] mem := v_1 - if !(isU12Bit(ValAndOff(sc).Off() + off)) { + if !(isU12Bit(sc.Off() + int64(off))) { break } v.reset(OpS390XMOVDstoreconst) - v.AuxInt = ValAndOff(sc).add(off) - v.Aux = s + v.AuxInt = valAndOffToAuxInt(sc.addOffset32(off)) + v.Aux = symToAux(s) v.AddArg2(ptr, mem) return true } // match: (MOVDstoreconst [sc] {sym1} (MOVDaddr [off] {sym2} ptr) mem) - // cond: ptr.Op != OpSB && canMergeSym(sym1, sym2) && ValAndOff(sc).canAdd(off) - // result: (MOVDstoreconst [ValAndOff(sc).add(off)] {mergeSym(sym1, sym2)} ptr mem) + // cond: ptr.Op != OpSB && canMergeSym(sym1, sym2) && sc.canAdd32(off) + // result: (MOVDstoreconst [sc.addOffset32(off)] {mergeSymTyped(sym1, sym2)} ptr mem) for { - sc := v.AuxInt - sym1 := v.Aux + sc := auxIntToValAndOff(v.AuxInt) + sym1 := auxToSym(v.Aux) if v_0.Op != OpS390XMOVDaddr { break } - off := v_0.AuxInt - sym2 := v_0.Aux + off := auxIntToInt32(v_0.AuxInt) + sym2 := auxToSym(v_0.Aux) ptr := v_0.Args[0] mem := v_1 - if !(ptr.Op != OpSB && canMergeSym(sym1, sym2) && ValAndOff(sc).canAdd(off)) { + if !(ptr.Op != OpSB && canMergeSym(sym1, sym2) && sc.canAdd32(off)) { break } v.reset(OpS390XMOVDstoreconst) - v.AuxInt = ValAndOff(sc).add(off) - v.Aux = mergeSym(sym1, sym2) + v.AuxInt = valAndOffToAuxInt(sc.addOffset32(off)) + v.Aux = symToAux(mergeSymTyped(sym1, sym2)) v.AddArg2(ptr, mem) return true } return false } -func rewriteValueS390X_OpS390XMOVDstoreidx(v *Value) bool { - v_3 := v.Args[3] - v_2 := v.Args[2] - v_1 := v.Args[1] - v_0 := v.Args[0] - // match: (MOVDstoreidx [c] {sym} (ADDconst [d] ptr) idx val mem) - // cond: is20Bit(c+d) - // result: (MOVDstoreidx [c+d] {sym} ptr idx val mem) - for { - c := v.AuxInt - sym := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - if v_0.Op != OpS390XADDconst { - continue - } - d := v_0.AuxInt - ptr := v_0.Args[0] - idx := v_1 - val := v_2 - mem := v_3 - if !(is20Bit(c + d)) { - continue - } - v.reset(OpS390XMOVDstoreidx) - v.AuxInt = c + d - v.Aux = sym - v.AddArg4(ptr, idx, val, mem) - return true - } - break - } - // match: (MOVDstoreidx [c] {sym} ptr (ADDconst [d] idx) val mem) - // cond: is20Bit(c+d) - // result: (MOVDstoreidx [c+d] {sym} ptr idx val mem) - for { - c := v.AuxInt - sym := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - ptr := v_0 - if v_1.Op != OpS390XADDconst { - continue - } - d := v_1.AuxInt - idx := v_1.Args[0] - val := v_2 - mem := v_3 - if !(is20Bit(c + d)) { - continue - } - v.reset(OpS390XMOVDstoreidx) - v.AuxInt = c + d - v.Aux = sym - v.AddArg4(ptr, idx, val, mem) - return true - } - break - } - return false -} func rewriteValueS390X_OpS390XMOVHBRstore(v *Value) bool { v_2 := v.Args[2] v_1 := v.Args[1] @@ -10722,15 +9359,15 @@ func rewriteValueS390X_OpS390XMOVHBRstore(v *Value) bool { // cond: x.Uses == 1 && clobber(x) // result: (MOVWBRstore [i-2] {s} p w mem) for { - i := v.AuxInt - s := v.Aux + i := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) p := v_0 - if v_1.Op != OpS390XSRDconst || v_1.AuxInt != 16 { + if v_1.Op != OpS390XSRDconst || auxIntToInt8(v_1.AuxInt) != 16 { break } w := v_1.Args[0] x := v_2 - if x.Op != OpS390XMOVHBRstore || x.AuxInt != i-2 || x.Aux != s { + if x.Op != OpS390XMOVHBRstore || auxIntToInt32(x.AuxInt) != i-2 || auxToSym(x.Aux) != s { break } mem := x.Args[2] @@ -10738,8 +9375,8 @@ func rewriteValueS390X_OpS390XMOVHBRstore(v *Value) bool { break } v.reset(OpS390XMOVWBRstore) - v.AuxInt = i - 2 - v.Aux = s + v.AuxInt = int32ToAuxInt(i - 2) + v.Aux = symToAux(s) v.AddArg3(p, w, mem) return true } @@ -10747,16 +9384,16 @@ func rewriteValueS390X_OpS390XMOVHBRstore(v *Value) bool { // cond: x.Uses == 1 && clobber(x) // result: (MOVWBRstore [i-2] {s} p w0 mem) for { - i := v.AuxInt - s := v.Aux + i := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) p := v_0 if v_1.Op != OpS390XSRDconst { break } - j := v_1.AuxInt + j := auxIntToInt8(v_1.AuxInt) w := v_1.Args[0] x := v_2 - if x.Op != OpS390XMOVHBRstore || x.AuxInt != i-2 || x.Aux != s { + if x.Op != OpS390XMOVHBRstore || auxIntToInt32(x.AuxInt) != i-2 || auxToSym(x.Aux) != s { break } mem := x.Args[2] @@ -10764,12 +9401,12 @@ func rewriteValueS390X_OpS390XMOVHBRstore(v *Value) bool { break } w0 := x.Args[1] - if w0.Op != OpS390XSRDconst || w0.AuxInt != j-16 || w != w0.Args[0] || !(x.Uses == 1 && clobber(x)) { + if w0.Op != OpS390XSRDconst || auxIntToInt8(w0.AuxInt) != j-16 || w != w0.Args[0] || !(x.Uses == 1 && clobber(x)) { break } v.reset(OpS390XMOVWBRstore) - v.AuxInt = i - 2 - v.Aux = s + v.AuxInt = int32ToAuxInt(i - 2) + v.Aux = symToAux(s) v.AddArg3(p, w0, mem) return true } @@ -10777,15 +9414,15 @@ func rewriteValueS390X_OpS390XMOVHBRstore(v *Value) bool { // cond: x.Uses == 1 && clobber(x) // result: (MOVWBRstore [i-2] {s} p w mem) for { - i := v.AuxInt - s := v.Aux + i := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) p := v_0 - if v_1.Op != OpS390XSRWconst || v_1.AuxInt != 16 { + if v_1.Op != OpS390XSRWconst || auxIntToInt8(v_1.AuxInt) != 16 { break } w := v_1.Args[0] x := v_2 - if x.Op != OpS390XMOVHBRstore || x.AuxInt != i-2 || x.Aux != s { + if x.Op != OpS390XMOVHBRstore || auxIntToInt32(x.AuxInt) != i-2 || auxToSym(x.Aux) != s { break } mem := x.Args[2] @@ -10793,8 +9430,8 @@ func rewriteValueS390X_OpS390XMOVHBRstore(v *Value) bool { break } v.reset(OpS390XMOVWBRstore) - v.AuxInt = i - 2 - v.Aux = s + v.AuxInt = int32ToAuxInt(i - 2) + v.Aux = symToAux(s) v.AddArg3(p, w, mem) return true } @@ -10802,16 +9439,16 @@ func rewriteValueS390X_OpS390XMOVHBRstore(v *Value) bool { // cond: x.Uses == 1 && clobber(x) // result: (MOVWBRstore [i-2] {s} p w0 mem) for { - i := v.AuxInt - s := v.Aux + i := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) p := v_0 if v_1.Op != OpS390XSRWconst { break } - j := v_1.AuxInt + j := auxIntToInt8(v_1.AuxInt) w := v_1.Args[0] x := v_2 - if x.Op != OpS390XMOVHBRstore || x.AuxInt != i-2 || x.Aux != s { + if x.Op != OpS390XMOVHBRstore || auxIntToInt32(x.AuxInt) != i-2 || auxToSym(x.Aux) != s { break } mem := x.Args[2] @@ -10819,166 +9456,17 @@ func rewriteValueS390X_OpS390XMOVHBRstore(v *Value) bool { break } w0 := x.Args[1] - if w0.Op != OpS390XSRWconst || w0.AuxInt != j-16 || w != w0.Args[0] || !(x.Uses == 1 && clobber(x)) { + if w0.Op != OpS390XSRWconst || auxIntToInt8(w0.AuxInt) != j-16 || w != w0.Args[0] || !(x.Uses == 1 && clobber(x)) { break } v.reset(OpS390XMOVWBRstore) - v.AuxInt = i - 2 - v.Aux = s + v.AuxInt = int32ToAuxInt(i - 2) + v.Aux = symToAux(s) v.AddArg3(p, w0, mem) return true } return false } -func rewriteValueS390X_OpS390XMOVHBRstoreidx(v *Value) bool { - v_3 := v.Args[3] - v_2 := v.Args[2] - v_1 := v.Args[1] - v_0 := v.Args[0] - // match: (MOVHBRstoreidx [i] {s} p idx (SRDconst [16] w) x:(MOVHBRstoreidx [i-2] {s} p idx w mem)) - // cond: x.Uses == 1 && clobber(x) - // result: (MOVWBRstoreidx [i-2] {s} p idx w mem) - for { - i := v.AuxInt - s := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - p := v_0 - idx := v_1 - if v_2.Op != OpS390XSRDconst || v_2.AuxInt != 16 { - continue - } - w := v_2.Args[0] - x := v_3 - if x.Op != OpS390XMOVHBRstoreidx || x.AuxInt != i-2 || x.Aux != s { - continue - } - mem := x.Args[3] - x_0 := x.Args[0] - x_1 := x.Args[1] - for _i1 := 0; _i1 <= 1; _i1, x_0, x_1 = _i1+1, x_1, x_0 { - if p != x_0 || idx != x_1 || w != x.Args[2] || !(x.Uses == 1 && clobber(x)) { - continue - } - v.reset(OpS390XMOVWBRstoreidx) - v.AuxInt = i - 2 - v.Aux = s - v.AddArg4(p, idx, w, mem) - return true - } - } - break - } - // match: (MOVHBRstoreidx [i] {s} p idx (SRDconst [j] w) x:(MOVHBRstoreidx [i-2] {s} p idx w0:(SRDconst [j-16] w) mem)) - // cond: x.Uses == 1 && clobber(x) - // result: (MOVWBRstoreidx [i-2] {s} p idx w0 mem) - for { - i := v.AuxInt - s := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - p := v_0 - idx := v_1 - if v_2.Op != OpS390XSRDconst { - continue - } - j := v_2.AuxInt - w := v_2.Args[0] - x := v_3 - if x.Op != OpS390XMOVHBRstoreidx || x.AuxInt != i-2 || x.Aux != s { - continue - } - mem := x.Args[3] - x_0 := x.Args[0] - x_1 := x.Args[1] - for _i1 := 0; _i1 <= 1; _i1, x_0, x_1 = _i1+1, x_1, x_0 { - if p != x_0 || idx != x_1 { - continue - } - w0 := x.Args[2] - if w0.Op != OpS390XSRDconst || w0.AuxInt != j-16 || w != w0.Args[0] || !(x.Uses == 1 && clobber(x)) { - continue - } - v.reset(OpS390XMOVWBRstoreidx) - v.AuxInt = i - 2 - v.Aux = s - v.AddArg4(p, idx, w0, mem) - return true - } - } - break - } - // match: (MOVHBRstoreidx [i] {s} p idx (SRWconst [16] w) x:(MOVHBRstoreidx [i-2] {s} p idx w mem)) - // cond: x.Uses == 1 && clobber(x) - // result: (MOVWBRstoreidx [i-2] {s} p idx w mem) - for { - i := v.AuxInt - s := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - p := v_0 - idx := v_1 - if v_2.Op != OpS390XSRWconst || v_2.AuxInt != 16 { - continue - } - w := v_2.Args[0] - x := v_3 - if x.Op != OpS390XMOVHBRstoreidx || x.AuxInt != i-2 || x.Aux != s { - continue - } - mem := x.Args[3] - x_0 := x.Args[0] - x_1 := x.Args[1] - for _i1 := 0; _i1 <= 1; _i1, x_0, x_1 = _i1+1, x_1, x_0 { - if p != x_0 || idx != x_1 || w != x.Args[2] || !(x.Uses == 1 && clobber(x)) { - continue - } - v.reset(OpS390XMOVWBRstoreidx) - v.AuxInt = i - 2 - v.Aux = s - v.AddArg4(p, idx, w, mem) - return true - } - } - break - } - // match: (MOVHBRstoreidx [i] {s} p idx (SRWconst [j] w) x:(MOVHBRstoreidx [i-2] {s} p idx w0:(SRWconst [j-16] w) mem)) - // cond: x.Uses == 1 && clobber(x) - // result: (MOVWBRstoreidx [i-2] {s} p idx w0 mem) - for { - i := v.AuxInt - s := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - p := v_0 - idx := v_1 - if v_2.Op != OpS390XSRWconst { - continue - } - j := v_2.AuxInt - w := v_2.Args[0] - x := v_3 - if x.Op != OpS390XMOVHBRstoreidx || x.AuxInt != i-2 || x.Aux != s { - continue - } - mem := x.Args[3] - x_0 := x.Args[0] - x_1 := x.Args[1] - for _i1 := 0; _i1 <= 1; _i1, x_0, x_1 = _i1+1, x_1, x_0 { - if p != x_0 || idx != x_1 { - continue - } - w0 := x.Args[2] - if w0.Op != OpS390XSRWconst || w0.AuxInt != j-16 || w != w0.Args[0] || !(x.Uses == 1 && clobber(x)) { - continue - } - v.reset(OpS390XMOVWBRstoreidx) - v.AuxInt = i - 2 - v.Aux = s - v.AddArg4(p, idx, w0, mem) - return true - } - } - break - } - return false -} func rewriteValueS390X_OpS390XMOVHZload(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] @@ -11002,155 +9490,49 @@ func rewriteValueS390X_OpS390XMOVHZload(v *Value) bool { return true } // match: (MOVHZload [off1] {sym} (ADDconst [off2] ptr) mem) - // cond: is20Bit(off1+off2) + // cond: is20Bit(int64(off1)+int64(off2)) // result: (MOVHZload [off1+off2] {sym} ptr mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpS390XADDconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) ptr := v_0.Args[0] mem := v_1 - if !(is20Bit(off1 + off2)) { + if !(is20Bit(int64(off1) + int64(off2))) { break } v.reset(OpS390XMOVHZload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg2(ptr, mem) return true } // match: (MOVHZload [off1] {sym1} (MOVDaddr <t> [off2] {sym2} base) mem) - // cond: is32Bit(off1+off2) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%2 == 0 && (off1+off2)%2 == 0)) - // result: (MOVHZload [off1+off2] {mergeSym(sym1,sym2)} base mem) + // cond: is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%2 == 0 && (off1+off2)%2 == 0)) + // result: (MOVHZload [off1+off2] {mergeSymTyped(sym1,sym2)} base mem) for { - off1 := v.AuxInt - sym1 := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym1 := auxToSym(v.Aux) if v_0.Op != OpS390XMOVDaddr { break } t := v_0.Type - off2 := v_0.AuxInt - sym2 := v_0.Aux + off2 := auxIntToInt32(v_0.AuxInt) + sym2 := auxToSym(v_0.Aux) base := v_0.Args[0] mem := v_1 - if !(is32Bit(off1+off2) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%2 == 0 && (off1+off2)%2 == 0))) { + if !(is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%2 == 0 && (off1+off2)%2 == 0))) { break } v.reset(OpS390XMOVHZload) - v.AuxInt = off1 + off2 - v.Aux = mergeSym(sym1, sym2) + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(mergeSymTyped(sym1, sym2)) v.AddArg2(base, mem) return true } - // match: (MOVHZload [off1] {sym1} (MOVDaddridx [off2] {sym2} ptr idx) mem) - // cond: is32Bit(off1+off2) && canMergeSym(sym1, sym2) - // result: (MOVHZloadidx [off1+off2] {mergeSym(sym1,sym2)} ptr idx mem) - for { - off1 := v.AuxInt - sym1 := v.Aux - if v_0.Op != OpS390XMOVDaddridx { - break - } - off2 := v_0.AuxInt - sym2 := v_0.Aux - idx := v_0.Args[1] - ptr := v_0.Args[0] - mem := v_1 - if !(is32Bit(off1+off2) && canMergeSym(sym1, sym2)) { - break - } - v.reset(OpS390XMOVHZloadidx) - v.AuxInt = off1 + off2 - v.Aux = mergeSym(sym1, sym2) - v.AddArg3(ptr, idx, mem) - return true - } - // match: (MOVHZload [off] {sym} (ADD ptr idx) mem) - // cond: ptr.Op != OpSB - // result: (MOVHZloadidx [off] {sym} ptr idx mem) - for { - off := auxIntToInt32(v.AuxInt) - sym := auxToSym(v.Aux) - if v_0.Op != OpS390XADD { - break - } - _ = v_0.Args[1] - v_0_0 := v_0.Args[0] - v_0_1 := v_0.Args[1] - for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { - ptr := v_0_0 - idx := v_0_1 - mem := v_1 - if !(ptr.Op != OpSB) { - continue - } - v.reset(OpS390XMOVHZloadidx) - v.AuxInt = int32ToAuxInt(off) - v.Aux = symToAux(sym) - v.AddArg3(ptr, idx, mem) - return true - } - break - } - return false -} -func rewriteValueS390X_OpS390XMOVHZloadidx(v *Value) bool { - v_2 := v.Args[2] - v_1 := v.Args[1] - v_0 := v.Args[0] - // match: (MOVHZloadidx [c] {sym} (ADDconst [d] ptr) idx mem) - // cond: is20Bit(c+d) - // result: (MOVHZloadidx [c+d] {sym} ptr idx mem) - for { - c := v.AuxInt - sym := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - if v_0.Op != OpS390XADDconst { - continue - } - d := v_0.AuxInt - ptr := v_0.Args[0] - idx := v_1 - mem := v_2 - if !(is20Bit(c + d)) { - continue - } - v.reset(OpS390XMOVHZloadidx) - v.AuxInt = c + d - v.Aux = sym - v.AddArg3(ptr, idx, mem) - return true - } - break - } - // match: (MOVHZloadidx [c] {sym} ptr (ADDconst [d] idx) mem) - // cond: is20Bit(c+d) - // result: (MOVHZloadidx [c+d] {sym} ptr idx mem) - for { - c := v.AuxInt - sym := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - ptr := v_0 - if v_1.Op != OpS390XADDconst { - continue - } - d := v_1.AuxInt - idx := v_1.Args[0] - mem := v_2 - if !(is20Bit(c + d)) { - continue - } - v.reset(OpS390XMOVHZloadidx) - v.AuxInt = c + d - v.Aux = sym - v.AddArg3(ptr, idx, mem) - return true - } - break - } return false } func rewriteValueS390X_OpS390XMOVHZreg(v *Value) bool { @@ -11248,17 +9630,6 @@ func rewriteValueS390X_OpS390XMOVHZreg(v *Value) bool { v.copyOf(x) return true } - // match: (MOVHZreg x:(MOVBZloadidx _ _ _)) - // cond: (!x.Type.IsSigned() || x.Type.Size() > 1) - // result: x - for { - x := v_0 - if x.Op != OpS390XMOVBZloadidx || !(!x.Type.IsSigned() || x.Type.Size() > 1) { - break - } - v.copyOf(x) - return true - } // match: (MOVHZreg x:(MOVHZload _ _)) // cond: (!x.Type.IsSigned() || x.Type.Size() > 2) // result: x @@ -11270,17 +9641,6 @@ func rewriteValueS390X_OpS390XMOVHZreg(v *Value) bool { v.copyOf(x) return true } - // match: (MOVHZreg x:(MOVHZloadidx _ _ _)) - // cond: (!x.Type.IsSigned() || x.Type.Size() > 2) - // result: x - for { - x := v_0 - if x.Op != OpS390XMOVHZloadidx || !(!x.Type.IsSigned() || x.Type.Size() > 2) { - break - } - v.copyOf(x) - return true - } // match: (MOVHZreg <t> x:(MOVHload [o] {s} p mem)) // cond: x.Uses == 1 && clobber(x) // result: @x.Block (MOVHZload <t> [o] {s} p mem) @@ -11305,31 +9665,6 @@ func rewriteValueS390X_OpS390XMOVHZreg(v *Value) bool { v0.AddArg2(p, mem) return true } - // match: (MOVHZreg <t> x:(MOVHloadidx [o] {s} p i mem)) - // cond: x.Uses == 1 && clobber(x) - // result: @x.Block (MOVHZloadidx <t> [o] {s} p i mem) - for { - t := v.Type - x := v_0 - if x.Op != OpS390XMOVHloadidx { - break - } - o := auxIntToInt32(x.AuxInt) - s := auxToSym(x.Aux) - mem := x.Args[2] - p := x.Args[0] - i := x.Args[1] - if !(x.Uses == 1 && clobber(x)) { - break - } - b = x.Block - v0 := b.NewValue0(v.Pos, OpS390XMOVHZloadidx, t) - v.copyOf(v0) - v0.AuxInt = int32ToAuxInt(o) - v0.Aux = symToAux(s) - v0.AddArg3(p, i, mem) - return true - } // match: (MOVHZreg x:(Arg <t>)) // cond: !t.IsSigned() && t.Size() <= 2 // result: x @@ -11357,16 +9692,16 @@ func rewriteValueS390X_OpS390XMOVHZreg(v *Value) bool { return true } // match: (MOVHZreg (ANDWconst [m] x)) - // result: (MOVWZreg (ANDWconst <typ.UInt32> [int64(uint16(m))] x)) + // result: (MOVWZreg (ANDWconst <typ.UInt32> [int32(uint16(m))] x)) for { if v_0.Op != OpS390XANDWconst { break } - m := v_0.AuxInt + m := auxIntToInt32(v_0.AuxInt) x := v_0.Args[0] v.reset(OpS390XMOVWZreg) v0 := b.NewValue0(v.Pos, OpS390XANDWconst, typ.UInt32) - v0.AuxInt = int64(uint16(m)) + v0.AuxInt = int32ToAuxInt(int32(uint16(m))) v0.AddArg(x) v.AddArg(v0) return true @@ -11396,155 +9731,49 @@ func rewriteValueS390X_OpS390XMOVHload(v *Value) bool { return true } // match: (MOVHload [off1] {sym} (ADDconst [off2] ptr) mem) - // cond: is20Bit(off1+off2) + // cond: is20Bit(int64(off1)+int64(off2)) // result: (MOVHload [off1+off2] {sym} ptr mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpS390XADDconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) ptr := v_0.Args[0] mem := v_1 - if !(is20Bit(off1 + off2)) { + if !(is20Bit(int64(off1) + int64(off2))) { break } v.reset(OpS390XMOVHload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg2(ptr, mem) return true } // match: (MOVHload [off1] {sym1} (MOVDaddr <t> [off2] {sym2} base) mem) - // cond: is32Bit(off1+off2) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%2 == 0 && (off1+off2)%2 == 0)) - // result: (MOVHload [off1+off2] {mergeSym(sym1,sym2)} base mem) + // cond: is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%2 == 0 && (off1+off2)%2 == 0)) + // result: (MOVHload [off1+off2] {mergeSymTyped(sym1,sym2)} base mem) for { - off1 := v.AuxInt - sym1 := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym1 := auxToSym(v.Aux) if v_0.Op != OpS390XMOVDaddr { break } t := v_0.Type - off2 := v_0.AuxInt - sym2 := v_0.Aux + off2 := auxIntToInt32(v_0.AuxInt) + sym2 := auxToSym(v_0.Aux) base := v_0.Args[0] mem := v_1 - if !(is32Bit(off1+off2) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%2 == 0 && (off1+off2)%2 == 0))) { + if !(is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%2 == 0 && (off1+off2)%2 == 0))) { break } v.reset(OpS390XMOVHload) - v.AuxInt = off1 + off2 - v.Aux = mergeSym(sym1, sym2) + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(mergeSymTyped(sym1, sym2)) v.AddArg2(base, mem) return true } - // match: (MOVHload [off1] {sym1} (MOVDaddridx [off2] {sym2} ptr idx) mem) - // cond: is32Bit(off1+off2) && canMergeSym(sym1, sym2) - // result: (MOVHloadidx [off1+off2] {mergeSym(sym1,sym2)} ptr idx mem) - for { - off1 := v.AuxInt - sym1 := v.Aux - if v_0.Op != OpS390XMOVDaddridx { - break - } - off2 := v_0.AuxInt - sym2 := v_0.Aux - idx := v_0.Args[1] - ptr := v_0.Args[0] - mem := v_1 - if !(is32Bit(off1+off2) && canMergeSym(sym1, sym2)) { - break - } - v.reset(OpS390XMOVHloadidx) - v.AuxInt = off1 + off2 - v.Aux = mergeSym(sym1, sym2) - v.AddArg3(ptr, idx, mem) - return true - } - // match: (MOVHload [off] {sym} (ADD ptr idx) mem) - // cond: ptr.Op != OpSB - // result: (MOVHloadidx [off] {sym} ptr idx mem) - for { - off := auxIntToInt32(v.AuxInt) - sym := auxToSym(v.Aux) - if v_0.Op != OpS390XADD { - break - } - _ = v_0.Args[1] - v_0_0 := v_0.Args[0] - v_0_1 := v_0.Args[1] - for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { - ptr := v_0_0 - idx := v_0_1 - mem := v_1 - if !(ptr.Op != OpSB) { - continue - } - v.reset(OpS390XMOVHloadidx) - v.AuxInt = int32ToAuxInt(off) - v.Aux = symToAux(sym) - v.AddArg3(ptr, idx, mem) - return true - } - break - } - return false -} -func rewriteValueS390X_OpS390XMOVHloadidx(v *Value) bool { - v_2 := v.Args[2] - v_1 := v.Args[1] - v_0 := v.Args[0] - // match: (MOVHloadidx [c] {sym} (ADDconst [d] ptr) idx mem) - // cond: is20Bit(c+d) - // result: (MOVHloadidx [c+d] {sym} ptr idx mem) - for { - c := v.AuxInt - sym := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - if v_0.Op != OpS390XADDconst { - continue - } - d := v_0.AuxInt - ptr := v_0.Args[0] - idx := v_1 - mem := v_2 - if !(is20Bit(c + d)) { - continue - } - v.reset(OpS390XMOVHloadidx) - v.AuxInt = c + d - v.Aux = sym - v.AddArg3(ptr, idx, mem) - return true - } - break - } - // match: (MOVHloadidx [c] {sym} ptr (ADDconst [d] idx) mem) - // cond: is20Bit(c+d) - // result: (MOVHloadidx [c+d] {sym} ptr idx mem) - for { - c := v.AuxInt - sym := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - ptr := v_0 - if v_1.Op != OpS390XADDconst { - continue - } - d := v_1.AuxInt - idx := v_1.Args[0] - mem := v_2 - if !(is20Bit(c + d)) { - continue - } - v.reset(OpS390XMOVHloadidx) - v.AuxInt = c + d - v.Aux = sym - v.AddArg3(ptr, idx, mem) - return true - } - break - } return false } func rewriteValueS390X_OpS390XMOVHreg(v *Value) bool { @@ -11642,17 +9871,6 @@ func rewriteValueS390X_OpS390XMOVHreg(v *Value) bool { v.copyOf(x) return true } - // match: (MOVHreg x:(MOVBloadidx _ _ _)) - // cond: (x.Type.IsSigned() || x.Type.Size() == 8) - // result: x - for { - x := v_0 - if x.Op != OpS390XMOVBloadidx || !(x.Type.IsSigned() || x.Type.Size() == 8) { - break - } - v.copyOf(x) - return true - } // match: (MOVHreg x:(MOVHload _ _)) // cond: (x.Type.IsSigned() || x.Type.Size() == 8) // result: x @@ -11664,17 +9882,6 @@ func rewriteValueS390X_OpS390XMOVHreg(v *Value) bool { v.copyOf(x) return true } - // match: (MOVHreg x:(MOVHloadidx _ _ _)) - // cond: (x.Type.IsSigned() || x.Type.Size() == 8) - // result: x - for { - x := v_0 - if x.Op != OpS390XMOVHloadidx || !(x.Type.IsSigned() || x.Type.Size() == 8) { - break - } - v.copyOf(x) - return true - } // match: (MOVHreg x:(MOVBZload _ _)) // cond: (!x.Type.IsSigned() || x.Type.Size() > 1) // result: x @@ -11686,17 +9893,6 @@ func rewriteValueS390X_OpS390XMOVHreg(v *Value) bool { v.copyOf(x) return true } - // match: (MOVHreg x:(MOVBZloadidx _ _ _)) - // cond: (!x.Type.IsSigned() || x.Type.Size() > 1) - // result: x - for { - x := v_0 - if x.Op != OpS390XMOVBZloadidx || !(!x.Type.IsSigned() || x.Type.Size() > 1) { - break - } - v.copyOf(x) - return true - } // match: (MOVHreg <t> x:(MOVHZload [o] {s} p mem)) // cond: x.Uses == 1 && clobber(x) // result: @x.Block (MOVHload <t> [o] {s} p mem) @@ -11721,31 +9917,6 @@ func rewriteValueS390X_OpS390XMOVHreg(v *Value) bool { v0.AddArg2(p, mem) return true } - // match: (MOVHreg <t> x:(MOVHZloadidx [o] {s} p i mem)) - // cond: x.Uses == 1 && clobber(x) - // result: @x.Block (MOVHloadidx <t> [o] {s} p i mem) - for { - t := v.Type - x := v_0 - if x.Op != OpS390XMOVHZloadidx { - break - } - o := auxIntToInt32(x.AuxInt) - s := auxToSym(x.Aux) - mem := x.Args[2] - p := x.Args[0] - i := x.Args[1] - if !(x.Uses == 1 && clobber(x)) { - break - } - b = x.Block - v0 := b.NewValue0(v.Pos, OpS390XMOVHloadidx, t) - v.copyOf(v0) - v0.AuxInt = int32ToAuxInt(o) - v0.Aux = symToAux(s) - v0.AddArg3(p, i, mem) - return true - } // match: (MOVHreg x:(Arg <t>)) // cond: t.IsSigned() && t.Size() <= 2 // result: x @@ -11774,19 +9945,19 @@ func rewriteValueS390X_OpS390XMOVHreg(v *Value) bool { } // match: (MOVHreg (ANDWconst [m] x)) // cond: int16(m) >= 0 - // result: (MOVWZreg (ANDWconst <typ.UInt32> [int64(uint16(m))] x)) + // result: (MOVWZreg (ANDWconst <typ.UInt32> [int32(uint16(m))] x)) for { if v_0.Op != OpS390XANDWconst { break } - m := v_0.AuxInt + m := auxIntToInt32(v_0.AuxInt) x := v_0.Args[0] if !(int16(m) >= 0) { break } v.reset(OpS390XMOVWZreg) v0 := b.NewValue0(v.Pos, OpS390XANDWconst, typ.UInt32) - v0.AuxInt = int64(uint16(m)) + v0.AuxInt = int32ToAuxInt(int32(uint16(m))) v0.AddArg(x) v.AddArg(v0) return true @@ -11832,134 +10003,82 @@ func rewriteValueS390X_OpS390XMOVHstore(v *Value) bool { return true } // match: (MOVHstore [off1] {sym} (ADDconst [off2] ptr) val mem) - // cond: is20Bit(off1+off2) + // cond: is20Bit(int64(off1)+int64(off2)) // result: (MOVHstore [off1+off2] {sym} ptr val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpS390XADDconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) ptr := v_0.Args[0] val := v_1 mem := v_2 - if !(is20Bit(off1 + off2)) { + if !(is20Bit(int64(off1) + int64(off2))) { break } v.reset(OpS390XMOVHstore) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(ptr, val, mem) return true } // match: (MOVHstore [off] {sym} ptr (MOVDconst [c]) mem) - // cond: isU12Bit(off) && ptr.Op != OpSB - // result: (MOVHstoreconst [makeValAndOff(int64(int16(c)),off)] {sym} ptr mem) + // cond: isU12Bit(int64(off)) && ptr.Op != OpSB + // result: (MOVHstoreconst [makeValAndOff32(int32(int16(c)),off)] {sym} ptr mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpS390XMOVDconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) mem := v_2 - if !(isU12Bit(off) && ptr.Op != OpSB) { + if !(isU12Bit(int64(off)) && ptr.Op != OpSB) { break } v.reset(OpS390XMOVHstoreconst) - v.AuxInt = makeValAndOff(int64(int16(c)), off) - v.Aux = sym + v.AuxInt = valAndOffToAuxInt(makeValAndOff32(int32(int16(c)), off)) + v.Aux = symToAux(sym) v.AddArg2(ptr, mem) return true } // match: (MOVHstore [off1] {sym1} (MOVDaddr <t> [off2] {sym2} base) val mem) - // cond: is32Bit(off1+off2) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%2 == 0 && (off1+off2)%2 == 0)) - // result: (MOVHstore [off1+off2] {mergeSym(sym1,sym2)} base val mem) + // cond: is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%2 == 0 && (off1+off2)%2 == 0)) + // result: (MOVHstore [off1+off2] {mergeSymTyped(sym1,sym2)} base val mem) for { - off1 := v.AuxInt - sym1 := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym1 := auxToSym(v.Aux) if v_0.Op != OpS390XMOVDaddr { break } t := v_0.Type - off2 := v_0.AuxInt - sym2 := v_0.Aux + off2 := auxIntToInt32(v_0.AuxInt) + sym2 := auxToSym(v_0.Aux) base := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1+off2) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%2 == 0 && (off1+off2)%2 == 0))) { + if !(is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%2 == 0 && (off1+off2)%2 == 0))) { break } v.reset(OpS390XMOVHstore) - v.AuxInt = off1 + off2 - v.Aux = mergeSym(sym1, sym2) + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(mergeSymTyped(sym1, sym2)) v.AddArg3(base, val, mem) return true } - // match: (MOVHstore [off1] {sym1} (MOVDaddridx [off2] {sym2} ptr idx) val mem) - // cond: is32Bit(off1+off2) && canMergeSym(sym1, sym2) - // result: (MOVHstoreidx [off1+off2] {mergeSym(sym1,sym2)} ptr idx val mem) - for { - off1 := v.AuxInt - sym1 := v.Aux - if v_0.Op != OpS390XMOVDaddridx { - break - } - off2 := v_0.AuxInt - sym2 := v_0.Aux - idx := v_0.Args[1] - ptr := v_0.Args[0] - val := v_1 - mem := v_2 - if !(is32Bit(off1+off2) && canMergeSym(sym1, sym2)) { - break - } - v.reset(OpS390XMOVHstoreidx) - v.AuxInt = off1 + off2 - v.Aux = mergeSym(sym1, sym2) - v.AddArg4(ptr, idx, val, mem) - return true - } - // match: (MOVHstore [off] {sym} (ADD ptr idx) val mem) - // cond: ptr.Op != OpSB - // result: (MOVHstoreidx [off] {sym} ptr idx val mem) - for { - off := auxIntToInt32(v.AuxInt) - sym := auxToSym(v.Aux) - if v_0.Op != OpS390XADD { - break - } - _ = v_0.Args[1] - v_0_0 := v_0.Args[0] - v_0_1 := v_0.Args[1] - for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { - ptr := v_0_0 - idx := v_0_1 - val := v_1 - mem := v_2 - if !(ptr.Op != OpSB) { - continue - } - v.reset(OpS390XMOVHstoreidx) - v.AuxInt = int32ToAuxInt(off) - v.Aux = symToAux(sym) - v.AddArg4(ptr, idx, val, mem) - return true - } - break - } // match: (MOVHstore [i] {s} p w x:(MOVHstore [i-2] {s} p (SRDconst [16] w) mem)) // cond: p.Op != OpSB && x.Uses == 1 && clobber(x) // result: (MOVWstore [i-2] {s} p w mem) for { - i := v.AuxInt - s := v.Aux + i := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) p := v_0 w := v_1 x := v_2 - if x.Op != OpS390XMOVHstore || x.AuxInt != i-2 || x.Aux != s { + if x.Op != OpS390XMOVHstore || auxIntToInt32(x.AuxInt) != i-2 || auxToSym(x.Aux) != s { break } mem := x.Args[2] @@ -11967,12 +10086,12 @@ func rewriteValueS390X_OpS390XMOVHstore(v *Value) bool { break } x_1 := x.Args[1] - if x_1.Op != OpS390XSRDconst || x_1.AuxInt != 16 || w != x_1.Args[0] || !(p.Op != OpSB && x.Uses == 1 && clobber(x)) { + if x_1.Op != OpS390XSRDconst || auxIntToInt8(x_1.AuxInt) != 16 || w != x_1.Args[0] || !(p.Op != OpSB && x.Uses == 1 && clobber(x)) { break } v.reset(OpS390XMOVWstore) - v.AuxInt = i - 2 - v.Aux = s + v.AuxInt = int32ToAuxInt(i - 2) + v.Aux = symToAux(s) v.AddArg3(p, w, mem) return true } @@ -11980,17 +10099,17 @@ func rewriteValueS390X_OpS390XMOVHstore(v *Value) bool { // cond: p.Op != OpSB && x.Uses == 1 && clobber(x) // result: (MOVWstore [i-2] {s} p w0 mem) for { - i := v.AuxInt - s := v.Aux + i := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) p := v_0 w0 := v_1 if w0.Op != OpS390XSRDconst { break } - j := w0.AuxInt + j := auxIntToInt8(w0.AuxInt) w := w0.Args[0] x := v_2 - if x.Op != OpS390XMOVHstore || x.AuxInt != i-2 || x.Aux != s { + if x.Op != OpS390XMOVHstore || auxIntToInt32(x.AuxInt) != i-2 || auxToSym(x.Aux) != s { break } mem := x.Args[2] @@ -11998,12 +10117,12 @@ func rewriteValueS390X_OpS390XMOVHstore(v *Value) bool { break } x_1 := x.Args[1] - if x_1.Op != OpS390XSRDconst || x_1.AuxInt != j+16 || w != x_1.Args[0] || !(p.Op != OpSB && x.Uses == 1 && clobber(x)) { + if x_1.Op != OpS390XSRDconst || auxIntToInt8(x_1.AuxInt) != j+16 || w != x_1.Args[0] || !(p.Op != OpSB && x.Uses == 1 && clobber(x)) { break } v.reset(OpS390XMOVWstore) - v.AuxInt = i - 2 - v.Aux = s + v.AuxInt = int32ToAuxInt(i - 2) + v.Aux = symToAux(s) v.AddArg3(p, w0, mem) return true } @@ -12011,12 +10130,12 @@ func rewriteValueS390X_OpS390XMOVHstore(v *Value) bool { // cond: p.Op != OpSB && x.Uses == 1 && clobber(x) // result: (MOVWstore [i-2] {s} p w mem) for { - i := v.AuxInt - s := v.Aux + i := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) p := v_0 w := v_1 x := v_2 - if x.Op != OpS390XMOVHstore || x.AuxInt != i-2 || x.Aux != s { + if x.Op != OpS390XMOVHstore || auxIntToInt32(x.AuxInt) != i-2 || auxToSym(x.Aux) != s { break } mem := x.Args[2] @@ -12024,12 +10143,12 @@ func rewriteValueS390X_OpS390XMOVHstore(v *Value) bool { break } x_1 := x.Args[1] - if x_1.Op != OpS390XSRWconst || x_1.AuxInt != 16 || w != x_1.Args[0] || !(p.Op != OpSB && x.Uses == 1 && clobber(x)) { + if x_1.Op != OpS390XSRWconst || auxIntToInt8(x_1.AuxInt) != 16 || w != x_1.Args[0] || !(p.Op != OpSB && x.Uses == 1 && clobber(x)) { break } v.reset(OpS390XMOVWstore) - v.AuxInt = i - 2 - v.Aux = s + v.AuxInt = int32ToAuxInt(i - 2) + v.Aux = symToAux(s) v.AddArg3(p, w, mem) return true } @@ -12037,17 +10156,17 @@ func rewriteValueS390X_OpS390XMOVHstore(v *Value) bool { // cond: p.Op != OpSB && x.Uses == 1 && clobber(x) // result: (MOVWstore [i-2] {s} p w0 mem) for { - i := v.AuxInt - s := v.Aux + i := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) p := v_0 w0 := v_1 if w0.Op != OpS390XSRWconst { break } - j := w0.AuxInt + j := auxIntToInt8(w0.AuxInt) w := w0.Args[0] x := v_2 - if x.Op != OpS390XMOVHstore || x.AuxInt != i-2 || x.Aux != s { + if x.Op != OpS390XMOVHstore || auxIntToInt32(x.AuxInt) != i-2 || auxToSym(x.Aux) != s { break } mem := x.Args[2] @@ -12055,12 +10174,12 @@ func rewriteValueS390X_OpS390XMOVHstore(v *Value) bool { break } x_1 := x.Args[1] - if x_1.Op != OpS390XSRWconst || x_1.AuxInt != j+16 || w != x_1.Args[0] || !(p.Op != OpSB && x.Uses == 1 && clobber(x)) { + if x_1.Op != OpS390XSRWconst || auxIntToInt8(x_1.AuxInt) != j+16 || w != x_1.Args[0] || !(p.Op != OpSB && x.Uses == 1 && clobber(x)) { break } v.reset(OpS390XMOVWstore) - v.AuxInt = i - 2 - v.Aux = s + v.AuxInt = int32ToAuxInt(i - 2) + v.Aux = symToAux(s) v.AddArg3(p, w0, mem) return true } @@ -12072,282 +10191,77 @@ func rewriteValueS390X_OpS390XMOVHstoreconst(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (MOVHstoreconst [sc] {s} (ADDconst [off] ptr) mem) - // cond: isU12Bit(ValAndOff(sc).Off()+off) - // result: (MOVHstoreconst [ValAndOff(sc).add(off)] {s} ptr mem) + // cond: isU12Bit(sc.Off()+int64(off)) + // result: (MOVHstoreconst [sc.addOffset32(off)] {s} ptr mem) for { - sc := v.AuxInt - s := v.Aux + sc := auxIntToValAndOff(v.AuxInt) + s := auxToSym(v.Aux) if v_0.Op != OpS390XADDconst { break } - off := v_0.AuxInt + off := auxIntToInt32(v_0.AuxInt) ptr := v_0.Args[0] mem := v_1 - if !(isU12Bit(ValAndOff(sc).Off() + off)) { + if !(isU12Bit(sc.Off() + int64(off))) { break } v.reset(OpS390XMOVHstoreconst) - v.AuxInt = ValAndOff(sc).add(off) - v.Aux = s + v.AuxInt = valAndOffToAuxInt(sc.addOffset32(off)) + v.Aux = symToAux(s) v.AddArg2(ptr, mem) return true } // match: (MOVHstoreconst [sc] {sym1} (MOVDaddr [off] {sym2} ptr) mem) - // cond: ptr.Op != OpSB && canMergeSym(sym1, sym2) && ValAndOff(sc).canAdd(off) - // result: (MOVHstoreconst [ValAndOff(sc).add(off)] {mergeSym(sym1, sym2)} ptr mem) + // cond: ptr.Op != OpSB && canMergeSym(sym1, sym2) && sc.canAdd32(off) + // result: (MOVHstoreconst [sc.addOffset32(off)] {mergeSymTyped(sym1, sym2)} ptr mem) for { - sc := v.AuxInt - sym1 := v.Aux + sc := auxIntToValAndOff(v.AuxInt) + sym1 := auxToSym(v.Aux) if v_0.Op != OpS390XMOVDaddr { break } - off := v_0.AuxInt - sym2 := v_0.Aux + off := auxIntToInt32(v_0.AuxInt) + sym2 := auxToSym(v_0.Aux) ptr := v_0.Args[0] mem := v_1 - if !(ptr.Op != OpSB && canMergeSym(sym1, sym2) && ValAndOff(sc).canAdd(off)) { + if !(ptr.Op != OpSB && canMergeSym(sym1, sym2) && sc.canAdd32(off)) { break } v.reset(OpS390XMOVHstoreconst) - v.AuxInt = ValAndOff(sc).add(off) - v.Aux = mergeSym(sym1, sym2) + v.AuxInt = valAndOffToAuxInt(sc.addOffset32(off)) + v.Aux = symToAux(mergeSymTyped(sym1, sym2)) v.AddArg2(ptr, mem) return true } // match: (MOVHstoreconst [c] {s} p x:(MOVHstoreconst [a] {s} p mem)) - // cond: p.Op != OpSB && x.Uses == 1 && ValAndOff(a).Off() + 2 == ValAndOff(c).Off() && clobber(x) - // result: (MOVWstore [ValAndOff(a).Off()] {s} p (MOVDconst [int64(int32(ValAndOff(c).Val()&0xffff | ValAndOff(a).Val()<<16))]) mem) + // cond: p.Op != OpSB && x.Uses == 1 && a.Off() + 2 == c.Off() && clobber(x) + // result: (MOVWstore [a.Off32()] {s} p (MOVDconst [int64(c.Val32()&0xffff | a.Val32()<<16)]) mem) for { - c := v.AuxInt - s := v.Aux + c := auxIntToValAndOff(v.AuxInt) + s := auxToSym(v.Aux) p := v_0 x := v_1 if x.Op != OpS390XMOVHstoreconst { break } - a := x.AuxInt - if x.Aux != s { + a := auxIntToValAndOff(x.AuxInt) + if auxToSym(x.Aux) != s { break } mem := x.Args[1] - if p != x.Args[0] || !(p.Op != OpSB && x.Uses == 1 && ValAndOff(a).Off()+2 == ValAndOff(c).Off() && clobber(x)) { + if p != x.Args[0] || !(p.Op != OpSB && x.Uses == 1 && a.Off()+2 == c.Off() && clobber(x)) { break } v.reset(OpS390XMOVWstore) - v.AuxInt = ValAndOff(a).Off() - v.Aux = s + v.AuxInt = int32ToAuxInt(a.Off32()) + v.Aux = symToAux(s) v0 := b.NewValue0(x.Pos, OpS390XMOVDconst, typ.UInt64) - v0.AuxInt = int64(int32(ValAndOff(c).Val()&0xffff | ValAndOff(a).Val()<<16)) + v0.AuxInt = int64ToAuxInt(int64(c.Val32()&0xffff | a.Val32()<<16)) v.AddArg3(p, v0, mem) return true } return false } -func rewriteValueS390X_OpS390XMOVHstoreidx(v *Value) bool { - v_3 := v.Args[3] - v_2 := v.Args[2] - v_1 := v.Args[1] - v_0 := v.Args[0] - // match: (MOVHstoreidx [c] {sym} (ADDconst [d] ptr) idx val mem) - // cond: is20Bit(c+d) - // result: (MOVHstoreidx [c+d] {sym} ptr idx val mem) - for { - c := v.AuxInt - sym := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - if v_0.Op != OpS390XADDconst { - continue - } - d := v_0.AuxInt - ptr := v_0.Args[0] - idx := v_1 - val := v_2 - mem := v_3 - if !(is20Bit(c + d)) { - continue - } - v.reset(OpS390XMOVHstoreidx) - v.AuxInt = c + d - v.Aux = sym - v.AddArg4(ptr, idx, val, mem) - return true - } - break - } - // match: (MOVHstoreidx [c] {sym} ptr (ADDconst [d] idx) val mem) - // cond: is20Bit(c+d) - // result: (MOVHstoreidx [c+d] {sym} ptr idx val mem) - for { - c := v.AuxInt - sym := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - ptr := v_0 - if v_1.Op != OpS390XADDconst { - continue - } - d := v_1.AuxInt - idx := v_1.Args[0] - val := v_2 - mem := v_3 - if !(is20Bit(c + d)) { - continue - } - v.reset(OpS390XMOVHstoreidx) - v.AuxInt = c + d - v.Aux = sym - v.AddArg4(ptr, idx, val, mem) - return true - } - break - } - // match: (MOVHstoreidx [i] {s} p idx w x:(MOVHstoreidx [i-2] {s} p idx (SRDconst [16] w) mem)) - // cond: x.Uses == 1 && clobber(x) - // result: (MOVWstoreidx [i-2] {s} p idx w mem) - for { - i := v.AuxInt - s := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - p := v_0 - idx := v_1 - w := v_2 - x := v_3 - if x.Op != OpS390XMOVHstoreidx || x.AuxInt != i-2 || x.Aux != s { - continue - } - mem := x.Args[3] - x_0 := x.Args[0] - x_1 := x.Args[1] - for _i1 := 0; _i1 <= 1; _i1, x_0, x_1 = _i1+1, x_1, x_0 { - if p != x_0 || idx != x_1 { - continue - } - x_2 := x.Args[2] - if x_2.Op != OpS390XSRDconst || x_2.AuxInt != 16 || w != x_2.Args[0] || !(x.Uses == 1 && clobber(x)) { - continue - } - v.reset(OpS390XMOVWstoreidx) - v.AuxInt = i - 2 - v.Aux = s - v.AddArg4(p, idx, w, mem) - return true - } - } - break - } - // match: (MOVHstoreidx [i] {s} p idx w0:(SRDconst [j] w) x:(MOVHstoreidx [i-2] {s} p idx (SRDconst [j+16] w) mem)) - // cond: x.Uses == 1 && clobber(x) - // result: (MOVWstoreidx [i-2] {s} p idx w0 mem) - for { - i := v.AuxInt - s := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - p := v_0 - idx := v_1 - w0 := v_2 - if w0.Op != OpS390XSRDconst { - continue - } - j := w0.AuxInt - w := w0.Args[0] - x := v_3 - if x.Op != OpS390XMOVHstoreidx || x.AuxInt != i-2 || x.Aux != s { - continue - } - mem := x.Args[3] - x_0 := x.Args[0] - x_1 := x.Args[1] - for _i1 := 0; _i1 <= 1; _i1, x_0, x_1 = _i1+1, x_1, x_0 { - if p != x_0 || idx != x_1 { - continue - } - x_2 := x.Args[2] - if x_2.Op != OpS390XSRDconst || x_2.AuxInt != j+16 || w != x_2.Args[0] || !(x.Uses == 1 && clobber(x)) { - continue - } - v.reset(OpS390XMOVWstoreidx) - v.AuxInt = i - 2 - v.Aux = s - v.AddArg4(p, idx, w0, mem) - return true - } - } - break - } - // match: (MOVHstoreidx [i] {s} p idx w x:(MOVHstoreidx [i-2] {s} p idx (SRWconst [16] w) mem)) - // cond: x.Uses == 1 && clobber(x) - // result: (MOVWstoreidx [i-2] {s} p idx w mem) - for { - i := v.AuxInt - s := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - p := v_0 - idx := v_1 - w := v_2 - x := v_3 - if x.Op != OpS390XMOVHstoreidx || x.AuxInt != i-2 || x.Aux != s { - continue - } - mem := x.Args[3] - x_0 := x.Args[0] - x_1 := x.Args[1] - for _i1 := 0; _i1 <= 1; _i1, x_0, x_1 = _i1+1, x_1, x_0 { - if p != x_0 || idx != x_1 { - continue - } - x_2 := x.Args[2] - if x_2.Op != OpS390XSRWconst || x_2.AuxInt != 16 || w != x_2.Args[0] || !(x.Uses == 1 && clobber(x)) { - continue - } - v.reset(OpS390XMOVWstoreidx) - v.AuxInt = i - 2 - v.Aux = s - v.AddArg4(p, idx, w, mem) - return true - } - } - break - } - // match: (MOVHstoreidx [i] {s} p idx w0:(SRWconst [j] w) x:(MOVHstoreidx [i-2] {s} p idx (SRWconst [j+16] w) mem)) - // cond: x.Uses == 1 && clobber(x) - // result: (MOVWstoreidx [i-2] {s} p idx w0 mem) - for { - i := v.AuxInt - s := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - p := v_0 - idx := v_1 - w0 := v_2 - if w0.Op != OpS390XSRWconst { - continue - } - j := w0.AuxInt - w := w0.Args[0] - x := v_3 - if x.Op != OpS390XMOVHstoreidx || x.AuxInt != i-2 || x.Aux != s { - continue - } - mem := x.Args[3] - x_0 := x.Args[0] - x_1 := x.Args[1] - for _i1 := 0; _i1 <= 1; _i1, x_0, x_1 = _i1+1, x_1, x_0 { - if p != x_0 || idx != x_1 { - continue - } - x_2 := x.Args[2] - if x_2.Op != OpS390XSRWconst || x_2.AuxInt != j+16 || w != x_2.Args[0] || !(x.Uses == 1 && clobber(x)) { - continue - } - v.reset(OpS390XMOVWstoreidx) - v.AuxInt = i - 2 - v.Aux = s - v.AddArg4(p, idx, w0, mem) - return true - } - } - break - } - return false -} func rewriteValueS390X_OpS390XMOVWBRstore(v *Value) bool { v_2 := v.Args[2] v_1 := v.Args[1] @@ -12356,15 +10270,15 @@ func rewriteValueS390X_OpS390XMOVWBRstore(v *Value) bool { // cond: x.Uses == 1 && clobber(x) // result: (MOVDBRstore [i-4] {s} p w mem) for { - i := v.AuxInt - s := v.Aux + i := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) p := v_0 - if v_1.Op != OpS390XSRDconst || v_1.AuxInt != 32 { + if v_1.Op != OpS390XSRDconst || auxIntToInt8(v_1.AuxInt) != 32 { break } w := v_1.Args[0] x := v_2 - if x.Op != OpS390XMOVWBRstore || x.AuxInt != i-4 || x.Aux != s { + if x.Op != OpS390XMOVWBRstore || auxIntToInt32(x.AuxInt) != i-4 || auxToSym(x.Aux) != s { break } mem := x.Args[2] @@ -12372,8 +10286,8 @@ func rewriteValueS390X_OpS390XMOVWBRstore(v *Value) bool { break } v.reset(OpS390XMOVDBRstore) - v.AuxInt = i - 4 - v.Aux = s + v.AuxInt = int32ToAuxInt(i - 4) + v.Aux = symToAux(s) v.AddArg3(p, w, mem) return true } @@ -12381,16 +10295,16 @@ func rewriteValueS390X_OpS390XMOVWBRstore(v *Value) bool { // cond: x.Uses == 1 && clobber(x) // result: (MOVDBRstore [i-4] {s} p w0 mem) for { - i := v.AuxInt - s := v.Aux + i := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) p := v_0 if v_1.Op != OpS390XSRDconst { break } - j := v_1.AuxInt + j := auxIntToInt8(v_1.AuxInt) w := v_1.Args[0] x := v_2 - if x.Op != OpS390XMOVWBRstore || x.AuxInt != i-4 || x.Aux != s { + if x.Op != OpS390XMOVWBRstore || auxIntToInt32(x.AuxInt) != i-4 || auxToSym(x.Aux) != s { break } mem := x.Args[2] @@ -12398,95 +10312,17 @@ func rewriteValueS390X_OpS390XMOVWBRstore(v *Value) bool { break } w0 := x.Args[1] - if w0.Op != OpS390XSRDconst || w0.AuxInt != j-32 || w != w0.Args[0] || !(x.Uses == 1 && clobber(x)) { + if w0.Op != OpS390XSRDconst || auxIntToInt8(w0.AuxInt) != j-32 || w != w0.Args[0] || !(x.Uses == 1 && clobber(x)) { break } v.reset(OpS390XMOVDBRstore) - v.AuxInt = i - 4 - v.Aux = s + v.AuxInt = int32ToAuxInt(i - 4) + v.Aux = symToAux(s) v.AddArg3(p, w0, mem) return true } return false } -func rewriteValueS390X_OpS390XMOVWBRstoreidx(v *Value) bool { - v_3 := v.Args[3] - v_2 := v.Args[2] - v_1 := v.Args[1] - v_0 := v.Args[0] - // match: (MOVWBRstoreidx [i] {s} p idx (SRDconst [32] w) x:(MOVWBRstoreidx [i-4] {s} p idx w mem)) - // cond: x.Uses == 1 && clobber(x) - // result: (MOVDBRstoreidx [i-4] {s} p idx w mem) - for { - i := v.AuxInt - s := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - p := v_0 - idx := v_1 - if v_2.Op != OpS390XSRDconst || v_2.AuxInt != 32 { - continue - } - w := v_2.Args[0] - x := v_3 - if x.Op != OpS390XMOVWBRstoreidx || x.AuxInt != i-4 || x.Aux != s { - continue - } - mem := x.Args[3] - x_0 := x.Args[0] - x_1 := x.Args[1] - for _i1 := 0; _i1 <= 1; _i1, x_0, x_1 = _i1+1, x_1, x_0 { - if p != x_0 || idx != x_1 || w != x.Args[2] || !(x.Uses == 1 && clobber(x)) { - continue - } - v.reset(OpS390XMOVDBRstoreidx) - v.AuxInt = i - 4 - v.Aux = s - v.AddArg4(p, idx, w, mem) - return true - } - } - break - } - // match: (MOVWBRstoreidx [i] {s} p idx (SRDconst [j] w) x:(MOVWBRstoreidx [i-4] {s} p idx w0:(SRDconst [j-32] w) mem)) - // cond: x.Uses == 1 && clobber(x) - // result: (MOVDBRstoreidx [i-4] {s} p idx w0 mem) - for { - i := v.AuxInt - s := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - p := v_0 - idx := v_1 - if v_2.Op != OpS390XSRDconst { - continue - } - j := v_2.AuxInt - w := v_2.Args[0] - x := v_3 - if x.Op != OpS390XMOVWBRstoreidx || x.AuxInt != i-4 || x.Aux != s { - continue - } - mem := x.Args[3] - x_0 := x.Args[0] - x_1 := x.Args[1] - for _i1 := 0; _i1 <= 1; _i1, x_0, x_1 = _i1+1, x_1, x_0 { - if p != x_0 || idx != x_1 { - continue - } - w0 := x.Args[2] - if w0.Op != OpS390XSRDconst || w0.AuxInt != j-32 || w != w0.Args[0] || !(x.Uses == 1 && clobber(x)) { - continue - } - v.reset(OpS390XMOVDBRstoreidx) - v.AuxInt = i - 4 - v.Aux = s - v.AddArg4(p, idx, w0, mem) - return true - } - } - break - } - return false -} func rewriteValueS390X_OpS390XMOVWZload(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] @@ -12510,155 +10346,49 @@ func rewriteValueS390X_OpS390XMOVWZload(v *Value) bool { return true } // match: (MOVWZload [off1] {sym} (ADDconst [off2] ptr) mem) - // cond: is20Bit(off1+off2) + // cond: is20Bit(int64(off1)+int64(off2)) // result: (MOVWZload [off1+off2] {sym} ptr mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpS390XADDconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) ptr := v_0.Args[0] mem := v_1 - if !(is20Bit(off1 + off2)) { + if !(is20Bit(int64(off1) + int64(off2))) { break } v.reset(OpS390XMOVWZload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg2(ptr, mem) return true } // match: (MOVWZload [off1] {sym1} (MOVDaddr <t> [off2] {sym2} base) mem) - // cond: is32Bit(off1+off2) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%4 == 0 && (off1+off2)%4 == 0)) - // result: (MOVWZload [off1+off2] {mergeSym(sym1,sym2)} base mem) + // cond: is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%4 == 0 && (off1+off2)%4 == 0)) + // result: (MOVWZload [off1+off2] {mergeSymTyped(sym1,sym2)} base mem) for { - off1 := v.AuxInt - sym1 := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym1 := auxToSym(v.Aux) if v_0.Op != OpS390XMOVDaddr { break } t := v_0.Type - off2 := v_0.AuxInt - sym2 := v_0.Aux + off2 := auxIntToInt32(v_0.AuxInt) + sym2 := auxToSym(v_0.Aux) base := v_0.Args[0] mem := v_1 - if !(is32Bit(off1+off2) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%4 == 0 && (off1+off2)%4 == 0))) { + if !(is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%4 == 0 && (off1+off2)%4 == 0))) { break } v.reset(OpS390XMOVWZload) - v.AuxInt = off1 + off2 - v.Aux = mergeSym(sym1, sym2) + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(mergeSymTyped(sym1, sym2)) v.AddArg2(base, mem) return true } - // match: (MOVWZload [off1] {sym1} (MOVDaddridx [off2] {sym2} ptr idx) mem) - // cond: is32Bit(off1+off2) && canMergeSym(sym1, sym2) - // result: (MOVWZloadidx [off1+off2] {mergeSym(sym1,sym2)} ptr idx mem) - for { - off1 := v.AuxInt - sym1 := v.Aux - if v_0.Op != OpS390XMOVDaddridx { - break - } - off2 := v_0.AuxInt - sym2 := v_0.Aux - idx := v_0.Args[1] - ptr := v_0.Args[0] - mem := v_1 - if !(is32Bit(off1+off2) && canMergeSym(sym1, sym2)) { - break - } - v.reset(OpS390XMOVWZloadidx) - v.AuxInt = off1 + off2 - v.Aux = mergeSym(sym1, sym2) - v.AddArg3(ptr, idx, mem) - return true - } - // match: (MOVWZload [off] {sym} (ADD ptr idx) mem) - // cond: ptr.Op != OpSB - // result: (MOVWZloadidx [off] {sym} ptr idx mem) - for { - off := auxIntToInt32(v.AuxInt) - sym := auxToSym(v.Aux) - if v_0.Op != OpS390XADD { - break - } - _ = v_0.Args[1] - v_0_0 := v_0.Args[0] - v_0_1 := v_0.Args[1] - for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { - ptr := v_0_0 - idx := v_0_1 - mem := v_1 - if !(ptr.Op != OpSB) { - continue - } - v.reset(OpS390XMOVWZloadidx) - v.AuxInt = int32ToAuxInt(off) - v.Aux = symToAux(sym) - v.AddArg3(ptr, idx, mem) - return true - } - break - } - return false -} -func rewriteValueS390X_OpS390XMOVWZloadidx(v *Value) bool { - v_2 := v.Args[2] - v_1 := v.Args[1] - v_0 := v.Args[0] - // match: (MOVWZloadidx [c] {sym} (ADDconst [d] ptr) idx mem) - // cond: is20Bit(c+d) - // result: (MOVWZloadidx [c+d] {sym} ptr idx mem) - for { - c := v.AuxInt - sym := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - if v_0.Op != OpS390XADDconst { - continue - } - d := v_0.AuxInt - ptr := v_0.Args[0] - idx := v_1 - mem := v_2 - if !(is20Bit(c + d)) { - continue - } - v.reset(OpS390XMOVWZloadidx) - v.AuxInt = c + d - v.Aux = sym - v.AddArg3(ptr, idx, mem) - return true - } - break - } - // match: (MOVWZloadidx [c] {sym} ptr (ADDconst [d] idx) mem) - // cond: is20Bit(c+d) - // result: (MOVWZloadidx [c+d] {sym} ptr idx mem) - for { - c := v.AuxInt - sym := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - ptr := v_0 - if v_1.Op != OpS390XADDconst { - continue - } - d := v_1.AuxInt - idx := v_1.Args[0] - mem := v_2 - if !(is20Bit(c + d)) { - continue - } - v.reset(OpS390XMOVWZloadidx) - v.AuxInt = c + d - v.Aux = sym - v.AddArg3(ptr, idx, mem) - return true - } - break - } return false } func rewriteValueS390X_OpS390XMOVWZreg(v *Value) bool { @@ -12739,17 +10469,6 @@ func rewriteValueS390X_OpS390XMOVWZreg(v *Value) bool { v.copyOf(x) return true } - // match: (MOVWZreg x:(MOVBZloadidx _ _ _)) - // cond: (!x.Type.IsSigned() || x.Type.Size() > 1) - // result: x - for { - x := v_0 - if x.Op != OpS390XMOVBZloadidx || !(!x.Type.IsSigned() || x.Type.Size() > 1) { - break - } - v.copyOf(x) - return true - } // match: (MOVWZreg x:(MOVHZload _ _)) // cond: (!x.Type.IsSigned() || x.Type.Size() > 2) // result: x @@ -12761,17 +10480,6 @@ func rewriteValueS390X_OpS390XMOVWZreg(v *Value) bool { v.copyOf(x) return true } - // match: (MOVWZreg x:(MOVHZloadidx _ _ _)) - // cond: (!x.Type.IsSigned() || x.Type.Size() > 2) - // result: x - for { - x := v_0 - if x.Op != OpS390XMOVHZloadidx || !(!x.Type.IsSigned() || x.Type.Size() > 2) { - break - } - v.copyOf(x) - return true - } // match: (MOVWZreg x:(MOVWZload _ _)) // cond: (!x.Type.IsSigned() || x.Type.Size() > 4) // result: x @@ -12783,17 +10491,6 @@ func rewriteValueS390X_OpS390XMOVWZreg(v *Value) bool { v.copyOf(x) return true } - // match: (MOVWZreg x:(MOVWZloadidx _ _ _)) - // cond: (!x.Type.IsSigned() || x.Type.Size() > 4) - // result: x - for { - x := v_0 - if x.Op != OpS390XMOVWZloadidx || !(!x.Type.IsSigned() || x.Type.Size() > 4) { - break - } - v.copyOf(x) - return true - } // match: (MOVWZreg <t> x:(MOVWload [o] {s} p mem)) // cond: x.Uses == 1 && clobber(x) // result: @x.Block (MOVWZload <t> [o] {s} p mem) @@ -12818,31 +10515,6 @@ func rewriteValueS390X_OpS390XMOVWZreg(v *Value) bool { v0.AddArg2(p, mem) return true } - // match: (MOVWZreg <t> x:(MOVWloadidx [o] {s} p i mem)) - // cond: x.Uses == 1 && clobber(x) - // result: @x.Block (MOVWZloadidx <t> [o] {s} p i mem) - for { - t := v.Type - x := v_0 - if x.Op != OpS390XMOVWloadidx { - break - } - o := auxIntToInt32(x.AuxInt) - s := auxToSym(x.Aux) - mem := x.Args[2] - p := x.Args[0] - i := x.Args[1] - if !(x.Uses == 1 && clobber(x)) { - break - } - b = x.Block - v0 := b.NewValue0(v.Pos, OpS390XMOVWZloadidx, t) - v.copyOf(v0) - v0.AuxInt = int32ToAuxInt(o) - v0.Aux = symToAux(s) - v0.AddArg3(p, i, mem) - return true - } // match: (MOVWZreg x:(Arg <t>)) // cond: !t.IsSigned() && t.Size() <= 4 // result: x @@ -12894,155 +10566,49 @@ func rewriteValueS390X_OpS390XMOVWload(v *Value) bool { return true } // match: (MOVWload [off1] {sym} (ADDconst [off2] ptr) mem) - // cond: is20Bit(off1+off2) + // cond: is20Bit(int64(off1)+int64(off2)) // result: (MOVWload [off1+off2] {sym} ptr mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpS390XADDconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) ptr := v_0.Args[0] mem := v_1 - if !(is20Bit(off1 + off2)) { + if !(is20Bit(int64(off1) + int64(off2))) { break } v.reset(OpS390XMOVWload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg2(ptr, mem) return true } // match: (MOVWload [off1] {sym1} (MOVDaddr <t> [off2] {sym2} base) mem) - // cond: is32Bit(off1+off2) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%4 == 0 && (off1+off2)%4 == 0)) - // result: (MOVWload [off1+off2] {mergeSym(sym1,sym2)} base mem) + // cond: is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%4 == 0 && (off1+off2)%4 == 0)) + // result: (MOVWload [off1+off2] {mergeSymTyped(sym1,sym2)} base mem) for { - off1 := v.AuxInt - sym1 := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym1 := auxToSym(v.Aux) if v_0.Op != OpS390XMOVDaddr { break } t := v_0.Type - off2 := v_0.AuxInt - sym2 := v_0.Aux + off2 := auxIntToInt32(v_0.AuxInt) + sym2 := auxToSym(v_0.Aux) base := v_0.Args[0] mem := v_1 - if !(is32Bit(off1+off2) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%4 == 0 && (off1+off2)%4 == 0))) { + if !(is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%4 == 0 && (off1+off2)%4 == 0))) { break } v.reset(OpS390XMOVWload) - v.AuxInt = off1 + off2 - v.Aux = mergeSym(sym1, sym2) + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(mergeSymTyped(sym1, sym2)) v.AddArg2(base, mem) return true } - // match: (MOVWload [off1] {sym1} (MOVDaddridx [off2] {sym2} ptr idx) mem) - // cond: is32Bit(off1+off2) && canMergeSym(sym1, sym2) - // result: (MOVWloadidx [off1+off2] {mergeSym(sym1,sym2)} ptr idx mem) - for { - off1 := v.AuxInt - sym1 := v.Aux - if v_0.Op != OpS390XMOVDaddridx { - break - } - off2 := v_0.AuxInt - sym2 := v_0.Aux - idx := v_0.Args[1] - ptr := v_0.Args[0] - mem := v_1 - if !(is32Bit(off1+off2) && canMergeSym(sym1, sym2)) { - break - } - v.reset(OpS390XMOVWloadidx) - v.AuxInt = off1 + off2 - v.Aux = mergeSym(sym1, sym2) - v.AddArg3(ptr, idx, mem) - return true - } - // match: (MOVWload [off] {sym} (ADD ptr idx) mem) - // cond: ptr.Op != OpSB - // result: (MOVWloadidx [off] {sym} ptr idx mem) - for { - off := auxIntToInt32(v.AuxInt) - sym := auxToSym(v.Aux) - if v_0.Op != OpS390XADD { - break - } - _ = v_0.Args[1] - v_0_0 := v_0.Args[0] - v_0_1 := v_0.Args[1] - for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { - ptr := v_0_0 - idx := v_0_1 - mem := v_1 - if !(ptr.Op != OpSB) { - continue - } - v.reset(OpS390XMOVWloadidx) - v.AuxInt = int32ToAuxInt(off) - v.Aux = symToAux(sym) - v.AddArg3(ptr, idx, mem) - return true - } - break - } - return false -} -func rewriteValueS390X_OpS390XMOVWloadidx(v *Value) bool { - v_2 := v.Args[2] - v_1 := v.Args[1] - v_0 := v.Args[0] - // match: (MOVWloadidx [c] {sym} (ADDconst [d] ptr) idx mem) - // cond: is20Bit(c+d) - // result: (MOVWloadidx [c+d] {sym} ptr idx mem) - for { - c := v.AuxInt - sym := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - if v_0.Op != OpS390XADDconst { - continue - } - d := v_0.AuxInt - ptr := v_0.Args[0] - idx := v_1 - mem := v_2 - if !(is20Bit(c + d)) { - continue - } - v.reset(OpS390XMOVWloadidx) - v.AuxInt = c + d - v.Aux = sym - v.AddArg3(ptr, idx, mem) - return true - } - break - } - // match: (MOVWloadidx [c] {sym} ptr (ADDconst [d] idx) mem) - // cond: is20Bit(c+d) - // result: (MOVWloadidx [c+d] {sym} ptr idx mem) - for { - c := v.AuxInt - sym := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - ptr := v_0 - if v_1.Op != OpS390XADDconst { - continue - } - d := v_1.AuxInt - idx := v_1.Args[0] - mem := v_2 - if !(is20Bit(c + d)) { - continue - } - v.reset(OpS390XMOVWloadidx) - v.AuxInt = c + d - v.Aux = sym - v.AddArg3(ptr, idx, mem) - return true - } - break - } return false } func rewriteValueS390X_OpS390XMOVWreg(v *Value) bool { @@ -13123,17 +10689,6 @@ func rewriteValueS390X_OpS390XMOVWreg(v *Value) bool { v.copyOf(x) return true } - // match: (MOVWreg x:(MOVBloadidx _ _ _)) - // cond: (x.Type.IsSigned() || x.Type.Size() == 8) - // result: x - for { - x := v_0 - if x.Op != OpS390XMOVBloadidx || !(x.Type.IsSigned() || x.Type.Size() == 8) { - break - } - v.copyOf(x) - return true - } // match: (MOVWreg x:(MOVHload _ _)) // cond: (x.Type.IsSigned() || x.Type.Size() == 8) // result: x @@ -13145,17 +10700,6 @@ func rewriteValueS390X_OpS390XMOVWreg(v *Value) bool { v.copyOf(x) return true } - // match: (MOVWreg x:(MOVHloadidx _ _ _)) - // cond: (x.Type.IsSigned() || x.Type.Size() == 8) - // result: x - for { - x := v_0 - if x.Op != OpS390XMOVHloadidx || !(x.Type.IsSigned() || x.Type.Size() == 8) { - break - } - v.copyOf(x) - return true - } // match: (MOVWreg x:(MOVWload _ _)) // cond: (x.Type.IsSigned() || x.Type.Size() == 8) // result: x @@ -13167,17 +10711,6 @@ func rewriteValueS390X_OpS390XMOVWreg(v *Value) bool { v.copyOf(x) return true } - // match: (MOVWreg x:(MOVWloadidx _ _ _)) - // cond: (x.Type.IsSigned() || x.Type.Size() == 8) - // result: x - for { - x := v_0 - if x.Op != OpS390XMOVWloadidx || !(x.Type.IsSigned() || x.Type.Size() == 8) { - break - } - v.copyOf(x) - return true - } // match: (MOVWreg x:(MOVBZload _ _)) // cond: (!x.Type.IsSigned() || x.Type.Size() > 1) // result: x @@ -13189,17 +10722,6 @@ func rewriteValueS390X_OpS390XMOVWreg(v *Value) bool { v.copyOf(x) return true } - // match: (MOVWreg x:(MOVBZloadidx _ _ _)) - // cond: (!x.Type.IsSigned() || x.Type.Size() > 1) - // result: x - for { - x := v_0 - if x.Op != OpS390XMOVBZloadidx || !(!x.Type.IsSigned() || x.Type.Size() > 1) { - break - } - v.copyOf(x) - return true - } // match: (MOVWreg x:(MOVHZload _ _)) // cond: (!x.Type.IsSigned() || x.Type.Size() > 2) // result: x @@ -13211,17 +10733,6 @@ func rewriteValueS390X_OpS390XMOVWreg(v *Value) bool { v.copyOf(x) return true } - // match: (MOVWreg x:(MOVHZloadidx _ _ _)) - // cond: (!x.Type.IsSigned() || x.Type.Size() > 2) - // result: x - for { - x := v_0 - if x.Op != OpS390XMOVHZloadidx || !(!x.Type.IsSigned() || x.Type.Size() > 2) { - break - } - v.copyOf(x) - return true - } // match: (MOVWreg <t> x:(MOVWZload [o] {s} p mem)) // cond: x.Uses == 1 && clobber(x) // result: @x.Block (MOVWload <t> [o] {s} p mem) @@ -13246,31 +10757,6 @@ func rewriteValueS390X_OpS390XMOVWreg(v *Value) bool { v0.AddArg2(p, mem) return true } - // match: (MOVWreg <t> x:(MOVWZloadidx [o] {s} p i mem)) - // cond: x.Uses == 1 && clobber(x) - // result: @x.Block (MOVWloadidx <t> [o] {s} p i mem) - for { - t := v.Type - x := v_0 - if x.Op != OpS390XMOVWZloadidx { - break - } - o := auxIntToInt32(x.AuxInt) - s := auxToSym(x.Aux) - mem := x.Args[2] - p := x.Args[0] - i := x.Args[1] - if !(x.Uses == 1 && clobber(x)) { - break - } - b = x.Block - v0 := b.NewValue0(v.Pos, OpS390XMOVWloadidx, t) - v.copyOf(v0) - v0.AuxInt = int32ToAuxInt(o) - v0.Aux = symToAux(s) - v0.AddArg3(p, i, mem) - return true - } // match: (MOVWreg x:(Arg <t>)) // cond: t.IsSigned() && t.Size() <= 4 // result: x @@ -13338,137 +10824,85 @@ func rewriteValueS390X_OpS390XMOVWstore(v *Value) bool { return true } // match: (MOVWstore [off1] {sym} (ADDconst [off2] ptr) val mem) - // cond: is20Bit(off1+off2) + // cond: is20Bit(int64(off1)+int64(off2)) // result: (MOVWstore [off1+off2] {sym} ptr val mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) if v_0.Op != OpS390XADDconst { break } - off2 := v_0.AuxInt + off2 := auxIntToInt32(v_0.AuxInt) ptr := v_0.Args[0] val := v_1 mem := v_2 - if !(is20Bit(off1 + off2)) { + if !(is20Bit(int64(off1) + int64(off2))) { break } v.reset(OpS390XMOVWstore) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(ptr, val, mem) return true } // match: (MOVWstore [off] {sym} ptr (MOVDconst [c]) mem) - // cond: is16Bit(c) && isU12Bit(off) && ptr.Op != OpSB - // result: (MOVWstoreconst [makeValAndOff(int64(int32(c)),off)] {sym} ptr mem) + // cond: is16Bit(c) && isU12Bit(int64(off)) && ptr.Op != OpSB + // result: (MOVWstoreconst [makeValAndOff32(int32(c),off)] {sym} ptr mem) for { - off := v.AuxInt - sym := v.Aux + off := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) ptr := v_0 if v_1.Op != OpS390XMOVDconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) mem := v_2 - if !(is16Bit(c) && isU12Bit(off) && ptr.Op != OpSB) { + if !(is16Bit(c) && isU12Bit(int64(off)) && ptr.Op != OpSB) { break } v.reset(OpS390XMOVWstoreconst) - v.AuxInt = makeValAndOff(int64(int32(c)), off) - v.Aux = sym + v.AuxInt = valAndOffToAuxInt(makeValAndOff32(int32(c), off)) + v.Aux = symToAux(sym) v.AddArg2(ptr, mem) return true } // match: (MOVWstore [off1] {sym1} (MOVDaddr <t> [off2] {sym2} base) val mem) - // cond: is32Bit(off1+off2) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%4 == 0 && (off1+off2)%4 == 0)) - // result: (MOVWstore [off1+off2] {mergeSym(sym1,sym2)} base val mem) + // cond: is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%4 == 0 && (off1+off2)%4 == 0)) + // result: (MOVWstore [off1+off2] {mergeSymTyped(sym1,sym2)} base val mem) for { - off1 := v.AuxInt - sym1 := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym1 := auxToSym(v.Aux) if v_0.Op != OpS390XMOVDaddr { break } t := v_0.Type - off2 := v_0.AuxInt - sym2 := v_0.Aux + off2 := auxIntToInt32(v_0.AuxInt) + sym2 := auxToSym(v_0.Aux) base := v_0.Args[0] val := v_1 mem := v_2 - if !(is32Bit(off1+off2) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%4 == 0 && (off1+off2)%4 == 0))) { + if !(is32Bit(int64(off1)+int64(off2)) && canMergeSym(sym1, sym2) && (base.Op != OpSB || (t.IsPtr() && t.Elem().Alignment()%4 == 0 && (off1+off2)%4 == 0))) { break } v.reset(OpS390XMOVWstore) - v.AuxInt = off1 + off2 - v.Aux = mergeSym(sym1, sym2) + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(mergeSymTyped(sym1, sym2)) v.AddArg3(base, val, mem) return true } - // match: (MOVWstore [off1] {sym1} (MOVDaddridx [off2] {sym2} ptr idx) val mem) - // cond: is32Bit(off1+off2) && canMergeSym(sym1, sym2) - // result: (MOVWstoreidx [off1+off2] {mergeSym(sym1,sym2)} ptr idx val mem) - for { - off1 := v.AuxInt - sym1 := v.Aux - if v_0.Op != OpS390XMOVDaddridx { - break - } - off2 := v_0.AuxInt - sym2 := v_0.Aux - idx := v_0.Args[1] - ptr := v_0.Args[0] - val := v_1 - mem := v_2 - if !(is32Bit(off1+off2) && canMergeSym(sym1, sym2)) { - break - } - v.reset(OpS390XMOVWstoreidx) - v.AuxInt = off1 + off2 - v.Aux = mergeSym(sym1, sym2) - v.AddArg4(ptr, idx, val, mem) - return true - } - // match: (MOVWstore [off] {sym} (ADD ptr idx) val mem) - // cond: ptr.Op != OpSB - // result: (MOVWstoreidx [off] {sym} ptr idx val mem) - for { - off := auxIntToInt32(v.AuxInt) - sym := auxToSym(v.Aux) - if v_0.Op != OpS390XADD { - break - } - _ = v_0.Args[1] - v_0_0 := v_0.Args[0] - v_0_1 := v_0.Args[1] - for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { - ptr := v_0_0 - idx := v_0_1 - val := v_1 - mem := v_2 - if !(ptr.Op != OpSB) { - continue - } - v.reset(OpS390XMOVWstoreidx) - v.AuxInt = int32ToAuxInt(off) - v.Aux = symToAux(sym) - v.AddArg4(ptr, idx, val, mem) - return true - } - break - } // match: (MOVWstore [i] {s} p (SRDconst [32] w) x:(MOVWstore [i-4] {s} p w mem)) // cond: p.Op != OpSB && x.Uses == 1 && clobber(x) // result: (MOVDstore [i-4] {s} p w mem) for { - i := v.AuxInt - s := v.Aux + i := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) p := v_0 - if v_1.Op != OpS390XSRDconst || v_1.AuxInt != 32 { + if v_1.Op != OpS390XSRDconst || auxIntToInt8(v_1.AuxInt) != 32 { break } w := v_1.Args[0] x := v_2 - if x.Op != OpS390XMOVWstore || x.AuxInt != i-4 || x.Aux != s { + if x.Op != OpS390XMOVWstore || auxIntToInt32(x.AuxInt) != i-4 || auxToSym(x.Aux) != s { break } mem := x.Args[2] @@ -13476,8 +10910,8 @@ func rewriteValueS390X_OpS390XMOVWstore(v *Value) bool { break } v.reset(OpS390XMOVDstore) - v.AuxInt = i - 4 - v.Aux = s + v.AuxInt = int32ToAuxInt(i - 4) + v.Aux = symToAux(s) v.AddArg3(p, w, mem) return true } @@ -13485,17 +10919,17 @@ func rewriteValueS390X_OpS390XMOVWstore(v *Value) bool { // cond: p.Op != OpSB && x.Uses == 1 && clobber(x) // result: (MOVDstore [i-4] {s} p w0 mem) for { - i := v.AuxInt - s := v.Aux + i := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) p := v_0 w0 := v_1 if w0.Op != OpS390XSRDconst { break } - j := w0.AuxInt + j := auxIntToInt8(w0.AuxInt) w := w0.Args[0] x := v_2 - if x.Op != OpS390XMOVWstore || x.AuxInt != i-4 || x.Aux != s { + if x.Op != OpS390XMOVWstore || auxIntToInt32(x.AuxInt) != i-4 || auxToSym(x.Aux) != s { break } mem := x.Args[2] @@ -13503,25 +10937,25 @@ func rewriteValueS390X_OpS390XMOVWstore(v *Value) bool { break } x_1 := x.Args[1] - if x_1.Op != OpS390XSRDconst || x_1.AuxInt != j+32 || w != x_1.Args[0] || !(p.Op != OpSB && x.Uses == 1 && clobber(x)) { + if x_1.Op != OpS390XSRDconst || auxIntToInt8(x_1.AuxInt) != j+32 || w != x_1.Args[0] || !(p.Op != OpSB && x.Uses == 1 && clobber(x)) { break } v.reset(OpS390XMOVDstore) - v.AuxInt = i - 4 - v.Aux = s + v.AuxInt = int32ToAuxInt(i - 4) + v.Aux = symToAux(s) v.AddArg3(p, w0, mem) return true } // match: (MOVWstore [i] {s} p w1 x:(MOVWstore [i-4] {s} p w0 mem)) - // cond: p.Op != OpSB && x.Uses == 1 && is20Bit(i-4) && clobber(x) + // cond: p.Op != OpSB && x.Uses == 1 && is20Bit(int64(i)-4) && clobber(x) // result: (STM2 [i-4] {s} p w0 w1 mem) for { - i := v.AuxInt - s := v.Aux + i := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) p := v_0 w1 := v_1 x := v_2 - if x.Op != OpS390XMOVWstore || x.AuxInt != i-4 || x.Aux != s { + if x.Op != OpS390XMOVWstore || auxIntToInt32(x.AuxInt) != i-4 || auxToSym(x.Aux) != s { break } mem := x.Args[2] @@ -13529,25 +10963,25 @@ func rewriteValueS390X_OpS390XMOVWstore(v *Value) bool { break } w0 := x.Args[1] - if !(p.Op != OpSB && x.Uses == 1 && is20Bit(i-4) && clobber(x)) { + if !(p.Op != OpSB && x.Uses == 1 && is20Bit(int64(i)-4) && clobber(x)) { break } v.reset(OpS390XSTM2) - v.AuxInt = i - 4 - v.Aux = s + v.AuxInt = int32ToAuxInt(i - 4) + v.Aux = symToAux(s) v.AddArg4(p, w0, w1, mem) return true } // match: (MOVWstore [i] {s} p w2 x:(STM2 [i-8] {s} p w0 w1 mem)) - // cond: x.Uses == 1 && is20Bit(i-8) && clobber(x) + // cond: x.Uses == 1 && is20Bit(int64(i)-8) && clobber(x) // result: (STM3 [i-8] {s} p w0 w1 w2 mem) for { - i := v.AuxInt - s := v.Aux + i := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) p := v_0 w2 := v_1 x := v_2 - if x.Op != OpS390XSTM2 || x.AuxInt != i-8 || x.Aux != s { + if x.Op != OpS390XSTM2 || auxIntToInt32(x.AuxInt) != i-8 || auxToSym(x.Aux) != s { break } mem := x.Args[3] @@ -13556,25 +10990,25 @@ func rewriteValueS390X_OpS390XMOVWstore(v *Value) bool { } w0 := x.Args[1] w1 := x.Args[2] - if !(x.Uses == 1 && is20Bit(i-8) && clobber(x)) { + if !(x.Uses == 1 && is20Bit(int64(i)-8) && clobber(x)) { break } v.reset(OpS390XSTM3) - v.AuxInt = i - 8 - v.Aux = s + v.AuxInt = int32ToAuxInt(i - 8) + v.Aux = symToAux(s) v.AddArg5(p, w0, w1, w2, mem) return true } // match: (MOVWstore [i] {s} p w3 x:(STM3 [i-12] {s} p w0 w1 w2 mem)) - // cond: x.Uses == 1 && is20Bit(i-12) && clobber(x) + // cond: x.Uses == 1 && is20Bit(int64(i)-12) && clobber(x) // result: (STM4 [i-12] {s} p w0 w1 w2 w3 mem) for { - i := v.AuxInt - s := v.Aux + i := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) p := v_0 w3 := v_1 x := v_2 - if x.Op != OpS390XSTM3 || x.AuxInt != i-12 || x.Aux != s { + if x.Op != OpS390XSTM3 || auxIntToInt32(x.AuxInt) != i-12 || auxToSym(x.Aux) != s { break } mem := x.Args[4] @@ -13584,12 +11018,12 @@ func rewriteValueS390X_OpS390XMOVWstore(v *Value) bool { w0 := x.Args[1] w1 := x.Args[2] w2 := x.Args[3] - if !(x.Uses == 1 && is20Bit(i-12) && clobber(x)) { + if !(x.Uses == 1 && is20Bit(int64(i)-12) && clobber(x)) { break } v.reset(OpS390XSTM4) - v.AuxInt = i - 12 - v.Aux = s + v.AuxInt = int32ToAuxInt(i - 12) + v.Aux = symToAux(s) v.AddArg6(p, w0, w1, w2, w3, mem) return true } @@ -13601,234 +11035,102 @@ func rewriteValueS390X_OpS390XMOVWstoreconst(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (MOVWstoreconst [sc] {s} (ADDconst [off] ptr) mem) - // cond: isU12Bit(ValAndOff(sc).Off()+off) - // result: (MOVWstoreconst [ValAndOff(sc).add(off)] {s} ptr mem) + // cond: isU12Bit(sc.Off()+int64(off)) + // result: (MOVWstoreconst [sc.addOffset32(off)] {s} ptr mem) for { - sc := v.AuxInt - s := v.Aux + sc := auxIntToValAndOff(v.AuxInt) + s := auxToSym(v.Aux) if v_0.Op != OpS390XADDconst { break } - off := v_0.AuxInt + off := auxIntToInt32(v_0.AuxInt) ptr := v_0.Args[0] mem := v_1 - if !(isU12Bit(ValAndOff(sc).Off() + off)) { + if !(isU12Bit(sc.Off() + int64(off))) { break } v.reset(OpS390XMOVWstoreconst) - v.AuxInt = ValAndOff(sc).add(off) - v.Aux = s + v.AuxInt = valAndOffToAuxInt(sc.addOffset32(off)) + v.Aux = symToAux(s) v.AddArg2(ptr, mem) return true } // match: (MOVWstoreconst [sc] {sym1} (MOVDaddr [off] {sym2} ptr) mem) - // cond: ptr.Op != OpSB && canMergeSym(sym1, sym2) && ValAndOff(sc).canAdd(off) - // result: (MOVWstoreconst [ValAndOff(sc).add(off)] {mergeSym(sym1, sym2)} ptr mem) + // cond: ptr.Op != OpSB && canMergeSym(sym1, sym2) && sc.canAdd32(off) + // result: (MOVWstoreconst [sc.addOffset32(off)] {mergeSymTyped(sym1, sym2)} ptr mem) for { - sc := v.AuxInt - sym1 := v.Aux + sc := auxIntToValAndOff(v.AuxInt) + sym1 := auxToSym(v.Aux) if v_0.Op != OpS390XMOVDaddr { break } - off := v_0.AuxInt - sym2 := v_0.Aux + off := auxIntToInt32(v_0.AuxInt) + sym2 := auxToSym(v_0.Aux) ptr := v_0.Args[0] mem := v_1 - if !(ptr.Op != OpSB && canMergeSym(sym1, sym2) && ValAndOff(sc).canAdd(off)) { + if !(ptr.Op != OpSB && canMergeSym(sym1, sym2) && sc.canAdd32(off)) { break } v.reset(OpS390XMOVWstoreconst) - v.AuxInt = ValAndOff(sc).add(off) - v.Aux = mergeSym(sym1, sym2) + v.AuxInt = valAndOffToAuxInt(sc.addOffset32(off)) + v.Aux = symToAux(mergeSymTyped(sym1, sym2)) v.AddArg2(ptr, mem) return true } // match: (MOVWstoreconst [c] {s} p x:(MOVWstoreconst [a] {s} p mem)) - // cond: p.Op != OpSB && x.Uses == 1 && ValAndOff(a).Off() + 4 == ValAndOff(c).Off() && clobber(x) - // result: (MOVDstore [ValAndOff(a).Off()] {s} p (MOVDconst [ValAndOff(c).Val()&0xffffffff | ValAndOff(a).Val()<<32]) mem) + // cond: p.Op != OpSB && x.Uses == 1 && a.Off() + 4 == c.Off() && clobber(x) + // result: (MOVDstore [a.Off32()] {s} p (MOVDconst [c.Val()&0xffffffff | a.Val()<<32]) mem) for { - c := v.AuxInt - s := v.Aux + c := auxIntToValAndOff(v.AuxInt) + s := auxToSym(v.Aux) p := v_0 x := v_1 if x.Op != OpS390XMOVWstoreconst { break } - a := x.AuxInt - if x.Aux != s { + a := auxIntToValAndOff(x.AuxInt) + if auxToSym(x.Aux) != s { break } mem := x.Args[1] - if p != x.Args[0] || !(p.Op != OpSB && x.Uses == 1 && ValAndOff(a).Off()+4 == ValAndOff(c).Off() && clobber(x)) { + if p != x.Args[0] || !(p.Op != OpSB && x.Uses == 1 && a.Off()+4 == c.Off() && clobber(x)) { break } v.reset(OpS390XMOVDstore) - v.AuxInt = ValAndOff(a).Off() - v.Aux = s + v.AuxInt = int32ToAuxInt(a.Off32()) + v.Aux = symToAux(s) v0 := b.NewValue0(x.Pos, OpS390XMOVDconst, typ.UInt64) - v0.AuxInt = ValAndOff(c).Val()&0xffffffff | ValAndOff(a).Val()<<32 + v0.AuxInt = int64ToAuxInt(c.Val()&0xffffffff | a.Val()<<32) v.AddArg3(p, v0, mem) return true } return false } -func rewriteValueS390X_OpS390XMOVWstoreidx(v *Value) bool { - v_3 := v.Args[3] - v_2 := v.Args[2] - v_1 := v.Args[1] - v_0 := v.Args[0] - // match: (MOVWstoreidx [c] {sym} (ADDconst [d] ptr) idx val mem) - // cond: is20Bit(c+d) - // result: (MOVWstoreidx [c+d] {sym} ptr idx val mem) - for { - c := v.AuxInt - sym := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - if v_0.Op != OpS390XADDconst { - continue - } - d := v_0.AuxInt - ptr := v_0.Args[0] - idx := v_1 - val := v_2 - mem := v_3 - if !(is20Bit(c + d)) { - continue - } - v.reset(OpS390XMOVWstoreidx) - v.AuxInt = c + d - v.Aux = sym - v.AddArg4(ptr, idx, val, mem) - return true - } - break - } - // match: (MOVWstoreidx [c] {sym} ptr (ADDconst [d] idx) val mem) - // cond: is20Bit(c+d) - // result: (MOVWstoreidx [c+d] {sym} ptr idx val mem) - for { - c := v.AuxInt - sym := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - ptr := v_0 - if v_1.Op != OpS390XADDconst { - continue - } - d := v_1.AuxInt - idx := v_1.Args[0] - val := v_2 - mem := v_3 - if !(is20Bit(c + d)) { - continue - } - v.reset(OpS390XMOVWstoreidx) - v.AuxInt = c + d - v.Aux = sym - v.AddArg4(ptr, idx, val, mem) - return true - } - break - } - // match: (MOVWstoreidx [i] {s} p idx w x:(MOVWstoreidx [i-4] {s} p idx (SRDconst [32] w) mem)) - // cond: x.Uses == 1 && clobber(x) - // result: (MOVDstoreidx [i-4] {s} p idx w mem) - for { - i := v.AuxInt - s := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - p := v_0 - idx := v_1 - w := v_2 - x := v_3 - if x.Op != OpS390XMOVWstoreidx || x.AuxInt != i-4 || x.Aux != s { - continue - } - mem := x.Args[3] - x_0 := x.Args[0] - x_1 := x.Args[1] - for _i1 := 0; _i1 <= 1; _i1, x_0, x_1 = _i1+1, x_1, x_0 { - if p != x_0 || idx != x_1 { - continue - } - x_2 := x.Args[2] - if x_2.Op != OpS390XSRDconst || x_2.AuxInt != 32 || w != x_2.Args[0] || !(x.Uses == 1 && clobber(x)) { - continue - } - v.reset(OpS390XMOVDstoreidx) - v.AuxInt = i - 4 - v.Aux = s - v.AddArg4(p, idx, w, mem) - return true - } - } - break - } - // match: (MOVWstoreidx [i] {s} p idx w0:(SRDconst [j] w) x:(MOVWstoreidx [i-4] {s} p idx (SRDconst [j+32] w) mem)) - // cond: x.Uses == 1 && clobber(x) - // result: (MOVDstoreidx [i-4] {s} p idx w0 mem) - for { - i := v.AuxInt - s := v.Aux - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - p := v_0 - idx := v_1 - w0 := v_2 - if w0.Op != OpS390XSRDconst { - continue - } - j := w0.AuxInt - w := w0.Args[0] - x := v_3 - if x.Op != OpS390XMOVWstoreidx || x.AuxInt != i-4 || x.Aux != s { - continue - } - mem := x.Args[3] - x_0 := x.Args[0] - x_1 := x.Args[1] - for _i1 := 0; _i1 <= 1; _i1, x_0, x_1 = _i1+1, x_1, x_0 { - if p != x_0 || idx != x_1 { - continue - } - x_2 := x.Args[2] - if x_2.Op != OpS390XSRDconst || x_2.AuxInt != j+32 || w != x_2.Args[0] || !(x.Uses == 1 && clobber(x)) { - continue - } - v.reset(OpS390XMOVDstoreidx) - v.AuxInt = i - 4 - v.Aux = s - v.AddArg4(p, idx, w0, mem) - return true - } - } - break - } - return false -} func rewriteValueS390X_OpS390XMULLD(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (MULLD x (MOVDconst [c])) // cond: is32Bit(c) - // result: (MULLDconst [c] x) + // result: (MULLDconst [int32(c)] x) for { for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { x := v_0 if v_1.Op != OpS390XMOVDconst { continue } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) if !(is32Bit(c)) { continue } v.reset(OpS390XMULLDconst) - v.AuxInt = c + v.AuxInt = int32ToAuxInt(int32(c)) v.AddArg(x) return true } break } // match: (MULLD <t> x g:(MOVDload [off] {sym} ptr mem)) - // cond: ptr.Op != OpSB && is20Bit(off) && canMergeLoadClobber(v, g, x) && clobber(g) + // cond: ptr.Op != OpSB && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g) // result: (MULLDload <t> [off] {sym} x ptr mem) for { t := v.Type @@ -13838,17 +11140,17 @@ func rewriteValueS390X_OpS390XMULLD(v *Value) bool { if g.Op != OpS390XMOVDload { continue } - off := g.AuxInt - sym := g.Aux + off := auxIntToInt32(g.AuxInt) + sym := auxToSym(g.Aux) mem := g.Args[1] ptr := g.Args[0] - if !(ptr.Op != OpSB && is20Bit(off) && canMergeLoadClobber(v, g, x) && clobber(g)) { + if !(ptr.Op != OpSB && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g)) { continue } v.reset(OpS390XMULLDload) v.Type = t - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(x, ptr, mem) return true } @@ -13920,15 +11222,15 @@ func rewriteValueS390X_OpS390XMULLDconst(v *Value) bool { return true } // match: (MULLDconst [c] (MOVDconst [d])) - // result: (MOVDconst [c*d]) + // result: (MOVDconst [int64(c)*d]) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) if v_0.Op != OpS390XMOVDconst { break } - d := v_0.AuxInt + d := auxIntToInt64(v_0.AuxInt) v.reset(OpS390XMOVDconst) - v.AuxInt = c * d + v.AuxInt = int64ToAuxInt(int64(c) * d) return true } return false @@ -13962,47 +11264,47 @@ func rewriteValueS390X_OpS390XMULLDload(v *Value) bool { return true } // match: (MULLDload [off1] {sym} x (ADDconst [off2] ptr) mem) - // cond: ptr.Op != OpSB && is20Bit(off1+off2) + // cond: ptr.Op != OpSB && is20Bit(int64(off1)+int64(off2)) // result: (MULLDload [off1+off2] {sym} x ptr mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) x := v_0 if v_1.Op != OpS390XADDconst { break } - off2 := v_1.AuxInt + off2 := auxIntToInt32(v_1.AuxInt) ptr := v_1.Args[0] mem := v_2 - if !(ptr.Op != OpSB && is20Bit(off1+off2)) { + if !(ptr.Op != OpSB && is20Bit(int64(off1)+int64(off2))) { break } v.reset(OpS390XMULLDload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(x, ptr, mem) return true } // match: (MULLDload [o1] {s1} x (MOVDaddr [o2] {s2} ptr) mem) - // cond: ptr.Op != OpSB && is20Bit(o1+o2) && canMergeSym(s1, s2) - // result: (MULLDload [o1+o2] {mergeSym(s1, s2)} x ptr mem) + // cond: ptr.Op != OpSB && is20Bit(int64(o1)+int64(o2)) && canMergeSym(s1, s2) + // result: (MULLDload [o1+o2] {mergeSymTyped(s1, s2)} x ptr mem) for { - o1 := v.AuxInt - s1 := v.Aux + o1 := auxIntToInt32(v.AuxInt) + s1 := auxToSym(v.Aux) x := v_0 if v_1.Op != OpS390XMOVDaddr { break } - o2 := v_1.AuxInt - s2 := v_1.Aux + o2 := auxIntToInt32(v_1.AuxInt) + s2 := auxToSym(v_1.Aux) ptr := v_1.Args[0] mem := v_2 - if !(ptr.Op != OpSB && is20Bit(o1+o2) && canMergeSym(s1, s2)) { + if !(ptr.Op != OpSB && is20Bit(int64(o1)+int64(o2)) && canMergeSym(s1, s2)) { break } v.reset(OpS390XMULLDload) - v.AuxInt = o1 + o2 - v.Aux = mergeSym(s1, s2) + v.AuxInt = int32ToAuxInt(o1 + o2) + v.Aux = symToAux(mergeSymTyped(s1, s2)) v.AddArg3(x, ptr, mem) return true } @@ -14012,23 +11314,23 @@ func rewriteValueS390X_OpS390XMULLW(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (MULLW x (MOVDconst [c])) - // result: (MULLWconst [int64(int32(c))] x) + // result: (MULLWconst [int32(c)] x) for { for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { x := v_0 if v_1.Op != OpS390XMOVDconst { continue } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) v.reset(OpS390XMULLWconst) - v.AuxInt = int64(int32(c)) + v.AuxInt = int32ToAuxInt(int32(c)) v.AddArg(x) return true } break } // match: (MULLW <t> x g:(MOVWload [off] {sym} ptr mem)) - // cond: ptr.Op != OpSB && is20Bit(off) && canMergeLoadClobber(v, g, x) && clobber(g) + // cond: ptr.Op != OpSB && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g) // result: (MULLWload <t> [off] {sym} x ptr mem) for { t := v.Type @@ -14038,24 +11340,24 @@ func rewriteValueS390X_OpS390XMULLW(v *Value) bool { if g.Op != OpS390XMOVWload { continue } - off := g.AuxInt - sym := g.Aux + off := auxIntToInt32(g.AuxInt) + sym := auxToSym(g.Aux) mem := g.Args[1] ptr := g.Args[0] - if !(ptr.Op != OpSB && is20Bit(off) && canMergeLoadClobber(v, g, x) && clobber(g)) { + if !(ptr.Op != OpSB && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g)) { continue } v.reset(OpS390XMULLWload) v.Type = t - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(x, ptr, mem) return true } break } // match: (MULLW <t> x g:(MOVWZload [off] {sym} ptr mem)) - // cond: ptr.Op != OpSB && is20Bit(off) && canMergeLoadClobber(v, g, x) && clobber(g) + // cond: ptr.Op != OpSB && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g) // result: (MULLWload <t> [off] {sym} x ptr mem) for { t := v.Type @@ -14065,17 +11367,17 @@ func rewriteValueS390X_OpS390XMULLW(v *Value) bool { if g.Op != OpS390XMOVWZload { continue } - off := g.AuxInt - sym := g.Aux + off := auxIntToInt32(g.AuxInt) + sym := auxToSym(g.Aux) mem := g.Args[1] ptr := g.Args[0] - if !(ptr.Op != OpSB && is20Bit(off) && canMergeLoadClobber(v, g, x) && clobber(g)) { + if !(ptr.Op != OpSB && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g)) { continue } v.reset(OpS390XMULLWload) v.Type = t - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(x, ptr, mem) return true } @@ -14147,15 +11449,15 @@ func rewriteValueS390X_OpS390XMULLWconst(v *Value) bool { return true } // match: (MULLWconst [c] (MOVDconst [d])) - // result: (MOVDconst [int64(int32(c*d))]) + // result: (MOVDconst [int64(c*int32(d))]) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) if v_0.Op != OpS390XMOVDconst { break } - d := v_0.AuxInt + d := auxIntToInt64(v_0.AuxInt) v.reset(OpS390XMOVDconst) - v.AuxInt = int64(int32(c * d)) + v.AuxInt = int64ToAuxInt(int64(c * int32(d))) return true } return false @@ -14165,47 +11467,47 @@ func rewriteValueS390X_OpS390XMULLWload(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (MULLWload [off1] {sym} x (ADDconst [off2] ptr) mem) - // cond: ptr.Op != OpSB && is20Bit(off1+off2) + // cond: ptr.Op != OpSB && is20Bit(int64(off1)+int64(off2)) // result: (MULLWload [off1+off2] {sym} x ptr mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) x := v_0 if v_1.Op != OpS390XADDconst { break } - off2 := v_1.AuxInt + off2 := auxIntToInt32(v_1.AuxInt) ptr := v_1.Args[0] mem := v_2 - if !(ptr.Op != OpSB && is20Bit(off1+off2)) { + if !(ptr.Op != OpSB && is20Bit(int64(off1)+int64(off2))) { break } v.reset(OpS390XMULLWload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(x, ptr, mem) return true } // match: (MULLWload [o1] {s1} x (MOVDaddr [o2] {s2} ptr) mem) - // cond: ptr.Op != OpSB && is20Bit(o1+o2) && canMergeSym(s1, s2) - // result: (MULLWload [o1+o2] {mergeSym(s1, s2)} x ptr mem) + // cond: ptr.Op != OpSB && is20Bit(int64(o1)+int64(o2)) && canMergeSym(s1, s2) + // result: (MULLWload [o1+o2] {mergeSymTyped(s1, s2)} x ptr mem) for { - o1 := v.AuxInt - s1 := v.Aux + o1 := auxIntToInt32(v.AuxInt) + s1 := auxToSym(v.Aux) x := v_0 if v_1.Op != OpS390XMOVDaddr { break } - o2 := v_1.AuxInt - s2 := v_1.Aux + o2 := auxIntToInt32(v_1.AuxInt) + s2 := auxToSym(v_1.Aux) ptr := v_1.Args[0] mem := v_2 - if !(ptr.Op != OpSB && is20Bit(o1+o2) && canMergeSym(s1, s2)) { + if !(ptr.Op != OpSB && is20Bit(int64(o1)+int64(o2)) && canMergeSym(s1, s2)) { break } v.reset(OpS390XMULLWload) - v.AuxInt = o1 + o2 - v.Aux = mergeSym(s1, s2) + v.AuxInt = int32ToAuxInt(o1 + o2) + v.Aux = symToAux(mergeSymTyped(s1, s2)) v.AddArg3(x, ptr, mem) return true } @@ -14391,14 +11693,14 @@ func rewriteValueS390X_OpS390XOR(v *Value) bool { } // match: (OR (SLDconst [63] (SRDconst [63] (LGDR x))) (MOVDconst [c])) // cond: c & -1<<63 == 0 - // result: (LGDR (CPSDR <x.Type> (FMOVDconst <x.Type> [c]) x)) + // result: (LGDR (CPSDR <x.Type> (FMOVDconst <x.Type> [math.Float64frombits(uint64(c))]) x)) for { for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - if v_0.Op != OpS390XSLDconst || v_0.AuxInt != 63 { + if v_0.Op != OpS390XSLDconst || auxIntToInt8(v_0.AuxInt) != 63 { continue } v_0_0 := v_0.Args[0] - if v_0_0.Op != OpS390XSRDconst || v_0_0.AuxInt != 63 { + if v_0_0.Op != OpS390XSRDconst || auxIntToInt8(v_0_0.AuxInt) != 63 { continue } v_0_0_0 := v_0_0.Args[0] @@ -14409,14 +11711,14 @@ func rewriteValueS390X_OpS390XOR(v *Value) bool { if v_1.Op != OpS390XMOVDconst { continue } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) if !(c&-1<<63 == 0) { continue } v.reset(OpS390XLGDR) v0 := b.NewValue0(v.Pos, OpS390XCPSDR, x.Type) v1 := b.NewValue0(v.Pos, OpS390XFMOVDconst, x.Type) - v1.AuxInt = c + v1.AuxInt = float64ToAuxInt(math.Float64frombits(uint64(c))) v0.AddArg2(v1, x) v.AddArg(v0) return true @@ -14458,7 +11760,7 @@ func rewriteValueS390X_OpS390XOR(v *Value) bool { } // match: (OR (AND (MOVDconst [-1<<63]) (LGDR x)) (MOVDconst [c])) // cond: c & -1<<63 == 0 - // result: (LGDR (CPSDR <x.Type> (FMOVDconst <x.Type> [c]) x)) + // result: (LGDR (CPSDR <x.Type> (FMOVDconst <x.Type> [math.Float64frombits(uint64(c))]) x)) for { for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { if v_0.Op != OpS390XAND { @@ -14468,21 +11770,21 @@ func rewriteValueS390X_OpS390XOR(v *Value) bool { v_0_0 := v_0.Args[0] v_0_1 := v_0.Args[1] for _i1 := 0; _i1 <= 1; _i1, v_0_0, v_0_1 = _i1+1, v_0_1, v_0_0 { - if v_0_0.Op != OpS390XMOVDconst || v_0_0.AuxInt != -1<<63 || v_0_1.Op != OpS390XLGDR { + if v_0_0.Op != OpS390XMOVDconst || auxIntToInt64(v_0_0.AuxInt) != -1<<63 || v_0_1.Op != OpS390XLGDR { continue } x := v_0_1.Args[0] if v_1.Op != OpS390XMOVDconst { continue } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) if !(c&-1<<63 == 0) { continue } v.reset(OpS390XLGDR) v0 := b.NewValue0(v.Pos, OpS390XCPSDR, x.Type) v1 := b.NewValue0(v.Pos, OpS390XFMOVDconst, x.Type) - v1.AuxInt = c + v1.AuxInt = float64ToAuxInt(math.Float64frombits(uint64(c))) v0.AddArg2(v1, x) v.AddArg(v0) return true @@ -14519,7 +11821,7 @@ func rewriteValueS390X_OpS390XOR(v *Value) bool { return true } // match: (OR <t> x g:(MOVDload [off] {sym} ptr mem)) - // cond: ptr.Op != OpSB && is20Bit(off) && canMergeLoadClobber(v, g, x) && clobber(g) + // cond: ptr.Op != OpSB && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g) // result: (ORload <t> [off] {sym} x ptr mem) for { t := v.Type @@ -14529,17 +11831,17 @@ func rewriteValueS390X_OpS390XOR(v *Value) bool { if g.Op != OpS390XMOVDload { continue } - off := g.AuxInt - sym := g.Aux + off := auxIntToInt32(g.AuxInt) + sym := auxToSym(g.Aux) mem := g.Args[1] ptr := g.Args[0] - if !(ptr.Op != OpSB && is20Bit(off) && canMergeLoadClobber(v, g, x) && clobber(g)) { + if !(ptr.Op != OpSB && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g)) { continue } v.reset(OpS390XORload) v.Type = t - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(x, ptr, mem) return true } @@ -14554,20 +11856,20 @@ func rewriteValueS390X_OpS390XOR(v *Value) bool { if x1.Op != OpS390XMOVBZload { continue } - i1 := x1.AuxInt - s := x1.Aux + i1 := auxIntToInt32(x1.AuxInt) + s := auxToSym(x1.Aux) mem := x1.Args[1] p := x1.Args[0] sh := v_1 - if sh.Op != OpS390XSLDconst || sh.AuxInt != 8 { + if sh.Op != OpS390XSLDconst || auxIntToInt8(sh.AuxInt) != 8 { continue } x0 := sh.Args[0] if x0.Op != OpS390XMOVBZload { continue } - i0 := x0.AuxInt - if x0.Aux != s { + i0 := auxIntToInt32(x0.AuxInt) + if auxToSym(x0.Aux) != s { continue } _ = x0.Args[1] @@ -14577,8 +11879,8 @@ func rewriteValueS390X_OpS390XOR(v *Value) bool { b = mergePoint(b, x0, x1) v0 := b.NewValue0(x0.Pos, OpS390XMOVHZload, typ.UInt16) v.copyOf(v0) - v0.AuxInt = i0 - v0.Aux = s + v0.AuxInt = int32ToAuxInt(i0) + v0.Aux = symToAux(s) v0.AddArg2(p, mem) return true } @@ -14593,20 +11895,20 @@ func rewriteValueS390X_OpS390XOR(v *Value) bool { if x1.Op != OpS390XMOVHZload { continue } - i1 := x1.AuxInt - s := x1.Aux + i1 := auxIntToInt32(x1.AuxInt) + s := auxToSym(x1.Aux) mem := x1.Args[1] p := x1.Args[0] sh := v_1 - if sh.Op != OpS390XSLDconst || sh.AuxInt != 16 { + if sh.Op != OpS390XSLDconst || auxIntToInt8(sh.AuxInt) != 16 { continue } x0 := sh.Args[0] if x0.Op != OpS390XMOVHZload { continue } - i0 := x0.AuxInt - if x0.Aux != s { + i0 := auxIntToInt32(x0.AuxInt) + if auxToSym(x0.Aux) != s { continue } _ = x0.Args[1] @@ -14616,8 +11918,8 @@ func rewriteValueS390X_OpS390XOR(v *Value) bool { b = mergePoint(b, x0, x1) v0 := b.NewValue0(x0.Pos, OpS390XMOVWZload, typ.UInt32) v.copyOf(v0) - v0.AuxInt = i0 - v0.Aux = s + v0.AuxInt = int32ToAuxInt(i0) + v0.Aux = symToAux(s) v0.AddArg2(p, mem) return true } @@ -14632,20 +11934,20 @@ func rewriteValueS390X_OpS390XOR(v *Value) bool { if x1.Op != OpS390XMOVWZload { continue } - i1 := x1.AuxInt - s := x1.Aux + i1 := auxIntToInt32(x1.AuxInt) + s := auxToSym(x1.Aux) mem := x1.Args[1] p := x1.Args[0] sh := v_1 - if sh.Op != OpS390XSLDconst || sh.AuxInt != 32 { + if sh.Op != OpS390XSLDconst || auxIntToInt8(sh.AuxInt) != 32 { continue } x0 := sh.Args[0] if x0.Op != OpS390XMOVWZload { continue } - i0 := x0.AuxInt - if x0.Aux != s { + i0 := auxIntToInt32(x0.AuxInt) + if auxToSym(x0.Aux) != s { continue } _ = x0.Args[1] @@ -14655,8 +11957,8 @@ func rewriteValueS390X_OpS390XOR(v *Value) bool { b = mergePoint(b, x0, x1) v0 := b.NewValue0(x0.Pos, OpS390XMOVDload, typ.UInt64) v.copyOf(v0) - v0.AuxInt = i0 - v0.Aux = s + v0.AuxInt = int32ToAuxInt(i0) + v0.Aux = symToAux(s) v0.AddArg2(p, mem) return true } @@ -14671,13 +11973,13 @@ func rewriteValueS390X_OpS390XOR(v *Value) bool { if s0.Op != OpS390XSLDconst { continue } - j0 := s0.AuxInt + j0 := auxIntToInt8(s0.AuxInt) x0 := s0.Args[0] if x0.Op != OpS390XMOVBZload { continue } - i0 := x0.AuxInt - s := x0.Aux + i0 := auxIntToInt32(x0.AuxInt) + s := auxToSym(x0.Aux) mem := x0.Args[1] p := x0.Args[0] or := v_1 @@ -14692,13 +11994,13 @@ func rewriteValueS390X_OpS390XOR(v *Value) bool { if s1.Op != OpS390XSLDconst { continue } - j1 := s1.AuxInt + j1 := auxIntToInt8(s1.AuxInt) x1 := s1.Args[0] if x1.Op != OpS390XMOVBZload { continue } - i1 := x1.AuxInt - if x1.Aux != s { + i1 := auxIntToInt32(x1.AuxInt) + if auxToSym(x1.Aux) != s { continue } _ = x1.Args[1] @@ -14713,10 +12015,10 @@ func rewriteValueS390X_OpS390XOR(v *Value) bool { v0 := b.NewValue0(x1.Pos, OpS390XOR, v.Type) v.copyOf(v0) v1 := b.NewValue0(x1.Pos, OpS390XSLDconst, v.Type) - v1.AuxInt = j1 + v1.AuxInt = int8ToAuxInt(j1) v2 := b.NewValue0(x1.Pos, OpS390XMOVHZload, typ.UInt16) - v2.AuxInt = i0 - v2.Aux = s + v2.AuxInt = int32ToAuxInt(i0) + v2.Aux = symToAux(s) v2.AddArg2(p, mem) v1.AddArg(v2) v0.AddArg2(v1, y) @@ -14734,13 +12036,13 @@ func rewriteValueS390X_OpS390XOR(v *Value) bool { if s0.Op != OpS390XSLDconst { continue } - j0 := s0.AuxInt + j0 := auxIntToInt8(s0.AuxInt) x0 := s0.Args[0] if x0.Op != OpS390XMOVHZload { continue } - i0 := x0.AuxInt - s := x0.Aux + i0 := auxIntToInt32(x0.AuxInt) + s := auxToSym(x0.Aux) mem := x0.Args[1] p := x0.Args[0] or := v_1 @@ -14755,13 +12057,13 @@ func rewriteValueS390X_OpS390XOR(v *Value) bool { if s1.Op != OpS390XSLDconst { continue } - j1 := s1.AuxInt + j1 := auxIntToInt8(s1.AuxInt) x1 := s1.Args[0] if x1.Op != OpS390XMOVHZload { continue } - i1 := x1.AuxInt - if x1.Aux != s { + i1 := auxIntToInt32(x1.AuxInt) + if auxToSym(x1.Aux) != s { continue } _ = x1.Args[1] @@ -14776,10 +12078,10 @@ func rewriteValueS390X_OpS390XOR(v *Value) bool { v0 := b.NewValue0(x1.Pos, OpS390XOR, v.Type) v.copyOf(v0) v1 := b.NewValue0(x1.Pos, OpS390XSLDconst, v.Type) - v1.AuxInt = j1 + v1.AuxInt = int8ToAuxInt(j1) v2 := b.NewValue0(x1.Pos, OpS390XMOVWZload, typ.UInt32) - v2.AuxInt = i0 - v2.Aux = s + v2.AuxInt = int32ToAuxInt(i0) + v2.Aux = symToAux(s) v2.AddArg2(p, mem) v1.AddArg(v2) v0.AddArg2(v1, y) @@ -14788,294 +12090,6 @@ func rewriteValueS390X_OpS390XOR(v *Value) bool { } break } - // match: (OR x1:(MOVBZloadidx [i1] {s} p idx mem) sh:(SLDconst [8] x0:(MOVBZloadidx [i0] {s} p idx mem))) - // cond: i1 == i0+1 && p.Op != OpSB && x0.Uses == 1 && x1.Uses == 1 && sh.Uses == 1 && mergePoint(b,x0,x1) != nil && clobber(x0, x1, sh) - // result: @mergePoint(b,x0,x1) (MOVHZloadidx [i0] {s} p idx mem) - for { - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - x1 := v_0 - if x1.Op != OpS390XMOVBZloadidx { - continue - } - i1 := x1.AuxInt - s := x1.Aux - mem := x1.Args[2] - x1_0 := x1.Args[0] - x1_1 := x1.Args[1] - for _i1 := 0; _i1 <= 1; _i1, x1_0, x1_1 = _i1+1, x1_1, x1_0 { - p := x1_0 - idx := x1_1 - sh := v_1 - if sh.Op != OpS390XSLDconst || sh.AuxInt != 8 { - continue - } - x0 := sh.Args[0] - if x0.Op != OpS390XMOVBZloadidx { - continue - } - i0 := x0.AuxInt - if x0.Aux != s { - continue - } - _ = x0.Args[2] - x0_0 := x0.Args[0] - x0_1 := x0.Args[1] - for _i2 := 0; _i2 <= 1; _i2, x0_0, x0_1 = _i2+1, x0_1, x0_0 { - if p != x0_0 || idx != x0_1 || mem != x0.Args[2] || !(i1 == i0+1 && p.Op != OpSB && x0.Uses == 1 && x1.Uses == 1 && sh.Uses == 1 && mergePoint(b, x0, x1) != nil && clobber(x0, x1, sh)) { - continue - } - b = mergePoint(b, x0, x1) - v0 := b.NewValue0(v.Pos, OpS390XMOVHZloadidx, typ.UInt16) - v.copyOf(v0) - v0.AuxInt = i0 - v0.Aux = s - v0.AddArg3(p, idx, mem) - return true - } - } - } - break - } - // match: (OR x1:(MOVHZloadidx [i1] {s} p idx mem) sh:(SLDconst [16] x0:(MOVHZloadidx [i0] {s} p idx mem))) - // cond: i1 == i0+2 && p.Op != OpSB && x0.Uses == 1 && x1.Uses == 1 && sh.Uses == 1 && mergePoint(b,x0,x1) != nil && clobber(x0, x1, sh) - // result: @mergePoint(b,x0,x1) (MOVWZloadidx [i0] {s} p idx mem) - for { - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - x1 := v_0 - if x1.Op != OpS390XMOVHZloadidx { - continue - } - i1 := x1.AuxInt - s := x1.Aux - mem := x1.Args[2] - x1_0 := x1.Args[0] - x1_1 := x1.Args[1] - for _i1 := 0; _i1 <= 1; _i1, x1_0, x1_1 = _i1+1, x1_1, x1_0 { - p := x1_0 - idx := x1_1 - sh := v_1 - if sh.Op != OpS390XSLDconst || sh.AuxInt != 16 { - continue - } - x0 := sh.Args[0] - if x0.Op != OpS390XMOVHZloadidx { - continue - } - i0 := x0.AuxInt - if x0.Aux != s { - continue - } - _ = x0.Args[2] - x0_0 := x0.Args[0] - x0_1 := x0.Args[1] - for _i2 := 0; _i2 <= 1; _i2, x0_0, x0_1 = _i2+1, x0_1, x0_0 { - if p != x0_0 || idx != x0_1 || mem != x0.Args[2] || !(i1 == i0+2 && p.Op != OpSB && x0.Uses == 1 && x1.Uses == 1 && sh.Uses == 1 && mergePoint(b, x0, x1) != nil && clobber(x0, x1, sh)) { - continue - } - b = mergePoint(b, x0, x1) - v0 := b.NewValue0(v.Pos, OpS390XMOVWZloadidx, typ.UInt32) - v.copyOf(v0) - v0.AuxInt = i0 - v0.Aux = s - v0.AddArg3(p, idx, mem) - return true - } - } - } - break - } - // match: (OR x1:(MOVWZloadidx [i1] {s} p idx mem) sh:(SLDconst [32] x0:(MOVWZloadidx [i0] {s} p idx mem))) - // cond: i1 == i0+4 && p.Op != OpSB && x0.Uses == 1 && x1.Uses == 1 && sh.Uses == 1 && mergePoint(b,x0,x1) != nil && clobber(x0, x1, sh) - // result: @mergePoint(b,x0,x1) (MOVDloadidx [i0] {s} p idx mem) - for { - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - x1 := v_0 - if x1.Op != OpS390XMOVWZloadidx { - continue - } - i1 := x1.AuxInt - s := x1.Aux - mem := x1.Args[2] - x1_0 := x1.Args[0] - x1_1 := x1.Args[1] - for _i1 := 0; _i1 <= 1; _i1, x1_0, x1_1 = _i1+1, x1_1, x1_0 { - p := x1_0 - idx := x1_1 - sh := v_1 - if sh.Op != OpS390XSLDconst || sh.AuxInt != 32 { - continue - } - x0 := sh.Args[0] - if x0.Op != OpS390XMOVWZloadidx { - continue - } - i0 := x0.AuxInt - if x0.Aux != s { - continue - } - _ = x0.Args[2] - x0_0 := x0.Args[0] - x0_1 := x0.Args[1] - for _i2 := 0; _i2 <= 1; _i2, x0_0, x0_1 = _i2+1, x0_1, x0_0 { - if p != x0_0 || idx != x0_1 || mem != x0.Args[2] || !(i1 == i0+4 && p.Op != OpSB && x0.Uses == 1 && x1.Uses == 1 && sh.Uses == 1 && mergePoint(b, x0, x1) != nil && clobber(x0, x1, sh)) { - continue - } - b = mergePoint(b, x0, x1) - v0 := b.NewValue0(v.Pos, OpS390XMOVDloadidx, typ.UInt64) - v.copyOf(v0) - v0.AuxInt = i0 - v0.Aux = s - v0.AddArg3(p, idx, mem) - return true - } - } - } - break - } - // match: (OR s0:(SLDconst [j0] x0:(MOVBZloadidx [i0] {s} p idx mem)) or:(OR s1:(SLDconst [j1] x1:(MOVBZloadidx [i1] {s} p idx mem)) y)) - // cond: i1 == i0+1 && j1 == j0-8 && j1 % 16 == 0 && x0.Uses == 1 && x1.Uses == 1 && s0.Uses == 1 && s1.Uses == 1 && or.Uses == 1 && mergePoint(b,x0,x1,y) != nil && clobber(x0, x1, s0, s1, or) - // result: @mergePoint(b,x0,x1,y) (OR <v.Type> (SLDconst <v.Type> [j1] (MOVHZloadidx [i0] {s} p idx mem)) y) - for { - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - s0 := v_0 - if s0.Op != OpS390XSLDconst { - continue - } - j0 := s0.AuxInt - x0 := s0.Args[0] - if x0.Op != OpS390XMOVBZloadidx { - continue - } - i0 := x0.AuxInt - s := x0.Aux - mem := x0.Args[2] - x0_0 := x0.Args[0] - x0_1 := x0.Args[1] - for _i1 := 0; _i1 <= 1; _i1, x0_0, x0_1 = _i1+1, x0_1, x0_0 { - p := x0_0 - idx := x0_1 - or := v_1 - if or.Op != OpS390XOR { - continue - } - _ = or.Args[1] - or_0 := or.Args[0] - or_1 := or.Args[1] - for _i2 := 0; _i2 <= 1; _i2, or_0, or_1 = _i2+1, or_1, or_0 { - s1 := or_0 - if s1.Op != OpS390XSLDconst { - continue - } - j1 := s1.AuxInt - x1 := s1.Args[0] - if x1.Op != OpS390XMOVBZloadidx { - continue - } - i1 := x1.AuxInt - if x1.Aux != s { - continue - } - _ = x1.Args[2] - x1_0 := x1.Args[0] - x1_1 := x1.Args[1] - for _i3 := 0; _i3 <= 1; _i3, x1_0, x1_1 = _i3+1, x1_1, x1_0 { - if p != x1_0 || idx != x1_1 || mem != x1.Args[2] { - continue - } - y := or_1 - if !(i1 == i0+1 && j1 == j0-8 && j1%16 == 0 && x0.Uses == 1 && x1.Uses == 1 && s0.Uses == 1 && s1.Uses == 1 && or.Uses == 1 && mergePoint(b, x0, x1, y) != nil && clobber(x0, x1, s0, s1, or)) { - continue - } - b = mergePoint(b, x0, x1, y) - v0 := b.NewValue0(v.Pos, OpS390XOR, v.Type) - v.copyOf(v0) - v1 := b.NewValue0(v.Pos, OpS390XSLDconst, v.Type) - v1.AuxInt = j1 - v2 := b.NewValue0(v.Pos, OpS390XMOVHZloadidx, typ.UInt16) - v2.AuxInt = i0 - v2.Aux = s - v2.AddArg3(p, idx, mem) - v1.AddArg(v2) - v0.AddArg2(v1, y) - return true - } - } - } - } - break - } - // match: (OR s0:(SLDconst [j0] x0:(MOVHZloadidx [i0] {s} p idx mem)) or:(OR s1:(SLDconst [j1] x1:(MOVHZloadidx [i1] {s} p idx mem)) y)) - // cond: i1 == i0+2 && j1 == j0-16 && j1 % 32 == 0 && x0.Uses == 1 && x1.Uses == 1 && s0.Uses == 1 && s1.Uses == 1 && or.Uses == 1 && mergePoint(b,x0,x1,y) != nil && clobber(x0, x1, s0, s1, or) - // result: @mergePoint(b,x0,x1,y) (OR <v.Type> (SLDconst <v.Type> [j1] (MOVWZloadidx [i0] {s} p idx mem)) y) - for { - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - s0 := v_0 - if s0.Op != OpS390XSLDconst { - continue - } - j0 := s0.AuxInt - x0 := s0.Args[0] - if x0.Op != OpS390XMOVHZloadidx { - continue - } - i0 := x0.AuxInt - s := x0.Aux - mem := x0.Args[2] - x0_0 := x0.Args[0] - x0_1 := x0.Args[1] - for _i1 := 0; _i1 <= 1; _i1, x0_0, x0_1 = _i1+1, x0_1, x0_0 { - p := x0_0 - idx := x0_1 - or := v_1 - if or.Op != OpS390XOR { - continue - } - _ = or.Args[1] - or_0 := or.Args[0] - or_1 := or.Args[1] - for _i2 := 0; _i2 <= 1; _i2, or_0, or_1 = _i2+1, or_1, or_0 { - s1 := or_0 - if s1.Op != OpS390XSLDconst { - continue - } - j1 := s1.AuxInt - x1 := s1.Args[0] - if x1.Op != OpS390XMOVHZloadidx { - continue - } - i1 := x1.AuxInt - if x1.Aux != s { - continue - } - _ = x1.Args[2] - x1_0 := x1.Args[0] - x1_1 := x1.Args[1] - for _i3 := 0; _i3 <= 1; _i3, x1_0, x1_1 = _i3+1, x1_1, x1_0 { - if p != x1_0 || idx != x1_1 || mem != x1.Args[2] { - continue - } - y := or_1 - if !(i1 == i0+2 && j1 == j0-16 && j1%32 == 0 && x0.Uses == 1 && x1.Uses == 1 && s0.Uses == 1 && s1.Uses == 1 && or.Uses == 1 && mergePoint(b, x0, x1, y) != nil && clobber(x0, x1, s0, s1, or)) { - continue - } - b = mergePoint(b, x0, x1, y) - v0 := b.NewValue0(v.Pos, OpS390XOR, v.Type) - v.copyOf(v0) - v1 := b.NewValue0(v.Pos, OpS390XSLDconst, v.Type) - v1.AuxInt = j1 - v2 := b.NewValue0(v.Pos, OpS390XMOVWZloadidx, typ.UInt32) - v2.AuxInt = i0 - v2.Aux = s - v2.AddArg3(p, idx, mem) - v1.AddArg(v2) - v0.AddArg2(v1, y) - return true - } - } - } - } - break - } // match: (OR x0:(MOVBZload [i0] {s} p mem) sh:(SLDconst [8] x1:(MOVBZload [i1] {s} p mem))) // cond: p.Op != OpSB && i1 == i0+1 && x0.Uses == 1 && x1.Uses == 1 && sh.Uses == 1 && mergePoint(b,x0,x1) != nil && clobber(x0, x1, sh) // result: @mergePoint(b,x0,x1) (MOVHZreg (MOVHBRload [i0] {s} p mem)) @@ -15085,20 +12099,20 @@ func rewriteValueS390X_OpS390XOR(v *Value) bool { if x0.Op != OpS390XMOVBZload { continue } - i0 := x0.AuxInt - s := x0.Aux + i0 := auxIntToInt32(x0.AuxInt) + s := auxToSym(x0.Aux) mem := x0.Args[1] p := x0.Args[0] sh := v_1 - if sh.Op != OpS390XSLDconst || sh.AuxInt != 8 { + if sh.Op != OpS390XSLDconst || auxIntToInt8(sh.AuxInt) != 8 { continue } x1 := sh.Args[0] if x1.Op != OpS390XMOVBZload { continue } - i1 := x1.AuxInt - if x1.Aux != s { + i1 := auxIntToInt32(x1.AuxInt) + if auxToSym(x1.Aux) != s { continue } _ = x1.Args[1] @@ -15109,8 +12123,8 @@ func rewriteValueS390X_OpS390XOR(v *Value) bool { v0 := b.NewValue0(x1.Pos, OpS390XMOVHZreg, typ.UInt64) v.copyOf(v0) v1 := b.NewValue0(x1.Pos, OpS390XMOVHBRload, typ.UInt16) - v1.AuxInt = i0 - v1.Aux = s + v1.AuxInt = int32ToAuxInt(i0) + v1.Aux = symToAux(s) v1.AddArg2(p, mem) v0.AddArg(v1) return true @@ -15130,12 +12144,12 @@ func rewriteValueS390X_OpS390XOR(v *Value) bool { if x0.Op != OpS390XMOVHBRload { continue } - i0 := x0.AuxInt - s := x0.Aux + i0 := auxIntToInt32(x0.AuxInt) + s := auxToSym(x0.Aux) mem := x0.Args[1] p := x0.Args[0] sh := v_1 - if sh.Op != OpS390XSLDconst || sh.AuxInt != 16 { + if sh.Op != OpS390XSLDconst || auxIntToInt8(sh.AuxInt) != 16 { continue } r1 := sh.Args[0] @@ -15146,8 +12160,8 @@ func rewriteValueS390X_OpS390XOR(v *Value) bool { if x1.Op != OpS390XMOVHBRload { continue } - i1 := x1.AuxInt - if x1.Aux != s { + i1 := auxIntToInt32(x1.AuxInt) + if auxToSym(x1.Aux) != s { continue } _ = x1.Args[1] @@ -15158,8 +12172,8 @@ func rewriteValueS390X_OpS390XOR(v *Value) bool { v0 := b.NewValue0(x1.Pos, OpS390XMOVWZreg, typ.UInt64) v.copyOf(v0) v1 := b.NewValue0(x1.Pos, OpS390XMOVWBRload, typ.UInt32) - v1.AuxInt = i0 - v1.Aux = s + v1.AuxInt = int32ToAuxInt(i0) + v1.Aux = symToAux(s) v1.AddArg2(p, mem) v0.AddArg(v1) return true @@ -15179,12 +12193,12 @@ func rewriteValueS390X_OpS390XOR(v *Value) bool { if x0.Op != OpS390XMOVWBRload { continue } - i0 := x0.AuxInt - s := x0.Aux + i0 := auxIntToInt32(x0.AuxInt) + s := auxToSym(x0.Aux) mem := x0.Args[1] p := x0.Args[0] sh := v_1 - if sh.Op != OpS390XSLDconst || sh.AuxInt != 32 { + if sh.Op != OpS390XSLDconst || auxIntToInt8(sh.AuxInt) != 32 { continue } r1 := sh.Args[0] @@ -15195,8 +12209,8 @@ func rewriteValueS390X_OpS390XOR(v *Value) bool { if x1.Op != OpS390XMOVWBRload { continue } - i1 := x1.AuxInt - if x1.Aux != s { + i1 := auxIntToInt32(x1.AuxInt) + if auxToSym(x1.Aux) != s { continue } _ = x1.Args[1] @@ -15206,8 +12220,8 @@ func rewriteValueS390X_OpS390XOR(v *Value) bool { b = mergePoint(b, x0, x1) v0 := b.NewValue0(x1.Pos, OpS390XMOVDBRload, typ.UInt64) v.copyOf(v0) - v0.AuxInt = i0 - v0.Aux = s + v0.AuxInt = int32ToAuxInt(i0) + v0.Aux = symToAux(s) v0.AddArg2(p, mem) return true } @@ -15222,13 +12236,13 @@ func rewriteValueS390X_OpS390XOR(v *Value) bool { if s1.Op != OpS390XSLDconst { continue } - j1 := s1.AuxInt + j1 := auxIntToInt8(s1.AuxInt) x1 := s1.Args[0] if x1.Op != OpS390XMOVBZload { continue } - i1 := x1.AuxInt - s := x1.Aux + i1 := auxIntToInt32(x1.AuxInt) + s := auxToSym(x1.Aux) mem := x1.Args[1] p := x1.Args[0] or := v_1 @@ -15243,13 +12257,13 @@ func rewriteValueS390X_OpS390XOR(v *Value) bool { if s0.Op != OpS390XSLDconst { continue } - j0 := s0.AuxInt + j0 := auxIntToInt8(s0.AuxInt) x0 := s0.Args[0] if x0.Op != OpS390XMOVBZload { continue } - i0 := x0.AuxInt - if x0.Aux != s { + i0 := auxIntToInt32(x0.AuxInt) + if auxToSym(x0.Aux) != s { continue } _ = x0.Args[1] @@ -15264,11 +12278,11 @@ func rewriteValueS390X_OpS390XOR(v *Value) bool { v0 := b.NewValue0(x0.Pos, OpS390XOR, v.Type) v.copyOf(v0) v1 := b.NewValue0(x0.Pos, OpS390XSLDconst, v.Type) - v1.AuxInt = j0 + v1.AuxInt = int8ToAuxInt(j0) v2 := b.NewValue0(x0.Pos, OpS390XMOVHZreg, typ.UInt64) v3 := b.NewValue0(x0.Pos, OpS390XMOVHBRload, typ.UInt16) - v3.AuxInt = i0 - v3.Aux = s + v3.AuxInt = int32ToAuxInt(i0) + v3.Aux = symToAux(s) v3.AddArg2(p, mem) v2.AddArg(v3) v1.AddArg(v2) @@ -15287,7 +12301,7 @@ func rewriteValueS390X_OpS390XOR(v *Value) bool { if s1.Op != OpS390XSLDconst { continue } - j1 := s1.AuxInt + j1 := auxIntToInt8(s1.AuxInt) r1 := s1.Args[0] if r1.Op != OpS390XMOVHZreg { continue @@ -15296,8 +12310,8 @@ func rewriteValueS390X_OpS390XOR(v *Value) bool { if x1.Op != OpS390XMOVHBRload { continue } - i1 := x1.AuxInt - s := x1.Aux + i1 := auxIntToInt32(x1.AuxInt) + s := auxToSym(x1.Aux) mem := x1.Args[1] p := x1.Args[0] or := v_1 @@ -15312,7 +12326,7 @@ func rewriteValueS390X_OpS390XOR(v *Value) bool { if s0.Op != OpS390XSLDconst { continue } - j0 := s0.AuxInt + j0 := auxIntToInt8(s0.AuxInt) r0 := s0.Args[0] if r0.Op != OpS390XMOVHZreg { continue @@ -15321,8 +12335,8 @@ func rewriteValueS390X_OpS390XOR(v *Value) bool { if x0.Op != OpS390XMOVHBRload { continue } - i0 := x0.AuxInt - if x0.Aux != s { + i0 := auxIntToInt32(x0.AuxInt) + if auxToSym(x0.Aux) != s { continue } _ = x0.Args[1] @@ -15337,11 +12351,11 @@ func rewriteValueS390X_OpS390XOR(v *Value) bool { v0 := b.NewValue0(x0.Pos, OpS390XOR, v.Type) v.copyOf(v0) v1 := b.NewValue0(x0.Pos, OpS390XSLDconst, v.Type) - v1.AuxInt = j0 + v1.AuxInt = int8ToAuxInt(j0) v2 := b.NewValue0(x0.Pos, OpS390XMOVWZreg, typ.UInt64) v3 := b.NewValue0(x0.Pos, OpS390XMOVWBRload, typ.UInt32) - v3.AuxInt = i0 - v3.Aux = s + v3.AuxInt = int32ToAuxInt(i0) + v3.Aux = symToAux(s) v3.AddArg2(p, mem) v2.AddArg(v3) v1.AddArg(v2) @@ -15351,326 +12365,6 @@ func rewriteValueS390X_OpS390XOR(v *Value) bool { } break } - // match: (OR x0:(MOVBZloadidx [i0] {s} p idx mem) sh:(SLDconst [8] x1:(MOVBZloadidx [i1] {s} p idx mem))) - // cond: p.Op != OpSB && i1 == i0+1 && x0.Uses == 1 && x1.Uses == 1 && sh.Uses == 1 && mergePoint(b,x0,x1) != nil && clobber(x0, x1, sh) - // result: @mergePoint(b,x0,x1) (MOVHZreg (MOVHBRloadidx [i0] {s} p idx mem)) - for { - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - x0 := v_0 - if x0.Op != OpS390XMOVBZloadidx { - continue - } - i0 := x0.AuxInt - s := x0.Aux - mem := x0.Args[2] - x0_0 := x0.Args[0] - x0_1 := x0.Args[1] - for _i1 := 0; _i1 <= 1; _i1, x0_0, x0_1 = _i1+1, x0_1, x0_0 { - p := x0_0 - idx := x0_1 - sh := v_1 - if sh.Op != OpS390XSLDconst || sh.AuxInt != 8 { - continue - } - x1 := sh.Args[0] - if x1.Op != OpS390XMOVBZloadidx { - continue - } - i1 := x1.AuxInt - if x1.Aux != s { - continue - } - _ = x1.Args[2] - x1_0 := x1.Args[0] - x1_1 := x1.Args[1] - for _i2 := 0; _i2 <= 1; _i2, x1_0, x1_1 = _i2+1, x1_1, x1_0 { - if p != x1_0 || idx != x1_1 || mem != x1.Args[2] || !(p.Op != OpSB && i1 == i0+1 && x0.Uses == 1 && x1.Uses == 1 && sh.Uses == 1 && mergePoint(b, x0, x1) != nil && clobber(x0, x1, sh)) { - continue - } - b = mergePoint(b, x0, x1) - v0 := b.NewValue0(v.Pos, OpS390XMOVHZreg, typ.UInt64) - v.copyOf(v0) - v1 := b.NewValue0(v.Pos, OpS390XMOVHBRloadidx, typ.Int16) - v1.AuxInt = i0 - v1.Aux = s - v1.AddArg3(p, idx, mem) - v0.AddArg(v1) - return true - } - } - } - break - } - // match: (OR r0:(MOVHZreg x0:(MOVHBRloadidx [i0] {s} p idx mem)) sh:(SLDconst [16] r1:(MOVHZreg x1:(MOVHBRloadidx [i1] {s} p idx mem)))) - // cond: i1 == i0+2 && x0.Uses == 1 && x1.Uses == 1 && r0.Uses == 1 && r1.Uses == 1 && sh.Uses == 1 && mergePoint(b,x0,x1) != nil && clobber(x0, x1, r0, r1, sh) - // result: @mergePoint(b,x0,x1) (MOVWZreg (MOVWBRloadidx [i0] {s} p idx mem)) - for { - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - r0 := v_0 - if r0.Op != OpS390XMOVHZreg { - continue - } - x0 := r0.Args[0] - if x0.Op != OpS390XMOVHBRloadidx { - continue - } - i0 := x0.AuxInt - s := x0.Aux - mem := x0.Args[2] - x0_0 := x0.Args[0] - x0_1 := x0.Args[1] - for _i1 := 0; _i1 <= 1; _i1, x0_0, x0_1 = _i1+1, x0_1, x0_0 { - p := x0_0 - idx := x0_1 - sh := v_1 - if sh.Op != OpS390XSLDconst || sh.AuxInt != 16 { - continue - } - r1 := sh.Args[0] - if r1.Op != OpS390XMOVHZreg { - continue - } - x1 := r1.Args[0] - if x1.Op != OpS390XMOVHBRloadidx { - continue - } - i1 := x1.AuxInt - if x1.Aux != s { - continue - } - _ = x1.Args[2] - x1_0 := x1.Args[0] - x1_1 := x1.Args[1] - for _i2 := 0; _i2 <= 1; _i2, x1_0, x1_1 = _i2+1, x1_1, x1_0 { - if p != x1_0 || idx != x1_1 || mem != x1.Args[2] || !(i1 == i0+2 && x0.Uses == 1 && x1.Uses == 1 && r0.Uses == 1 && r1.Uses == 1 && sh.Uses == 1 && mergePoint(b, x0, x1) != nil && clobber(x0, x1, r0, r1, sh)) { - continue - } - b = mergePoint(b, x0, x1) - v0 := b.NewValue0(v.Pos, OpS390XMOVWZreg, typ.UInt64) - v.copyOf(v0) - v1 := b.NewValue0(v.Pos, OpS390XMOVWBRloadidx, typ.Int32) - v1.AuxInt = i0 - v1.Aux = s - v1.AddArg3(p, idx, mem) - v0.AddArg(v1) - return true - } - } - } - break - } - // match: (OR r0:(MOVWZreg x0:(MOVWBRloadidx [i0] {s} p idx mem)) sh:(SLDconst [32] r1:(MOVWZreg x1:(MOVWBRloadidx [i1] {s} p idx mem)))) - // cond: i1 == i0+4 && x0.Uses == 1 && x1.Uses == 1 && r0.Uses == 1 && r1.Uses == 1 && sh.Uses == 1 && mergePoint(b,x0,x1) != nil && clobber(x0, x1, r0, r1, sh) - // result: @mergePoint(b,x0,x1) (MOVDBRloadidx [i0] {s} p idx mem) - for { - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - r0 := v_0 - if r0.Op != OpS390XMOVWZreg { - continue - } - x0 := r0.Args[0] - if x0.Op != OpS390XMOVWBRloadidx { - continue - } - i0 := x0.AuxInt - s := x0.Aux - mem := x0.Args[2] - x0_0 := x0.Args[0] - x0_1 := x0.Args[1] - for _i1 := 0; _i1 <= 1; _i1, x0_0, x0_1 = _i1+1, x0_1, x0_0 { - p := x0_0 - idx := x0_1 - sh := v_1 - if sh.Op != OpS390XSLDconst || sh.AuxInt != 32 { - continue - } - r1 := sh.Args[0] - if r1.Op != OpS390XMOVWZreg { - continue - } - x1 := r1.Args[0] - if x1.Op != OpS390XMOVWBRloadidx { - continue - } - i1 := x1.AuxInt - if x1.Aux != s { - continue - } - _ = x1.Args[2] - x1_0 := x1.Args[0] - x1_1 := x1.Args[1] - for _i2 := 0; _i2 <= 1; _i2, x1_0, x1_1 = _i2+1, x1_1, x1_0 { - if p != x1_0 || idx != x1_1 || mem != x1.Args[2] || !(i1 == i0+4 && x0.Uses == 1 && x1.Uses == 1 && r0.Uses == 1 && r1.Uses == 1 && sh.Uses == 1 && mergePoint(b, x0, x1) != nil && clobber(x0, x1, r0, r1, sh)) { - continue - } - b = mergePoint(b, x0, x1) - v0 := b.NewValue0(v.Pos, OpS390XMOVDBRloadidx, typ.Int64) - v.copyOf(v0) - v0.AuxInt = i0 - v0.Aux = s - v0.AddArg3(p, idx, mem) - return true - } - } - } - break - } - // match: (OR s1:(SLDconst [j1] x1:(MOVBZloadidx [i1] {s} p idx mem)) or:(OR s0:(SLDconst [j0] x0:(MOVBZloadidx [i0] {s} p idx mem)) y)) - // cond: p.Op != OpSB && i1 == i0+1 && j1 == j0+8 && j0 % 16 == 0 && x0.Uses == 1 && x1.Uses == 1 && s0.Uses == 1 && s1.Uses == 1 && or.Uses == 1 && mergePoint(b,x0,x1,y) != nil && clobber(x0, x1, s0, s1, or) - // result: @mergePoint(b,x0,x1,y) (OR <v.Type> (SLDconst <v.Type> [j0] (MOVHZreg (MOVHBRloadidx [i0] {s} p idx mem))) y) - for { - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - s1 := v_0 - if s1.Op != OpS390XSLDconst { - continue - } - j1 := s1.AuxInt - x1 := s1.Args[0] - if x1.Op != OpS390XMOVBZloadidx { - continue - } - i1 := x1.AuxInt - s := x1.Aux - mem := x1.Args[2] - x1_0 := x1.Args[0] - x1_1 := x1.Args[1] - for _i1 := 0; _i1 <= 1; _i1, x1_0, x1_1 = _i1+1, x1_1, x1_0 { - p := x1_0 - idx := x1_1 - or := v_1 - if or.Op != OpS390XOR { - continue - } - _ = or.Args[1] - or_0 := or.Args[0] - or_1 := or.Args[1] - for _i2 := 0; _i2 <= 1; _i2, or_0, or_1 = _i2+1, or_1, or_0 { - s0 := or_0 - if s0.Op != OpS390XSLDconst { - continue - } - j0 := s0.AuxInt - x0 := s0.Args[0] - if x0.Op != OpS390XMOVBZloadidx { - continue - } - i0 := x0.AuxInt - if x0.Aux != s { - continue - } - _ = x0.Args[2] - x0_0 := x0.Args[0] - x0_1 := x0.Args[1] - for _i3 := 0; _i3 <= 1; _i3, x0_0, x0_1 = _i3+1, x0_1, x0_0 { - if p != x0_0 || idx != x0_1 || mem != x0.Args[2] { - continue - } - y := or_1 - if !(p.Op != OpSB && i1 == i0+1 && j1 == j0+8 && j0%16 == 0 && x0.Uses == 1 && x1.Uses == 1 && s0.Uses == 1 && s1.Uses == 1 && or.Uses == 1 && mergePoint(b, x0, x1, y) != nil && clobber(x0, x1, s0, s1, or)) { - continue - } - b = mergePoint(b, x0, x1, y) - v0 := b.NewValue0(v.Pos, OpS390XOR, v.Type) - v.copyOf(v0) - v1 := b.NewValue0(v.Pos, OpS390XSLDconst, v.Type) - v1.AuxInt = j0 - v2 := b.NewValue0(v.Pos, OpS390XMOVHZreg, typ.UInt64) - v3 := b.NewValue0(v.Pos, OpS390XMOVHBRloadidx, typ.Int16) - v3.AuxInt = i0 - v3.Aux = s - v3.AddArg3(p, idx, mem) - v2.AddArg(v3) - v1.AddArg(v2) - v0.AddArg2(v1, y) - return true - } - } - } - } - break - } - // match: (OR s1:(SLDconst [j1] r1:(MOVHZreg x1:(MOVHBRloadidx [i1] {s} p idx mem))) or:(OR s0:(SLDconst [j0] r0:(MOVHZreg x0:(MOVHBRloadidx [i0] {s} p idx mem))) y)) - // cond: i1 == i0+2 && j1 == j0+16 && j0 % 32 == 0 && x0.Uses == 1 && x1.Uses == 1 && r0.Uses == 1 && r1.Uses == 1 && s0.Uses == 1 && s1.Uses == 1 && or.Uses == 1 && mergePoint(b,x0,x1,y) != nil && clobber(x0, x1, r0, r1, s0, s1, or) - // result: @mergePoint(b,x0,x1,y) (OR <v.Type> (SLDconst <v.Type> [j0] (MOVWZreg (MOVWBRloadidx [i0] {s} p idx mem))) y) - for { - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - s1 := v_0 - if s1.Op != OpS390XSLDconst { - continue - } - j1 := s1.AuxInt - r1 := s1.Args[0] - if r1.Op != OpS390XMOVHZreg { - continue - } - x1 := r1.Args[0] - if x1.Op != OpS390XMOVHBRloadidx { - continue - } - i1 := x1.AuxInt - s := x1.Aux - mem := x1.Args[2] - x1_0 := x1.Args[0] - x1_1 := x1.Args[1] - for _i1 := 0; _i1 <= 1; _i1, x1_0, x1_1 = _i1+1, x1_1, x1_0 { - p := x1_0 - idx := x1_1 - or := v_1 - if or.Op != OpS390XOR { - continue - } - _ = or.Args[1] - or_0 := or.Args[0] - or_1 := or.Args[1] - for _i2 := 0; _i2 <= 1; _i2, or_0, or_1 = _i2+1, or_1, or_0 { - s0 := or_0 - if s0.Op != OpS390XSLDconst { - continue - } - j0 := s0.AuxInt - r0 := s0.Args[0] - if r0.Op != OpS390XMOVHZreg { - continue - } - x0 := r0.Args[0] - if x0.Op != OpS390XMOVHBRloadidx { - continue - } - i0 := x0.AuxInt - if x0.Aux != s { - continue - } - _ = x0.Args[2] - x0_0 := x0.Args[0] - x0_1 := x0.Args[1] - for _i3 := 0; _i3 <= 1; _i3, x0_0, x0_1 = _i3+1, x0_1, x0_0 { - if p != x0_0 || idx != x0_1 || mem != x0.Args[2] { - continue - } - y := or_1 - if !(i1 == i0+2 && j1 == j0+16 && j0%32 == 0 && x0.Uses == 1 && x1.Uses == 1 && r0.Uses == 1 && r1.Uses == 1 && s0.Uses == 1 && s1.Uses == 1 && or.Uses == 1 && mergePoint(b, x0, x1, y) != nil && clobber(x0, x1, r0, r1, s0, s1, or)) { - continue - } - b = mergePoint(b, x0, x1, y) - v0 := b.NewValue0(v.Pos, OpS390XOR, v.Type) - v.copyOf(v0) - v1 := b.NewValue0(v.Pos, OpS390XSLDconst, v.Type) - v1.AuxInt = j0 - v2 := b.NewValue0(v.Pos, OpS390XMOVWZreg, typ.UInt64) - v3 := b.NewValue0(v.Pos, OpS390XMOVWBRloadidx, typ.Int32) - v3.AuxInt = i0 - v3.Aux = s - v3.AddArg3(p, idx, mem) - v2.AddArg(v3) - v1.AddArg(v2) - v0.AddArg2(v1, y) - return true - } - } - } - } - break - } return false } func rewriteValueS390X_OpS390XORW(v *Value) bool { @@ -15679,16 +12373,16 @@ func rewriteValueS390X_OpS390XORW(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (ORW x (MOVDconst [c])) - // result: (ORWconst [int64(int32(c))] x) + // result: (ORWconst [int32(c)] x) for { for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { x := v_0 if v_1.Op != OpS390XMOVDconst { continue } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) v.reset(OpS390XORWconst) - v.AuxInt = int64(int32(c)) + v.AuxInt = int32ToAuxInt(int32(c)) v.AddArg(x) return true } @@ -15729,7 +12423,7 @@ func rewriteValueS390X_OpS390XORW(v *Value) bool { return true } // match: (ORW <t> x g:(MOVWload [off] {sym} ptr mem)) - // cond: ptr.Op != OpSB && is20Bit(off) && canMergeLoadClobber(v, g, x) && clobber(g) + // cond: ptr.Op != OpSB && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g) // result: (ORWload <t> [off] {sym} x ptr mem) for { t := v.Type @@ -15739,24 +12433,24 @@ func rewriteValueS390X_OpS390XORW(v *Value) bool { if g.Op != OpS390XMOVWload { continue } - off := g.AuxInt - sym := g.Aux + off := auxIntToInt32(g.AuxInt) + sym := auxToSym(g.Aux) mem := g.Args[1] ptr := g.Args[0] - if !(ptr.Op != OpSB && is20Bit(off) && canMergeLoadClobber(v, g, x) && clobber(g)) { + if !(ptr.Op != OpSB && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g)) { continue } v.reset(OpS390XORWload) v.Type = t - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(x, ptr, mem) return true } break } // match: (ORW <t> x g:(MOVWZload [off] {sym} ptr mem)) - // cond: ptr.Op != OpSB && is20Bit(off) && canMergeLoadClobber(v, g, x) && clobber(g) + // cond: ptr.Op != OpSB && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g) // result: (ORWload <t> [off] {sym} x ptr mem) for { t := v.Type @@ -15766,17 +12460,17 @@ func rewriteValueS390X_OpS390XORW(v *Value) bool { if g.Op != OpS390XMOVWZload { continue } - off := g.AuxInt - sym := g.Aux + off := auxIntToInt32(g.AuxInt) + sym := auxToSym(g.Aux) mem := g.Args[1] ptr := g.Args[0] - if !(ptr.Op != OpSB && is20Bit(off) && canMergeLoadClobber(v, g, x) && clobber(g)) { + if !(ptr.Op != OpSB && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g)) { continue } v.reset(OpS390XORWload) v.Type = t - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(x, ptr, mem) return true } @@ -15791,20 +12485,20 @@ func rewriteValueS390X_OpS390XORW(v *Value) bool { if x1.Op != OpS390XMOVBZload { continue } - i1 := x1.AuxInt - s := x1.Aux + i1 := auxIntToInt32(x1.AuxInt) + s := auxToSym(x1.Aux) mem := x1.Args[1] p := x1.Args[0] sh := v_1 - if sh.Op != OpS390XSLWconst || sh.AuxInt != 8 { + if sh.Op != OpS390XSLWconst || auxIntToInt8(sh.AuxInt) != 8 { continue } x0 := sh.Args[0] if x0.Op != OpS390XMOVBZload { continue } - i0 := x0.AuxInt - if x0.Aux != s { + i0 := auxIntToInt32(x0.AuxInt) + if auxToSym(x0.Aux) != s { continue } _ = x0.Args[1] @@ -15814,8 +12508,8 @@ func rewriteValueS390X_OpS390XORW(v *Value) bool { b = mergePoint(b, x0, x1) v0 := b.NewValue0(x0.Pos, OpS390XMOVHZload, typ.UInt16) v.copyOf(v0) - v0.AuxInt = i0 - v0.Aux = s + v0.AuxInt = int32ToAuxInt(i0) + v0.Aux = symToAux(s) v0.AddArg2(p, mem) return true } @@ -15830,20 +12524,20 @@ func rewriteValueS390X_OpS390XORW(v *Value) bool { if x1.Op != OpS390XMOVHZload { continue } - i1 := x1.AuxInt - s := x1.Aux + i1 := auxIntToInt32(x1.AuxInt) + s := auxToSym(x1.Aux) mem := x1.Args[1] p := x1.Args[0] sh := v_1 - if sh.Op != OpS390XSLWconst || sh.AuxInt != 16 { + if sh.Op != OpS390XSLWconst || auxIntToInt8(sh.AuxInt) != 16 { continue } x0 := sh.Args[0] if x0.Op != OpS390XMOVHZload { continue } - i0 := x0.AuxInt - if x0.Aux != s { + i0 := auxIntToInt32(x0.AuxInt) + if auxToSym(x0.Aux) != s { continue } _ = x0.Args[1] @@ -15853,8 +12547,8 @@ func rewriteValueS390X_OpS390XORW(v *Value) bool { b = mergePoint(b, x0, x1) v0 := b.NewValue0(x0.Pos, OpS390XMOVWZload, typ.UInt32) v.copyOf(v0) - v0.AuxInt = i0 - v0.Aux = s + v0.AuxInt = int32ToAuxInt(i0) + v0.Aux = symToAux(s) v0.AddArg2(p, mem) return true } @@ -15869,13 +12563,13 @@ func rewriteValueS390X_OpS390XORW(v *Value) bool { if s0.Op != OpS390XSLWconst { continue } - j0 := s0.AuxInt + j0 := auxIntToInt8(s0.AuxInt) x0 := s0.Args[0] if x0.Op != OpS390XMOVBZload { continue } - i0 := x0.AuxInt - s := x0.Aux + i0 := auxIntToInt32(x0.AuxInt) + s := auxToSym(x0.Aux) mem := x0.Args[1] p := x0.Args[0] or := v_1 @@ -15890,13 +12584,13 @@ func rewriteValueS390X_OpS390XORW(v *Value) bool { if s1.Op != OpS390XSLWconst { continue } - j1 := s1.AuxInt + j1 := auxIntToInt8(s1.AuxInt) x1 := s1.Args[0] if x1.Op != OpS390XMOVBZload { continue } - i1 := x1.AuxInt - if x1.Aux != s { + i1 := auxIntToInt32(x1.AuxInt) + if auxToSym(x1.Aux) != s { continue } _ = x1.Args[1] @@ -15911,10 +12605,10 @@ func rewriteValueS390X_OpS390XORW(v *Value) bool { v0 := b.NewValue0(x1.Pos, OpS390XORW, v.Type) v.copyOf(v0) v1 := b.NewValue0(x1.Pos, OpS390XSLWconst, v.Type) - v1.AuxInt = j1 + v1.AuxInt = int8ToAuxInt(j1) v2 := b.NewValue0(x1.Pos, OpS390XMOVHZload, typ.UInt16) - v2.AuxInt = i0 - v2.Aux = s + v2.AuxInt = int32ToAuxInt(i0) + v2.Aux = symToAux(s) v2.AddArg2(p, mem) v1.AddArg(v2) v0.AddArg2(v1, y) @@ -15923,174 +12617,6 @@ func rewriteValueS390X_OpS390XORW(v *Value) bool { } break } - // match: (ORW x1:(MOVBZloadidx [i1] {s} p idx mem) sh:(SLWconst [8] x0:(MOVBZloadidx [i0] {s} p idx mem))) - // cond: i1 == i0+1 && p.Op != OpSB && x0.Uses == 1 && x1.Uses == 1 && sh.Uses == 1 && mergePoint(b,x0,x1) != nil && clobber(x0, x1, sh) - // result: @mergePoint(b,x0,x1) (MOVHZloadidx [i0] {s} p idx mem) - for { - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - x1 := v_0 - if x1.Op != OpS390XMOVBZloadidx { - continue - } - i1 := x1.AuxInt - s := x1.Aux - mem := x1.Args[2] - x1_0 := x1.Args[0] - x1_1 := x1.Args[1] - for _i1 := 0; _i1 <= 1; _i1, x1_0, x1_1 = _i1+1, x1_1, x1_0 { - p := x1_0 - idx := x1_1 - sh := v_1 - if sh.Op != OpS390XSLWconst || sh.AuxInt != 8 { - continue - } - x0 := sh.Args[0] - if x0.Op != OpS390XMOVBZloadidx { - continue - } - i0 := x0.AuxInt - if x0.Aux != s { - continue - } - _ = x0.Args[2] - x0_0 := x0.Args[0] - x0_1 := x0.Args[1] - for _i2 := 0; _i2 <= 1; _i2, x0_0, x0_1 = _i2+1, x0_1, x0_0 { - if p != x0_0 || idx != x0_1 || mem != x0.Args[2] || !(i1 == i0+1 && p.Op != OpSB && x0.Uses == 1 && x1.Uses == 1 && sh.Uses == 1 && mergePoint(b, x0, x1) != nil && clobber(x0, x1, sh)) { - continue - } - b = mergePoint(b, x0, x1) - v0 := b.NewValue0(v.Pos, OpS390XMOVHZloadidx, typ.UInt16) - v.copyOf(v0) - v0.AuxInt = i0 - v0.Aux = s - v0.AddArg3(p, idx, mem) - return true - } - } - } - break - } - // match: (ORW x1:(MOVHZloadidx [i1] {s} p idx mem) sh:(SLWconst [16] x0:(MOVHZloadidx [i0] {s} p idx mem))) - // cond: i1 == i0+2 && p.Op != OpSB && x0.Uses == 1 && x1.Uses == 1 && sh.Uses == 1 && mergePoint(b,x0,x1) != nil && clobber(x0, x1, sh) - // result: @mergePoint(b,x0,x1) (MOVWZloadidx [i0] {s} p idx mem) - for { - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - x1 := v_0 - if x1.Op != OpS390XMOVHZloadidx { - continue - } - i1 := x1.AuxInt - s := x1.Aux - mem := x1.Args[2] - x1_0 := x1.Args[0] - x1_1 := x1.Args[1] - for _i1 := 0; _i1 <= 1; _i1, x1_0, x1_1 = _i1+1, x1_1, x1_0 { - p := x1_0 - idx := x1_1 - sh := v_1 - if sh.Op != OpS390XSLWconst || sh.AuxInt != 16 { - continue - } - x0 := sh.Args[0] - if x0.Op != OpS390XMOVHZloadidx { - continue - } - i0 := x0.AuxInt - if x0.Aux != s { - continue - } - _ = x0.Args[2] - x0_0 := x0.Args[0] - x0_1 := x0.Args[1] - for _i2 := 0; _i2 <= 1; _i2, x0_0, x0_1 = _i2+1, x0_1, x0_0 { - if p != x0_0 || idx != x0_1 || mem != x0.Args[2] || !(i1 == i0+2 && p.Op != OpSB && x0.Uses == 1 && x1.Uses == 1 && sh.Uses == 1 && mergePoint(b, x0, x1) != nil && clobber(x0, x1, sh)) { - continue - } - b = mergePoint(b, x0, x1) - v0 := b.NewValue0(v.Pos, OpS390XMOVWZloadidx, typ.UInt32) - v.copyOf(v0) - v0.AuxInt = i0 - v0.Aux = s - v0.AddArg3(p, idx, mem) - return true - } - } - } - break - } - // match: (ORW s0:(SLWconst [j0] x0:(MOVBZloadidx [i0] {s} p idx mem)) or:(ORW s1:(SLWconst [j1] x1:(MOVBZloadidx [i1] {s} p idx mem)) y)) - // cond: i1 == i0+1 && j1 == j0-8 && j1 % 16 == 0 && x0.Uses == 1 && x1.Uses == 1 && s0.Uses == 1 && s1.Uses == 1 && or.Uses == 1 && mergePoint(b,x0,x1,y) != nil && clobber(x0, x1, s0, s1, or) - // result: @mergePoint(b,x0,x1,y) (ORW <v.Type> (SLWconst <v.Type> [j1] (MOVHZloadidx [i0] {s} p idx mem)) y) - for { - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - s0 := v_0 - if s0.Op != OpS390XSLWconst { - continue - } - j0 := s0.AuxInt - x0 := s0.Args[0] - if x0.Op != OpS390XMOVBZloadidx { - continue - } - i0 := x0.AuxInt - s := x0.Aux - mem := x0.Args[2] - x0_0 := x0.Args[0] - x0_1 := x0.Args[1] - for _i1 := 0; _i1 <= 1; _i1, x0_0, x0_1 = _i1+1, x0_1, x0_0 { - p := x0_0 - idx := x0_1 - or := v_1 - if or.Op != OpS390XORW { - continue - } - _ = or.Args[1] - or_0 := or.Args[0] - or_1 := or.Args[1] - for _i2 := 0; _i2 <= 1; _i2, or_0, or_1 = _i2+1, or_1, or_0 { - s1 := or_0 - if s1.Op != OpS390XSLWconst { - continue - } - j1 := s1.AuxInt - x1 := s1.Args[0] - if x1.Op != OpS390XMOVBZloadidx { - continue - } - i1 := x1.AuxInt - if x1.Aux != s { - continue - } - _ = x1.Args[2] - x1_0 := x1.Args[0] - x1_1 := x1.Args[1] - for _i3 := 0; _i3 <= 1; _i3, x1_0, x1_1 = _i3+1, x1_1, x1_0 { - if p != x1_0 || idx != x1_1 || mem != x1.Args[2] { - continue - } - y := or_1 - if !(i1 == i0+1 && j1 == j0-8 && j1%16 == 0 && x0.Uses == 1 && x1.Uses == 1 && s0.Uses == 1 && s1.Uses == 1 && or.Uses == 1 && mergePoint(b, x0, x1, y) != nil && clobber(x0, x1, s0, s1, or)) { - continue - } - b = mergePoint(b, x0, x1, y) - v0 := b.NewValue0(v.Pos, OpS390XORW, v.Type) - v.copyOf(v0) - v1 := b.NewValue0(v.Pos, OpS390XSLWconst, v.Type) - v1.AuxInt = j1 - v2 := b.NewValue0(v.Pos, OpS390XMOVHZloadidx, typ.UInt16) - v2.AuxInt = i0 - v2.Aux = s - v2.AddArg3(p, idx, mem) - v1.AddArg(v2) - v0.AddArg2(v1, y) - return true - } - } - } - } - break - } // match: (ORW x0:(MOVBZload [i0] {s} p mem) sh:(SLWconst [8] x1:(MOVBZload [i1] {s} p mem))) // cond: p.Op != OpSB && i1 == i0+1 && x0.Uses == 1 && x1.Uses == 1 && sh.Uses == 1 && mergePoint(b,x0,x1) != nil && clobber(x0, x1, sh) // result: @mergePoint(b,x0,x1) (MOVHZreg (MOVHBRload [i0] {s} p mem)) @@ -16100,20 +12626,20 @@ func rewriteValueS390X_OpS390XORW(v *Value) bool { if x0.Op != OpS390XMOVBZload { continue } - i0 := x0.AuxInt - s := x0.Aux + i0 := auxIntToInt32(x0.AuxInt) + s := auxToSym(x0.Aux) mem := x0.Args[1] p := x0.Args[0] sh := v_1 - if sh.Op != OpS390XSLWconst || sh.AuxInt != 8 { + if sh.Op != OpS390XSLWconst || auxIntToInt8(sh.AuxInt) != 8 { continue } x1 := sh.Args[0] if x1.Op != OpS390XMOVBZload { continue } - i1 := x1.AuxInt - if x1.Aux != s { + i1 := auxIntToInt32(x1.AuxInt) + if auxToSym(x1.Aux) != s { continue } _ = x1.Args[1] @@ -16124,8 +12650,8 @@ func rewriteValueS390X_OpS390XORW(v *Value) bool { v0 := b.NewValue0(x1.Pos, OpS390XMOVHZreg, typ.UInt64) v.copyOf(v0) v1 := b.NewValue0(x1.Pos, OpS390XMOVHBRload, typ.UInt16) - v1.AuxInt = i0 - v1.Aux = s + v1.AuxInt = int32ToAuxInt(i0) + v1.Aux = symToAux(s) v1.AddArg2(p, mem) v0.AddArg(v1) return true @@ -16145,12 +12671,12 @@ func rewriteValueS390X_OpS390XORW(v *Value) bool { if x0.Op != OpS390XMOVHBRload { continue } - i0 := x0.AuxInt - s := x0.Aux + i0 := auxIntToInt32(x0.AuxInt) + s := auxToSym(x0.Aux) mem := x0.Args[1] p := x0.Args[0] sh := v_1 - if sh.Op != OpS390XSLWconst || sh.AuxInt != 16 { + if sh.Op != OpS390XSLWconst || auxIntToInt8(sh.AuxInt) != 16 { continue } r1 := sh.Args[0] @@ -16161,8 +12687,8 @@ func rewriteValueS390X_OpS390XORW(v *Value) bool { if x1.Op != OpS390XMOVHBRload { continue } - i1 := x1.AuxInt - if x1.Aux != s { + i1 := auxIntToInt32(x1.AuxInt) + if auxToSym(x1.Aux) != s { continue } _ = x1.Args[1] @@ -16172,8 +12698,8 @@ func rewriteValueS390X_OpS390XORW(v *Value) bool { b = mergePoint(b, x0, x1) v0 := b.NewValue0(x1.Pos, OpS390XMOVWBRload, typ.UInt32) v.copyOf(v0) - v0.AuxInt = i0 - v0.Aux = s + v0.AuxInt = int32ToAuxInt(i0) + v0.Aux = symToAux(s) v0.AddArg2(p, mem) return true } @@ -16188,13 +12714,13 @@ func rewriteValueS390X_OpS390XORW(v *Value) bool { if s1.Op != OpS390XSLWconst { continue } - j1 := s1.AuxInt + j1 := auxIntToInt8(s1.AuxInt) x1 := s1.Args[0] if x1.Op != OpS390XMOVBZload { continue } - i1 := x1.AuxInt - s := x1.Aux + i1 := auxIntToInt32(x1.AuxInt) + s := auxToSym(x1.Aux) mem := x1.Args[1] p := x1.Args[0] or := v_1 @@ -16209,13 +12735,13 @@ func rewriteValueS390X_OpS390XORW(v *Value) bool { if s0.Op != OpS390XSLWconst { continue } - j0 := s0.AuxInt + j0 := auxIntToInt8(s0.AuxInt) x0 := s0.Args[0] if x0.Op != OpS390XMOVBZload { continue } - i0 := x0.AuxInt - if x0.Aux != s { + i0 := auxIntToInt32(x0.AuxInt) + if auxToSym(x0.Aux) != s { continue } _ = x0.Args[1] @@ -16230,11 +12756,11 @@ func rewriteValueS390X_OpS390XORW(v *Value) bool { v0 := b.NewValue0(x0.Pos, OpS390XORW, v.Type) v.copyOf(v0) v1 := b.NewValue0(x0.Pos, OpS390XSLWconst, v.Type) - v1.AuxInt = j0 + v1.AuxInt = int8ToAuxInt(j0) v2 := b.NewValue0(x0.Pos, OpS390XMOVHZreg, typ.UInt64) v3 := b.NewValue0(x0.Pos, OpS390XMOVHBRload, typ.UInt16) - v3.AuxInt = i0 - v3.Aux = s + v3.AuxInt = int32ToAuxInt(i0) + v3.Aux = symToAux(s) v3.AddArg2(p, mem) v2.AddArg(v3) v1.AddArg(v2) @@ -16244,186 +12770,6 @@ func rewriteValueS390X_OpS390XORW(v *Value) bool { } break } - // match: (ORW x0:(MOVBZloadidx [i0] {s} p idx mem) sh:(SLWconst [8] x1:(MOVBZloadidx [i1] {s} p idx mem))) - // cond: p.Op != OpSB && i1 == i0+1 && x0.Uses == 1 && x1.Uses == 1 && sh.Uses == 1 && mergePoint(b,x0,x1) != nil && clobber(x0, x1, sh) - // result: @mergePoint(b,x0,x1) (MOVHZreg (MOVHBRloadidx [i0] {s} p idx mem)) - for { - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - x0 := v_0 - if x0.Op != OpS390XMOVBZloadidx { - continue - } - i0 := x0.AuxInt - s := x0.Aux - mem := x0.Args[2] - x0_0 := x0.Args[0] - x0_1 := x0.Args[1] - for _i1 := 0; _i1 <= 1; _i1, x0_0, x0_1 = _i1+1, x0_1, x0_0 { - p := x0_0 - idx := x0_1 - sh := v_1 - if sh.Op != OpS390XSLWconst || sh.AuxInt != 8 { - continue - } - x1 := sh.Args[0] - if x1.Op != OpS390XMOVBZloadidx { - continue - } - i1 := x1.AuxInt - if x1.Aux != s { - continue - } - _ = x1.Args[2] - x1_0 := x1.Args[0] - x1_1 := x1.Args[1] - for _i2 := 0; _i2 <= 1; _i2, x1_0, x1_1 = _i2+1, x1_1, x1_0 { - if p != x1_0 || idx != x1_1 || mem != x1.Args[2] || !(p.Op != OpSB && i1 == i0+1 && x0.Uses == 1 && x1.Uses == 1 && sh.Uses == 1 && mergePoint(b, x0, x1) != nil && clobber(x0, x1, sh)) { - continue - } - b = mergePoint(b, x0, x1) - v0 := b.NewValue0(v.Pos, OpS390XMOVHZreg, typ.UInt64) - v.copyOf(v0) - v1 := b.NewValue0(v.Pos, OpS390XMOVHBRloadidx, typ.Int16) - v1.AuxInt = i0 - v1.Aux = s - v1.AddArg3(p, idx, mem) - v0.AddArg(v1) - return true - } - } - } - break - } - // match: (ORW r0:(MOVHZreg x0:(MOVHBRloadidx [i0] {s} p idx mem)) sh:(SLWconst [16] r1:(MOVHZreg x1:(MOVHBRloadidx [i1] {s} p idx mem)))) - // cond: i1 == i0+2 && x0.Uses == 1 && x1.Uses == 1 && r0.Uses == 1 && r1.Uses == 1 && sh.Uses == 1 && mergePoint(b,x0,x1) != nil && clobber(x0, x1, r0, r1, sh) - // result: @mergePoint(b,x0,x1) (MOVWBRloadidx [i0] {s} p idx mem) - for { - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - r0 := v_0 - if r0.Op != OpS390XMOVHZreg { - continue - } - x0 := r0.Args[0] - if x0.Op != OpS390XMOVHBRloadidx { - continue - } - i0 := x0.AuxInt - s := x0.Aux - mem := x0.Args[2] - x0_0 := x0.Args[0] - x0_1 := x0.Args[1] - for _i1 := 0; _i1 <= 1; _i1, x0_0, x0_1 = _i1+1, x0_1, x0_0 { - p := x0_0 - idx := x0_1 - sh := v_1 - if sh.Op != OpS390XSLWconst || sh.AuxInt != 16 { - continue - } - r1 := sh.Args[0] - if r1.Op != OpS390XMOVHZreg { - continue - } - x1 := r1.Args[0] - if x1.Op != OpS390XMOVHBRloadidx { - continue - } - i1 := x1.AuxInt - if x1.Aux != s { - continue - } - _ = x1.Args[2] - x1_0 := x1.Args[0] - x1_1 := x1.Args[1] - for _i2 := 0; _i2 <= 1; _i2, x1_0, x1_1 = _i2+1, x1_1, x1_0 { - if p != x1_0 || idx != x1_1 || mem != x1.Args[2] || !(i1 == i0+2 && x0.Uses == 1 && x1.Uses == 1 && r0.Uses == 1 && r1.Uses == 1 && sh.Uses == 1 && mergePoint(b, x0, x1) != nil && clobber(x0, x1, r0, r1, sh)) { - continue - } - b = mergePoint(b, x0, x1) - v0 := b.NewValue0(v.Pos, OpS390XMOVWBRloadidx, typ.Int32) - v.copyOf(v0) - v0.AuxInt = i0 - v0.Aux = s - v0.AddArg3(p, idx, mem) - return true - } - } - } - break - } - // match: (ORW s1:(SLWconst [j1] x1:(MOVBZloadidx [i1] {s} p idx mem)) or:(ORW s0:(SLWconst [j0] x0:(MOVBZloadidx [i0] {s} p idx mem)) y)) - // cond: p.Op != OpSB && i1 == i0+1 && j1 == j0+8 && j0 % 16 == 0 && x0.Uses == 1 && x1.Uses == 1 && s0.Uses == 1 && s1.Uses == 1 && or.Uses == 1 && mergePoint(b,x0,x1,y) != nil && clobber(x0, x1, s0, s1, or) - // result: @mergePoint(b,x0,x1,y) (ORW <v.Type> (SLWconst <v.Type> [j0] (MOVHZreg (MOVHBRloadidx [i0] {s} p idx mem))) y) - for { - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - s1 := v_0 - if s1.Op != OpS390XSLWconst { - continue - } - j1 := s1.AuxInt - x1 := s1.Args[0] - if x1.Op != OpS390XMOVBZloadidx { - continue - } - i1 := x1.AuxInt - s := x1.Aux - mem := x1.Args[2] - x1_0 := x1.Args[0] - x1_1 := x1.Args[1] - for _i1 := 0; _i1 <= 1; _i1, x1_0, x1_1 = _i1+1, x1_1, x1_0 { - p := x1_0 - idx := x1_1 - or := v_1 - if or.Op != OpS390XORW { - continue - } - _ = or.Args[1] - or_0 := or.Args[0] - or_1 := or.Args[1] - for _i2 := 0; _i2 <= 1; _i2, or_0, or_1 = _i2+1, or_1, or_0 { - s0 := or_0 - if s0.Op != OpS390XSLWconst { - continue - } - j0 := s0.AuxInt - x0 := s0.Args[0] - if x0.Op != OpS390XMOVBZloadidx { - continue - } - i0 := x0.AuxInt - if x0.Aux != s { - continue - } - _ = x0.Args[2] - x0_0 := x0.Args[0] - x0_1 := x0.Args[1] - for _i3 := 0; _i3 <= 1; _i3, x0_0, x0_1 = _i3+1, x0_1, x0_0 { - if p != x0_0 || idx != x0_1 || mem != x0.Args[2] { - continue - } - y := or_1 - if !(p.Op != OpSB && i1 == i0+1 && j1 == j0+8 && j0%16 == 0 && x0.Uses == 1 && x1.Uses == 1 && s0.Uses == 1 && s1.Uses == 1 && or.Uses == 1 && mergePoint(b, x0, x1, y) != nil && clobber(x0, x1, s0, s1, or)) { - continue - } - b = mergePoint(b, x0, x1, y) - v0 := b.NewValue0(v.Pos, OpS390XORW, v.Type) - v.copyOf(v0) - v1 := b.NewValue0(v.Pos, OpS390XSLWconst, v.Type) - v1.AuxInt = j0 - v2 := b.NewValue0(v.Pos, OpS390XMOVHZreg, typ.UInt64) - v3 := b.NewValue0(v.Pos, OpS390XMOVHBRloadidx, typ.Int16) - v3.AuxInt = i0 - v3.Aux = s - v3.AddArg3(p, idx, mem) - v2.AddArg(v3) - v1.AddArg(v2) - v0.AddArg2(v1, y) - return true - } - } - } - } - break - } return false } func rewriteValueS390X_OpS390XORWconst(v *Value) bool { @@ -16453,15 +12799,15 @@ func rewriteValueS390X_OpS390XORWconst(v *Value) bool { return true } // match: (ORWconst [c] (MOVDconst [d])) - // result: (MOVDconst [c|d]) + // result: (MOVDconst [int64(c)|d]) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) if v_0.Op != OpS390XMOVDconst { break } - d := v_0.AuxInt + d := auxIntToInt64(v_0.AuxInt) v.reset(OpS390XMOVDconst) - v.AuxInt = c | d + v.AuxInt = int64ToAuxInt(int64(c) | d) return true } return false @@ -16471,47 +12817,47 @@ func rewriteValueS390X_OpS390XORWload(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (ORWload [off1] {sym} x (ADDconst [off2] ptr) mem) - // cond: ptr.Op != OpSB && is20Bit(off1+off2) + // cond: ptr.Op != OpSB && is20Bit(int64(off1)+int64(off2)) // result: (ORWload [off1+off2] {sym} x ptr mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) x := v_0 if v_1.Op != OpS390XADDconst { break } - off2 := v_1.AuxInt + off2 := auxIntToInt32(v_1.AuxInt) ptr := v_1.Args[0] mem := v_2 - if !(ptr.Op != OpSB && is20Bit(off1+off2)) { + if !(ptr.Op != OpSB && is20Bit(int64(off1)+int64(off2))) { break } v.reset(OpS390XORWload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(x, ptr, mem) return true } // match: (ORWload [o1] {s1} x (MOVDaddr [o2] {s2} ptr) mem) - // cond: ptr.Op != OpSB && is20Bit(o1+o2) && canMergeSym(s1, s2) - // result: (ORWload [o1+o2] {mergeSym(s1, s2)} x ptr mem) + // cond: ptr.Op != OpSB && is20Bit(int64(o1)+int64(o2)) && canMergeSym(s1, s2) + // result: (ORWload [o1+o2] {mergeSymTyped(s1, s2)} x ptr mem) for { - o1 := v.AuxInt - s1 := v.Aux + o1 := auxIntToInt32(v.AuxInt) + s1 := auxToSym(v.Aux) x := v_0 if v_1.Op != OpS390XMOVDaddr { break } - o2 := v_1.AuxInt - s2 := v_1.Aux + o2 := auxIntToInt32(v_1.AuxInt) + s2 := auxToSym(v_1.Aux) ptr := v_1.Args[0] mem := v_2 - if !(ptr.Op != OpSB && is20Bit(o1+o2) && canMergeSym(s1, s2)) { + if !(ptr.Op != OpSB && is20Bit(int64(o1)+int64(o2)) && canMergeSym(s1, s2)) { break } v.reset(OpS390XORWload) - v.AuxInt = o1 + o2 - v.Aux = mergeSym(s1, s2) + v.AuxInt = int32ToAuxInt(o1 + o2) + v.Aux = symToAux(mergeSymTyped(s1, s2)) v.AddArg3(x, ptr, mem) return true } @@ -16582,47 +12928,47 @@ func rewriteValueS390X_OpS390XORload(v *Value) bool { return true } // match: (ORload [off1] {sym} x (ADDconst [off2] ptr) mem) - // cond: ptr.Op != OpSB && is20Bit(off1+off2) + // cond: ptr.Op != OpSB && is20Bit(int64(off1)+int64(off2)) // result: (ORload [off1+off2] {sym} x ptr mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) x := v_0 if v_1.Op != OpS390XADDconst { break } - off2 := v_1.AuxInt + off2 := auxIntToInt32(v_1.AuxInt) ptr := v_1.Args[0] mem := v_2 - if !(ptr.Op != OpSB && is20Bit(off1+off2)) { + if !(ptr.Op != OpSB && is20Bit(int64(off1)+int64(off2))) { break } v.reset(OpS390XORload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(x, ptr, mem) return true } // match: (ORload [o1] {s1} x (MOVDaddr [o2] {s2} ptr) mem) - // cond: ptr.Op != OpSB && is20Bit(o1+o2) && canMergeSym(s1, s2) - // result: (ORload [o1+o2] {mergeSym(s1, s2)} x ptr mem) + // cond: ptr.Op != OpSB && is20Bit(int64(o1)+int64(o2)) && canMergeSym(s1, s2) + // result: (ORload [o1+o2] {mergeSymTyped(s1, s2)} x ptr mem) for { - o1 := v.AuxInt - s1 := v.Aux + o1 := auxIntToInt32(v.AuxInt) + s1 := auxToSym(v.Aux) x := v_0 if v_1.Op != OpS390XMOVDaddr { break } - o2 := v_1.AuxInt - s2 := v_1.Aux + o2 := auxIntToInt32(v_1.AuxInt) + s2 := auxToSym(v_1.Aux) ptr := v_1.Args[0] mem := v_2 - if !(ptr.Op != OpSB && is20Bit(o1+o2) && canMergeSym(s1, s2)) { + if !(ptr.Op != OpSB && is20Bit(int64(o1)+int64(o2)) && canMergeSym(s1, s2)) { break } v.reset(OpS390XORload) - v.AuxInt = o1 + o2 - v.Aux = mergeSym(s1, s2) + v.AuxInt = int32ToAuxInt(o1 + o2) + v.Aux = symToAux(mergeSymTyped(s1, s2)) v.AddArg3(x, ptr, mem) return true } @@ -16632,15 +12978,15 @@ func rewriteValueS390X_OpS390XRLL(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (RLL x (MOVDconst [c])) - // result: (RLLconst x [c&31]) + // result: (RLLconst x [int8(c&31)]) for { x := v_0 if v_1.Op != OpS390XMOVDconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) v.reset(OpS390XRLLconst) - v.AuxInt = c & 31 + v.AuxInt = int8ToAuxInt(int8(c & 31)) v.AddArg(x) return true } @@ -16650,15 +12996,15 @@ func rewriteValueS390X_OpS390XRLLG(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (RLLG x (MOVDconst [c])) - // result: (RLLGconst x [c&63]) + // result: (RLLGconst x [int8(c&63)]) for { x := v_0 if v_1.Op != OpS390XMOVDconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) v.reset(OpS390XRLLGconst) - v.AuxInt = c & 63 + v.AuxInt = int8ToAuxInt(int8(c & 63)) v.AddArg(x) return true } @@ -16670,20 +13016,20 @@ func rewriteValueS390X_OpS390XSLD(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (SLD x (MOVDconst [c])) - // result: (SLDconst x [c&63]) + // result: (SLDconst x [int8(c&63)]) for { x := v_0 if v_1.Op != OpS390XMOVDconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) v.reset(OpS390XSLDconst) - v.AuxInt = c & 63 + v.AuxInt = int8ToAuxInt(int8(c & 63)) v.AddArg(x) return true } // match: (SLD x (AND (MOVDconst [c]) y)) - // result: (SLD x (ANDWconst <typ.UInt32> [c&63] y)) + // result: (SLD x (ANDWconst <typ.UInt32> [int32(c&63)] y)) for { x := v_0 if v_1.Op != OpS390XAND { @@ -16696,11 +13042,11 @@ func rewriteValueS390X_OpS390XSLD(v *Value) bool { if v_1_0.Op != OpS390XMOVDconst { continue } - c := v_1_0.AuxInt + c := auxIntToInt64(v_1_0.AuxInt) y := v_1_1 v.reset(OpS390XSLD) v0 := b.NewValue0(v.Pos, OpS390XANDWconst, typ.UInt32) - v0.AuxInt = c & 63 + v0.AuxInt = int32ToAuxInt(int32(c & 63)) v0.AddArg(y) v.AddArg2(x, v0) return true @@ -16818,20 +13164,20 @@ func rewriteValueS390X_OpS390XSLW(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (SLW x (MOVDconst [c])) - // result: (SLWconst x [c&63]) + // result: (SLWconst x [int8(c&63)]) for { x := v_0 if v_1.Op != OpS390XMOVDconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) v.reset(OpS390XSLWconst) - v.AuxInt = c & 63 + v.AuxInt = int8ToAuxInt(int8(c & 63)) v.AddArg(x) return true } // match: (SLW x (AND (MOVDconst [c]) y)) - // result: (SLW x (ANDWconst <typ.UInt32> [c&63] y)) + // result: (SLW x (ANDWconst <typ.UInt32> [int32(c&63)] y)) for { x := v_0 if v_1.Op != OpS390XAND { @@ -16844,11 +13190,11 @@ func rewriteValueS390X_OpS390XSLW(v *Value) bool { if v_1_0.Op != OpS390XMOVDconst { continue } - c := v_1_0.AuxInt + c := auxIntToInt64(v_1_0.AuxInt) y := v_1_1 v.reset(OpS390XSLW) v0 := b.NewValue0(v.Pos, OpS390XANDWconst, typ.UInt32) - v0.AuxInt = c & 63 + v0.AuxInt = int32ToAuxInt(int32(c & 63)) v0.AddArg(y) v.AddArg2(x, v0) return true @@ -16966,20 +13312,20 @@ func rewriteValueS390X_OpS390XSRAD(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (SRAD x (MOVDconst [c])) - // result: (SRADconst x [c&63]) + // result: (SRADconst x [int8(c&63)]) for { x := v_0 if v_1.Op != OpS390XMOVDconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) v.reset(OpS390XSRADconst) - v.AuxInt = c & 63 + v.AuxInt = int8ToAuxInt(int8(c & 63)) v.AddArg(x) return true } // match: (SRAD x (AND (MOVDconst [c]) y)) - // result: (SRAD x (ANDWconst <typ.UInt32> [c&63] y)) + // result: (SRAD x (ANDWconst <typ.UInt32> [int32(c&63)] y)) for { x := v_0 if v_1.Op != OpS390XAND { @@ -16992,11 +13338,11 @@ func rewriteValueS390X_OpS390XSRAD(v *Value) bool { if v_1_0.Op != OpS390XMOVDconst { continue } - c := v_1_0.AuxInt + c := auxIntToInt64(v_1_0.AuxInt) y := v_1_1 v.reset(OpS390XSRAD) v0 := b.NewValue0(v.Pos, OpS390XANDWconst, typ.UInt32) - v0.AuxInt = c & 63 + v0.AuxInt = int32ToAuxInt(int32(c & 63)) v0.AddArg(y) v.AddArg2(x, v0) return true @@ -17126,20 +13472,20 @@ func rewriteValueS390X_OpS390XSRAW(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (SRAW x (MOVDconst [c])) - // result: (SRAWconst x [c&63]) + // result: (SRAWconst x [int8(c&63)]) for { x := v_0 if v_1.Op != OpS390XMOVDconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) v.reset(OpS390XSRAWconst) - v.AuxInt = c & 63 + v.AuxInt = int8ToAuxInt(int8(c & 63)) v.AddArg(x) return true } // match: (SRAW x (AND (MOVDconst [c]) y)) - // result: (SRAW x (ANDWconst <typ.UInt32> [c&63] y)) + // result: (SRAW x (ANDWconst <typ.UInt32> [int32(c&63)] y)) for { x := v_0 if v_1.Op != OpS390XAND { @@ -17152,11 +13498,11 @@ func rewriteValueS390X_OpS390XSRAW(v *Value) bool { if v_1_0.Op != OpS390XMOVDconst { continue } - c := v_1_0.AuxInt + c := auxIntToInt64(v_1_0.AuxInt) y := v_1_1 v.reset(OpS390XSRAW) v0 := b.NewValue0(v.Pos, OpS390XANDWconst, typ.UInt32) - v0.AuxInt = c & 63 + v0.AuxInt = int32ToAuxInt(int32(c & 63)) v0.AddArg(y) v.AddArg2(x, v0) return true @@ -17286,20 +13632,20 @@ func rewriteValueS390X_OpS390XSRD(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (SRD x (MOVDconst [c])) - // result: (SRDconst x [c&63]) + // result: (SRDconst x [int8(c&63)]) for { x := v_0 if v_1.Op != OpS390XMOVDconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) v.reset(OpS390XSRDconst) - v.AuxInt = c & 63 + v.AuxInt = int8ToAuxInt(int8(c & 63)) v.AddArg(x) return true } // match: (SRD x (AND (MOVDconst [c]) y)) - // result: (SRD x (ANDWconst <typ.UInt32> [c&63] y)) + // result: (SRD x (ANDWconst <typ.UInt32> [int32(c&63)] y)) for { x := v_0 if v_1.Op != OpS390XAND { @@ -17312,11 +13658,11 @@ func rewriteValueS390X_OpS390XSRD(v *Value) bool { if v_1_0.Op != OpS390XMOVDconst { continue } - c := v_1_0.AuxInt + c := auxIntToInt64(v_1_0.AuxInt) y := v_1_1 v.reset(OpS390XSRD) v0 := b.NewValue0(v.Pos, OpS390XANDWconst, typ.UInt32) - v0.AuxInt = c & 63 + v0.AuxInt = int32ToAuxInt(int32(c & 63)) v0.AddArg(y) v.AddArg2(x, v0) return true @@ -17454,20 +13800,20 @@ func rewriteValueS390X_OpS390XSRW(v *Value) bool { b := v.Block typ := &b.Func.Config.Types // match: (SRW x (MOVDconst [c])) - // result: (SRWconst x [c&63]) + // result: (SRWconst x [int8(c&63)]) for { x := v_0 if v_1.Op != OpS390XMOVDconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) v.reset(OpS390XSRWconst) - v.AuxInt = c & 63 + v.AuxInt = int8ToAuxInt(int8(c & 63)) v.AddArg(x) return true } // match: (SRW x (AND (MOVDconst [c]) y)) - // result: (SRW x (ANDWconst <typ.UInt32> [c&63] y)) + // result: (SRW x (ANDWconst <typ.UInt32> [int32(c&63)] y)) for { x := v_0 if v_1.Op != OpS390XAND { @@ -17480,11 +13826,11 @@ func rewriteValueS390X_OpS390XSRW(v *Value) bool { if v_1_0.Op != OpS390XMOVDconst { continue } - c := v_1_0.AuxInt + c := auxIntToInt64(v_1_0.AuxInt) y := v_1_1 v.reset(OpS390XSRW) v0 := b.NewValue0(v.Pos, OpS390XANDWconst, typ.UInt32) - v0.AuxInt = c & 63 + v0.AuxInt = int32ToAuxInt(int32(c & 63)) v0.AddArg(y) v.AddArg2(x, v0) return true @@ -17602,16 +13948,16 @@ func rewriteValueS390X_OpS390XSTM2(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (STM2 [i] {s} p w2 w3 x:(STM2 [i-8] {s} p w0 w1 mem)) - // cond: x.Uses == 1 && is20Bit(i-8) && clobber(x) + // cond: x.Uses == 1 && is20Bit(int64(i)-8) && clobber(x) // result: (STM4 [i-8] {s} p w0 w1 w2 w3 mem) for { - i := v.AuxInt - s := v.Aux + i := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) p := v_0 w2 := v_1 w3 := v_2 x := v_3 - if x.Op != OpS390XSTM2 || x.AuxInt != i-8 || x.Aux != s { + if x.Op != OpS390XSTM2 || auxIntToInt32(x.AuxInt) != i-8 || auxToSym(x.Aux) != s { break } mem := x.Args[3] @@ -17620,22 +13966,22 @@ func rewriteValueS390X_OpS390XSTM2(v *Value) bool { } w0 := x.Args[1] w1 := x.Args[2] - if !(x.Uses == 1 && is20Bit(i-8) && clobber(x)) { + if !(x.Uses == 1 && is20Bit(int64(i)-8) && clobber(x)) { break } v.reset(OpS390XSTM4) - v.AuxInt = i - 8 - v.Aux = s + v.AuxInt = int32ToAuxInt(i - 8) + v.Aux = symToAux(s) v.AddArg6(p, w0, w1, w2, w3, mem) return true } // match: (STM2 [i] {s} p (SRDconst [32] x) x mem) // result: (MOVDstore [i] {s} p x mem) for { - i := v.AuxInt - s := v.Aux + i := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) p := v_0 - if v_1.Op != OpS390XSRDconst || v_1.AuxInt != 32 { + if v_1.Op != OpS390XSRDconst || auxIntToInt8(v_1.AuxInt) != 32 { break } x := v_1.Args[0] @@ -17644,8 +13990,8 @@ func rewriteValueS390X_OpS390XSTM2(v *Value) bool { } mem := v_3 v.reset(OpS390XMOVDstore) - v.AuxInt = i - v.Aux = s + v.AuxInt = int32ToAuxInt(i) + v.Aux = symToAux(s) v.AddArg3(p, x, mem) return true } @@ -17657,16 +14003,16 @@ func rewriteValueS390X_OpS390XSTMG2(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (STMG2 [i] {s} p w2 w3 x:(STMG2 [i-16] {s} p w0 w1 mem)) - // cond: x.Uses == 1 && is20Bit(i-16) && clobber(x) + // cond: x.Uses == 1 && is20Bit(int64(i)-16) && clobber(x) // result: (STMG4 [i-16] {s} p w0 w1 w2 w3 mem) for { - i := v.AuxInt - s := v.Aux + i := auxIntToInt32(v.AuxInt) + s := auxToSym(v.Aux) p := v_0 w2 := v_1 w3 := v_2 x := v_3 - if x.Op != OpS390XSTMG2 || x.AuxInt != i-16 || x.Aux != s { + if x.Op != OpS390XSTMG2 || auxIntToInt32(x.AuxInt) != i-16 || auxToSym(x.Aux) != s { break } mem := x.Args[3] @@ -17675,12 +14021,12 @@ func rewriteValueS390X_OpS390XSTMG2(v *Value) bool { } w0 := x.Args[1] w1 := x.Args[2] - if !(x.Uses == 1 && is20Bit(i-16) && clobber(x)) { + if !(x.Uses == 1 && is20Bit(int64(i)-16) && clobber(x)) { break } v.reset(OpS390XSTMG4) - v.AuxInt = i - 16 - v.Aux = s + v.AuxInt = int32ToAuxInt(i - 16) + v.Aux = symToAux(s) v.AddArg6(p, w0, w1, w2, w3, mem) return true } @@ -17692,36 +14038,36 @@ func rewriteValueS390X_OpS390XSUB(v *Value) bool { b := v.Block // match: (SUB x (MOVDconst [c])) // cond: is32Bit(c) - // result: (SUBconst x [c]) + // result: (SUBconst x [int32(c)]) for { x := v_0 if v_1.Op != OpS390XMOVDconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) if !(is32Bit(c)) { break } v.reset(OpS390XSUBconst) - v.AuxInt = c + v.AuxInt = int32ToAuxInt(int32(c)) v.AddArg(x) return true } // match: (SUB (MOVDconst [c]) x) // cond: is32Bit(c) - // result: (NEG (SUBconst <v.Type> x [c])) + // result: (NEG (SUBconst <v.Type> x [int32(c)])) for { if v_0.Op != OpS390XMOVDconst { break } - c := v_0.AuxInt + c := auxIntToInt64(v_0.AuxInt) x := v_1 if !(is32Bit(c)) { break } v.reset(OpS390XNEG) v0 := b.NewValue0(v.Pos, OpS390XSUBconst, v.Type) - v0.AuxInt = c + v0.AuxInt = int32ToAuxInt(int32(c)) v0.AddArg(x) v.AddArg(v0) return true @@ -17738,7 +14084,7 @@ func rewriteValueS390X_OpS390XSUB(v *Value) bool { return true } // match: (SUB <t> x g:(MOVDload [off] {sym} ptr mem)) - // cond: ptr.Op != OpSB && is20Bit(off) && canMergeLoadClobber(v, g, x) && clobber(g) + // cond: ptr.Op != OpSB && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g) // result: (SUBload <t> [off] {sym} x ptr mem) for { t := v.Type @@ -17747,17 +14093,17 @@ func rewriteValueS390X_OpS390XSUB(v *Value) bool { if g.Op != OpS390XMOVDload { break } - off := g.AuxInt - sym := g.Aux + off := auxIntToInt32(g.AuxInt) + sym := auxToSym(g.Aux) mem := g.Args[1] ptr := g.Args[0] - if !(ptr.Op != OpSB && is20Bit(off) && canMergeLoadClobber(v, g, x) && clobber(g)) { + if !(ptr.Op != OpSB && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g)) { break } v.reset(OpS390XSUBload) v.Type = t - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(x, ptr, mem) return true } @@ -17840,29 +14186,29 @@ func rewriteValueS390X_OpS390XSUBW(v *Value) bool { v_0 := v.Args[0] b := v.Block // match: (SUBW x (MOVDconst [c])) - // result: (SUBWconst x [int64(int32(c))]) + // result: (SUBWconst x [int32(c)]) for { x := v_0 if v_1.Op != OpS390XMOVDconst { break } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) v.reset(OpS390XSUBWconst) - v.AuxInt = int64(int32(c)) + v.AuxInt = int32ToAuxInt(int32(c)) v.AddArg(x) return true } // match: (SUBW (MOVDconst [c]) x) - // result: (NEGW (SUBWconst <v.Type> x [int64(int32(c))])) + // result: (NEGW (SUBWconst <v.Type> x [int32(c)])) for { if v_0.Op != OpS390XMOVDconst { break } - c := v_0.AuxInt + c := auxIntToInt64(v_0.AuxInt) x := v_1 v.reset(OpS390XNEGW) v0 := b.NewValue0(v.Pos, OpS390XSUBWconst, v.Type) - v0.AuxInt = int64(int32(c)) + v0.AuxInt = int32ToAuxInt(int32(c)) v0.AddArg(x) v.AddArg(v0) return true @@ -17879,7 +14225,7 @@ func rewriteValueS390X_OpS390XSUBW(v *Value) bool { return true } // match: (SUBW <t> x g:(MOVWload [off] {sym} ptr mem)) - // cond: ptr.Op != OpSB && is20Bit(off) && canMergeLoadClobber(v, g, x) && clobber(g) + // cond: ptr.Op != OpSB && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g) // result: (SUBWload <t> [off] {sym} x ptr mem) for { t := v.Type @@ -17888,22 +14234,22 @@ func rewriteValueS390X_OpS390XSUBW(v *Value) bool { if g.Op != OpS390XMOVWload { break } - off := g.AuxInt - sym := g.Aux + off := auxIntToInt32(g.AuxInt) + sym := auxToSym(g.Aux) mem := g.Args[1] ptr := g.Args[0] - if !(ptr.Op != OpSB && is20Bit(off) && canMergeLoadClobber(v, g, x) && clobber(g)) { + if !(ptr.Op != OpSB && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g)) { break } v.reset(OpS390XSUBWload) v.Type = t - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(x, ptr, mem) return true } // match: (SUBW <t> x g:(MOVWZload [off] {sym} ptr mem)) - // cond: ptr.Op != OpSB && is20Bit(off) && canMergeLoadClobber(v, g, x) && clobber(g) + // cond: ptr.Op != OpSB && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g) // result: (SUBWload <t> [off] {sym} x ptr mem) for { t := v.Type @@ -17912,17 +14258,17 @@ func rewriteValueS390X_OpS390XSUBW(v *Value) bool { if g.Op != OpS390XMOVWZload { break } - off := g.AuxInt - sym := g.Aux + off := auxIntToInt32(g.AuxInt) + sym := auxToSym(g.Aux) mem := g.Args[1] ptr := g.Args[0] - if !(ptr.Op != OpSB && is20Bit(off) && canMergeLoadClobber(v, g, x) && clobber(g)) { + if !(ptr.Op != OpSB && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g)) { break } v.reset(OpS390XSUBWload) v.Type = t - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(x, ptr, mem) return true } @@ -17943,12 +14289,12 @@ func rewriteValueS390X_OpS390XSUBWconst(v *Value) bool { return true } // match: (SUBWconst [c] x) - // result: (ADDWconst [int64(int32(-c))] x) + // result: (ADDWconst [-int32(c)] x) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) x := v_0 v.reset(OpS390XADDWconst) - v.AuxInt = int64(int32(-c)) + v.AuxInt = int32ToAuxInt(-int32(c)) v.AddArg(x) return true } @@ -17958,47 +14304,47 @@ func rewriteValueS390X_OpS390XSUBWload(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (SUBWload [off1] {sym} x (ADDconst [off2] ptr) mem) - // cond: ptr.Op != OpSB && is20Bit(off1+off2) + // cond: ptr.Op != OpSB && is20Bit(int64(off1)+int64(off2)) // result: (SUBWload [off1+off2] {sym} x ptr mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) x := v_0 if v_1.Op != OpS390XADDconst { break } - off2 := v_1.AuxInt + off2 := auxIntToInt32(v_1.AuxInt) ptr := v_1.Args[0] mem := v_2 - if !(ptr.Op != OpSB && is20Bit(off1+off2)) { + if !(ptr.Op != OpSB && is20Bit(int64(off1)+int64(off2))) { break } v.reset(OpS390XSUBWload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(x, ptr, mem) return true } // match: (SUBWload [o1] {s1} x (MOVDaddr [o2] {s2} ptr) mem) - // cond: ptr.Op != OpSB && is20Bit(o1+o2) && canMergeSym(s1, s2) - // result: (SUBWload [o1+o2] {mergeSym(s1, s2)} x ptr mem) + // cond: ptr.Op != OpSB && is20Bit(int64(o1)+int64(o2)) && canMergeSym(s1, s2) + // result: (SUBWload [o1+o2] {mergeSymTyped(s1, s2)} x ptr mem) for { - o1 := v.AuxInt - s1 := v.Aux + o1 := auxIntToInt32(v.AuxInt) + s1 := auxToSym(v.Aux) x := v_0 if v_1.Op != OpS390XMOVDaddr { break } - o2 := v_1.AuxInt - s2 := v_1.Aux + o2 := auxIntToInt32(v_1.AuxInt) + s2 := auxToSym(v_1.Aux) ptr := v_1.Args[0] mem := v_2 - if !(ptr.Op != OpSB && is20Bit(o1+o2) && canMergeSym(s1, s2)) { + if !(ptr.Op != OpSB && is20Bit(int64(o1)+int64(o2)) && canMergeSym(s1, s2)) { break } v.reset(OpS390XSUBWload) - v.AuxInt = o1 + o2 - v.Aux = mergeSym(s1, s2) + v.AuxInt = int32ToAuxInt(o1 + o2) + v.Aux = symToAux(mergeSymTyped(s1, s2)) v.AddArg3(x, ptr, mem) return true } @@ -18031,32 +14377,32 @@ func rewriteValueS390X_OpS390XSUBconst(v *Value) bool { return true } // match: (SUBconst (MOVDconst [d]) [c]) - // result: (MOVDconst [d-c]) + // result: (MOVDconst [d-int64(c)]) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) if v_0.Op != OpS390XMOVDconst { break } - d := v_0.AuxInt + d := auxIntToInt64(v_0.AuxInt) v.reset(OpS390XMOVDconst) - v.AuxInt = d - c + v.AuxInt = int64ToAuxInt(d - int64(c)) return true } // match: (SUBconst (SUBconst x [d]) [c]) - // cond: is32Bit(-c-d) + // cond: is32Bit(-int64(c)-int64(d)) // result: (ADDconst [-c-d] x) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) if v_0.Op != OpS390XSUBconst { break } - d := v_0.AuxInt + d := auxIntToInt32(v_0.AuxInt) x := v_0.Args[0] - if !(is32Bit(-c - d)) { + if !(is32Bit(-int64(c) - int64(d))) { break } v.reset(OpS390XADDconst) - v.AuxInt = -c - d + v.AuxInt = int32ToAuxInt(-c - d) v.AddArg(x) return true } @@ -18091,47 +14437,47 @@ func rewriteValueS390X_OpS390XSUBload(v *Value) bool { return true } // match: (SUBload [off1] {sym} x (ADDconst [off2] ptr) mem) - // cond: ptr.Op != OpSB && is20Bit(off1+off2) + // cond: ptr.Op != OpSB && is20Bit(int64(off1)+int64(off2)) // result: (SUBload [off1+off2] {sym} x ptr mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) x := v_0 if v_1.Op != OpS390XADDconst { break } - off2 := v_1.AuxInt + off2 := auxIntToInt32(v_1.AuxInt) ptr := v_1.Args[0] mem := v_2 - if !(ptr.Op != OpSB && is20Bit(off1+off2)) { + if !(ptr.Op != OpSB && is20Bit(int64(off1)+int64(off2))) { break } v.reset(OpS390XSUBload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(x, ptr, mem) return true } // match: (SUBload [o1] {s1} x (MOVDaddr [o2] {s2} ptr) mem) - // cond: ptr.Op != OpSB && is20Bit(o1+o2) && canMergeSym(s1, s2) - // result: (SUBload [o1+o2] {mergeSym(s1, s2)} x ptr mem) + // cond: ptr.Op != OpSB && is20Bit(int64(o1)+int64(o2)) && canMergeSym(s1, s2) + // result: (SUBload [o1+o2] {mergeSymTyped(s1, s2)} x ptr mem) for { - o1 := v.AuxInt - s1 := v.Aux + o1 := auxIntToInt32(v.AuxInt) + s1 := auxToSym(v.Aux) x := v_0 if v_1.Op != OpS390XMOVDaddr { break } - o2 := v_1.AuxInt - s2 := v_1.Aux + o2 := auxIntToInt32(v_1.AuxInt) + s2 := auxToSym(v_1.Aux) ptr := v_1.Args[0] mem := v_2 - if !(ptr.Op != OpSB && is20Bit(o1+o2) && canMergeSym(s1, s2)) { + if !(ptr.Op != OpSB && is20Bit(int64(o1)+int64(o2)) && canMergeSym(s1, s2)) { break } v.reset(OpS390XSUBload) - v.AuxInt = o1 + o2 - v.Aux = mergeSym(s1, s2) + v.AuxInt = int32ToAuxInt(o1 + o2) + v.Aux = symToAux(mergeSymTyped(s1, s2)) v.AddArg3(x, ptr, mem) return true } @@ -18266,7 +14612,7 @@ func rewriteValueS390X_OpS390XXOR(v *Value) bool { return true } // match: (XOR <t> x g:(MOVDload [off] {sym} ptr mem)) - // cond: ptr.Op != OpSB && is20Bit(off) && canMergeLoadClobber(v, g, x) && clobber(g) + // cond: ptr.Op != OpSB && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g) // result: (XORload <t> [off] {sym} x ptr mem) for { t := v.Type @@ -18276,17 +14622,17 @@ func rewriteValueS390X_OpS390XXOR(v *Value) bool { if g.Op != OpS390XMOVDload { continue } - off := g.AuxInt - sym := g.Aux + off := auxIntToInt32(g.AuxInt) + sym := auxToSym(g.Aux) mem := g.Args[1] ptr := g.Args[0] - if !(ptr.Op != OpSB && is20Bit(off) && canMergeLoadClobber(v, g, x) && clobber(g)) { + if !(ptr.Op != OpSB && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g)) { continue } v.reset(OpS390XXORload) v.Type = t - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(x, ptr, mem) return true } @@ -18298,16 +14644,16 @@ func rewriteValueS390X_OpS390XXORW(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (XORW x (MOVDconst [c])) - // result: (XORWconst [int64(int32(c))] x) + // result: (XORWconst [int32(c)] x) for { for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { x := v_0 if v_1.Op != OpS390XMOVDconst { continue } - c := v_1.AuxInt + c := auxIntToInt64(v_1.AuxInt) v.reset(OpS390XXORWconst) - v.AuxInt = int64(int32(c)) + v.AuxInt = int32ToAuxInt(int32(c)) v.AddArg(x) return true } @@ -18349,7 +14695,7 @@ func rewriteValueS390X_OpS390XXORW(v *Value) bool { return true } // match: (XORW <t> x g:(MOVWload [off] {sym} ptr mem)) - // cond: ptr.Op != OpSB && is20Bit(off) && canMergeLoadClobber(v, g, x) && clobber(g) + // cond: ptr.Op != OpSB && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g) // result: (XORWload <t> [off] {sym} x ptr mem) for { t := v.Type @@ -18359,24 +14705,24 @@ func rewriteValueS390X_OpS390XXORW(v *Value) bool { if g.Op != OpS390XMOVWload { continue } - off := g.AuxInt - sym := g.Aux + off := auxIntToInt32(g.AuxInt) + sym := auxToSym(g.Aux) mem := g.Args[1] ptr := g.Args[0] - if !(ptr.Op != OpSB && is20Bit(off) && canMergeLoadClobber(v, g, x) && clobber(g)) { + if !(ptr.Op != OpSB && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g)) { continue } v.reset(OpS390XXORWload) v.Type = t - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(x, ptr, mem) return true } break } // match: (XORW <t> x g:(MOVWZload [off] {sym} ptr mem)) - // cond: ptr.Op != OpSB && is20Bit(off) && canMergeLoadClobber(v, g, x) && clobber(g) + // cond: ptr.Op != OpSB && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g) // result: (XORWload <t> [off] {sym} x ptr mem) for { t := v.Type @@ -18386,17 +14732,17 @@ func rewriteValueS390X_OpS390XXORW(v *Value) bool { if g.Op != OpS390XMOVWZload { continue } - off := g.AuxInt - sym := g.Aux + off := auxIntToInt32(g.AuxInt) + sym := auxToSym(g.Aux) mem := g.Args[1] ptr := g.Args[0] - if !(ptr.Op != OpSB && is20Bit(off) && canMergeLoadClobber(v, g, x) && clobber(g)) { + if !(ptr.Op != OpSB && is20Bit(int64(off)) && canMergeLoadClobber(v, g, x) && clobber(g)) { continue } v.reset(OpS390XXORWload) v.Type = t - v.AuxInt = off - v.Aux = sym + v.AuxInt = int32ToAuxInt(off) + v.Aux = symToAux(sym) v.AddArg3(x, ptr, mem) return true } @@ -18419,15 +14765,15 @@ func rewriteValueS390X_OpS390XXORWconst(v *Value) bool { return true } // match: (XORWconst [c] (MOVDconst [d])) - // result: (MOVDconst [c^d]) + // result: (MOVDconst [int64(c)^d]) for { - c := v.AuxInt + c := auxIntToInt32(v.AuxInt) if v_0.Op != OpS390XMOVDconst { break } - d := v_0.AuxInt + d := auxIntToInt64(v_0.AuxInt) v.reset(OpS390XMOVDconst) - v.AuxInt = c ^ d + v.AuxInt = int64ToAuxInt(int64(c) ^ d) return true } return false @@ -18437,47 +14783,47 @@ func rewriteValueS390X_OpS390XXORWload(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] // match: (XORWload [off1] {sym} x (ADDconst [off2] ptr) mem) - // cond: ptr.Op != OpSB && is20Bit(off1+off2) + // cond: ptr.Op != OpSB && is20Bit(int64(off1)+int64(off2)) // result: (XORWload [off1+off2] {sym} x ptr mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) x := v_0 if v_1.Op != OpS390XADDconst { break } - off2 := v_1.AuxInt + off2 := auxIntToInt32(v_1.AuxInt) ptr := v_1.Args[0] mem := v_2 - if !(ptr.Op != OpSB && is20Bit(off1+off2)) { + if !(ptr.Op != OpSB && is20Bit(int64(off1)+int64(off2))) { break } v.reset(OpS390XXORWload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(x, ptr, mem) return true } // match: (XORWload [o1] {s1} x (MOVDaddr [o2] {s2} ptr) mem) - // cond: ptr.Op != OpSB && is20Bit(o1+o2) && canMergeSym(s1, s2) - // result: (XORWload [o1+o2] {mergeSym(s1, s2)} x ptr mem) + // cond: ptr.Op != OpSB && is20Bit(int64(o1)+int64(o2)) && canMergeSym(s1, s2) + // result: (XORWload [o1+o2] {mergeSymTyped(s1, s2)} x ptr mem) for { - o1 := v.AuxInt - s1 := v.Aux + o1 := auxIntToInt32(v.AuxInt) + s1 := auxToSym(v.Aux) x := v_0 if v_1.Op != OpS390XMOVDaddr { break } - o2 := v_1.AuxInt - s2 := v_1.Aux + o2 := auxIntToInt32(v_1.AuxInt) + s2 := auxToSym(v_1.Aux) ptr := v_1.Args[0] mem := v_2 - if !(ptr.Op != OpSB && is20Bit(o1+o2) && canMergeSym(s1, s2)) { + if !(ptr.Op != OpSB && is20Bit(int64(o1)+int64(o2)) && canMergeSym(s1, s2)) { break } v.reset(OpS390XXORWload) - v.AuxInt = o1 + o2 - v.Aux = mergeSym(s1, s2) + v.AuxInt = int32ToAuxInt(o1 + o2) + v.Aux = symToAux(mergeSymTyped(s1, s2)) v.AddArg3(x, ptr, mem) return true } @@ -18538,47 +14884,47 @@ func rewriteValueS390X_OpS390XXORload(v *Value) bool { return true } // match: (XORload [off1] {sym} x (ADDconst [off2] ptr) mem) - // cond: ptr.Op != OpSB && is20Bit(off1+off2) + // cond: ptr.Op != OpSB && is20Bit(int64(off1)+int64(off2)) // result: (XORload [off1+off2] {sym} x ptr mem) for { - off1 := v.AuxInt - sym := v.Aux + off1 := auxIntToInt32(v.AuxInt) + sym := auxToSym(v.Aux) x := v_0 if v_1.Op != OpS390XADDconst { break } - off2 := v_1.AuxInt + off2 := auxIntToInt32(v_1.AuxInt) ptr := v_1.Args[0] mem := v_2 - if !(ptr.Op != OpSB && is20Bit(off1+off2)) { + if !(ptr.Op != OpSB && is20Bit(int64(off1)+int64(off2))) { break } v.reset(OpS390XXORload) - v.AuxInt = off1 + off2 - v.Aux = sym + v.AuxInt = int32ToAuxInt(off1 + off2) + v.Aux = symToAux(sym) v.AddArg3(x, ptr, mem) return true } // match: (XORload [o1] {s1} x (MOVDaddr [o2] {s2} ptr) mem) - // cond: ptr.Op != OpSB && is20Bit(o1+o2) && canMergeSym(s1, s2) - // result: (XORload [o1+o2] {mergeSym(s1, s2)} x ptr mem) + // cond: ptr.Op != OpSB && is20Bit(int64(o1)+int64(o2)) && canMergeSym(s1, s2) + // result: (XORload [o1+o2] {mergeSymTyped(s1, s2)} x ptr mem) for { - o1 := v.AuxInt - s1 := v.Aux + o1 := auxIntToInt32(v.AuxInt) + s1 := auxToSym(v.Aux) x := v_0 if v_1.Op != OpS390XMOVDaddr { break } - o2 := v_1.AuxInt - s2 := v_1.Aux + o2 := auxIntToInt32(v_1.AuxInt) + s2 := auxToSym(v_1.Aux) ptr := v_1.Args[0] mem := v_2 - if !(ptr.Op != OpSB && is20Bit(o1+o2) && canMergeSym(s1, s2)) { + if !(ptr.Op != OpSB && is20Bit(int64(o1)+int64(o2)) && canMergeSym(s1, s2)) { break } v.reset(OpS390XXORload) - v.AuxInt = o1 + o2 - v.Aux = mergeSym(s1, s2) + v.AuxInt = int32ToAuxInt(o1 + o2) + v.Aux = symToAux(mergeSymTyped(s1, s2)) v.AddArg3(x, ptr, mem) return true } @@ -18662,19 +15008,19 @@ func rewriteValueS390X_OpSelect0(v *Value) bool { return true } // match: (Select0 (ADDCconst (MOVDconst [c]) [d])) - // result: (MOVDconst [c+d]) + // result: (MOVDconst [c+int64(d)]) for { if v_0.Op != OpS390XADDCconst { break } - d := v_0.AuxInt + d := auxIntToInt16(v_0.AuxInt) v_0_0 := v_0.Args[0] if v_0_0.Op != OpS390XMOVDconst { break } - c := v_0_0.AuxInt + c := auxIntToInt64(v_0_0.AuxInt) v.reset(OpS390XMOVDconst) - v.AuxInt = c + d + v.AuxInt = int64ToAuxInt(c + int64(d)) return true } // match: (Select0 (SUBC (MOVDconst [c]) (MOVDconst [d]))) @@ -18859,38 +15205,38 @@ func rewriteValueS390X_OpSelect1(v *Value) bool { return true } // match: (Select1 (ADDCconst (MOVDconst [c]) [d])) - // cond: uint64(c+d) >= uint64(c) && c+d == 0 + // cond: uint64(c+int64(d)) >= uint64(c) && c+int64(d) == 0 // result: (FlagEQ) for { if v_0.Op != OpS390XADDCconst { break } - d := v_0.AuxInt + d := auxIntToInt16(v_0.AuxInt) v_0_0 := v_0.Args[0] if v_0_0.Op != OpS390XMOVDconst { break } - c := v_0_0.AuxInt - if !(uint64(c+d) >= uint64(c) && c+d == 0) { + c := auxIntToInt64(v_0_0.AuxInt) + if !(uint64(c+int64(d)) >= uint64(c) && c+int64(d) == 0) { break } v.reset(OpS390XFlagEQ) return true } // match: (Select1 (ADDCconst (MOVDconst [c]) [d])) - // cond: uint64(c+d) >= uint64(c) && c+d != 0 + // cond: uint64(c+int64(d)) >= uint64(c) && c+int64(d) != 0 // result: (FlagLT) for { if v_0.Op != OpS390XADDCconst { break } - d := v_0.AuxInt + d := auxIntToInt16(v_0.AuxInt) v_0_0 := v_0.Args[0] if v_0_0.Op != OpS390XMOVDconst { break } - c := v_0_0.AuxInt - if !(uint64(c+d) >= uint64(c) && c+d != 0) { + c := auxIntToInt64(v_0_0.AuxInt) + if !(uint64(c+int64(d)) >= uint64(c) && c+int64(d) != 0) { break } v.reset(OpS390XFlagLT) diff --git a/src/cmd/compile/internal/ssa/rewritedec.go b/src/cmd/compile/internal/ssa/rewritedec.go index cef781ffaa..e0fa9768d9 100644 --- a/src/cmd/compile/internal/ssa/rewritedec.go +++ b/src/cmd/compile/internal/ssa/rewritedec.go @@ -328,9 +328,10 @@ func rewriteValuedec_OpStore(v *Value) bool { v.AddArg3(v0, len, v1) return true } - // match: (Store dst (SliceMake ptr len cap) mem) - // result: (Store {typ.Int} (OffPtr <typ.IntPtr> [2*config.PtrSize] dst) cap (Store {typ.Int} (OffPtr <typ.IntPtr> [config.PtrSize] dst) len (Store {typ.BytePtr} dst ptr mem))) + // match: (Store {t} dst (SliceMake ptr len cap) mem) + // result: (Store {typ.Int} (OffPtr <typ.IntPtr> [2*config.PtrSize] dst) cap (Store {typ.Int} (OffPtr <typ.IntPtr> [config.PtrSize] dst) len (Store {t.Elem().PtrTo()} dst ptr mem))) for { + t := auxToType(v.Aux) dst := v_0 if v_1.Op != OpSliceMake { break @@ -350,7 +351,7 @@ func rewriteValuedec_OpStore(v *Value) bool { v2.AuxInt = int64ToAuxInt(config.PtrSize) v2.AddArg(dst) v3 := b.NewValue0(v.Pos, OpStore, types.TypeMem) - v3.Aux = typeToAux(typ.BytePtr) + v3.Aux = typeToAux(t.Elem().PtrTo()) v3.AddArg3(dst, ptr, mem) v1.AddArg3(v2, len, v3) v.AddArg3(v0, cap, v1) diff --git a/src/cmd/compile/internal/ssa/softfloat.go b/src/cmd/compile/internal/ssa/softfloat.go index 4b578b133b..a8a8f83629 100644 --- a/src/cmd/compile/internal/ssa/softfloat.go +++ b/src/cmd/compile/internal/ssa/softfloat.go @@ -18,6 +18,7 @@ func softfloat(f *Func) { for _, b := range f.Blocks { for _, v := range b.Values { if v.Type.IsFloat() { + f.unCache(v) switch v.Op { case OpPhi, OpLoad, OpArg: if v.Type.Size() == 4 { @@ -72,7 +73,7 @@ func softfloat(f *Func) { if newInt64 && f.Config.RegSize == 4 { // On 32bit arch, decompose Uint64 introduced in the switch above. decomposeBuiltIn(f) - applyRewrite(f, rewriteBlockdec64, rewriteValuedec64) + applyRewrite(f, rewriteBlockdec64, rewriteValuedec64, removeDeadValues) } } diff --git a/src/cmd/compile/internal/ssa/value.go b/src/cmd/compile/internal/ssa/value.go index 7ead0ff300..6692df7921 100644 --- a/src/cmd/compile/internal/ssa/value.go +++ b/src/cmd/compile/internal/ssa/value.go @@ -54,6 +54,9 @@ type Value struct { // nor a slot on Go stack, and the generation of this value is delayed to its use time. OnWasmStack bool + // Is this value in the per-function constant cache? If so, remove from cache before changing it or recycling it. + InCache bool + // Storage for the first three args argstorage [3]*Value } @@ -210,7 +213,7 @@ func (v *Value) auxString() string { } return s + fmt.Sprintf(" [%s]", v.AuxValAndOff()) case auxCCop: - return fmt.Sprintf(" {%s}", v.Aux.(Op)) + return fmt.Sprintf(" {%s}", Op(v.AuxInt)) case auxS390XCCMask, auxS390XRotateParams: return fmt.Sprintf(" {%v}", v.Aux) case auxFlagConstant: @@ -332,6 +335,9 @@ func (v *Value) resetArgs() { // of cmd/compile by almost 10%, and slows it down. //go:noinline func (v *Value) reset(op Op) { + if v.InCache { + v.Block.Func.unCache(v) + } v.Op = op v.resetArgs() v.AuxInt = 0 @@ -342,6 +348,9 @@ func (v *Value) reset(op Op) { // It modifies v to be (Copy a). //go:noinline func (v *Value) copyOf(a *Value) { + if v.InCache { + v.Block.Func.unCache(v) + } v.Op = OpCopy v.resetArgs() v.AddArg(a) @@ -460,3 +469,23 @@ func (v *Value) LackingPos() bool { return v.Op == OpVarDef || v.Op == OpVarKill || v.Op == OpVarLive || v.Op == OpPhi || (v.Op == OpFwdRef || v.Op == OpCopy) && v.Type == types.TypeMem } + +// removeable reports whether the value v can be removed from the SSA graph entirely +// if its use count drops to 0. +func (v *Value) removeable() bool { + if v.Type.IsVoid() { + // Void ops, like nil pointer checks, must stay. + return false + } + if v.Type.IsMemory() { + // All memory ops aren't needed here, but we do need + // to keep calls at least (because they might have + // syncronization operations we can't see). + return false + } + if v.Op.HasSideEffects() { + // These are mostly synchronization operations. + return false + } + return true +} diff --git a/src/cmd/compile/internal/ssa/writebarrier.go b/src/cmd/compile/internal/ssa/writebarrier.go index c7fb059475..214798a1ab 100644 --- a/src/cmd/compile/internal/ssa/writebarrier.go +++ b/src/cmd/compile/internal/ssa/writebarrier.go @@ -31,7 +31,7 @@ func needwb(v *Value, zeroes map[ID]ZeroRegion) bool { if !ok { v.Fatalf("store aux is not a type: %s", v.LongString()) } - if !t.HasHeapPointer() { + if !t.HasPointers() { return false } if IsStackAddr(v.Args[0]) { diff --git a/src/cmd/compile/internal/types/type.go b/src/cmd/compile/internal/types/type.go index 20ae856bba..a777a5fd90 100644 --- a/src/cmd/compile/internal/types/type.go +++ b/src/cmd/compile/internal/types/type.go @@ -1230,6 +1230,11 @@ func (t *Type) IsUnsafePtr() bool { return t.Etype == TUNSAFEPTR } +// IsUintptr reports whether t is an uintptr. +func (t *Type) IsUintptr() bool { + return t.Etype == TUINTPTR +} + // IsPtrShaped reports whether t is represented by a single machine pointer. // In addition to regular Go pointer types, this includes map, channel, and // function types and unsafe.Pointer. It does not include array or struct types @@ -1398,14 +1403,9 @@ func (t *Type) IsUntyped() bool { return false } -// TODO(austin): We probably only need HasHeapPointer. See -// golang.org/cl/73412 for discussion. - +// HasPointers reports whether t contains a heap pointer. +// Note that this function ignores pointers to go:notinheap types. func (t *Type) HasPointers() bool { - return t.hasPointers1(false) -} - -func (t *Type) hasPointers1(ignoreNotInHeap bool) bool { switch t.Etype { case TINT, TUINT, TINT8, TUINT8, TINT16, TUINT16, TINT32, TUINT32, TINT64, TUINT64, TUINTPTR, TFLOAT32, TFLOAT64, TCOMPLEX64, TCOMPLEX128, TBOOL, TSSA: @@ -1415,34 +1415,27 @@ func (t *Type) hasPointers1(ignoreNotInHeap bool) bool { if t.NumElem() == 0 { // empty array has no pointers return false } - return t.Elem().hasPointers1(ignoreNotInHeap) + return t.Elem().HasPointers() case TSTRUCT: for _, t1 := range t.Fields().Slice() { - if t1.Type.hasPointers1(ignoreNotInHeap) { + if t1.Type.HasPointers() { return true } } return false case TPTR, TSLICE: - return !(ignoreNotInHeap && t.Elem().NotInHeap()) + return !t.Elem().NotInHeap() case TTUPLE: ttup := t.Extra.(*Tuple) - return ttup.first.hasPointers1(ignoreNotInHeap) || ttup.second.hasPointers1(ignoreNotInHeap) + return ttup.first.HasPointers() || ttup.second.HasPointers() } return true } -// HasHeapPointer reports whether t contains a heap pointer. -// This is used for write barrier insertion, so it ignores -// pointers to go:notinheap types. -func (t *Type) HasHeapPointer() bool { - return t.hasPointers1(true) -} - func (t *Type) Symbol() *obj.LSym { return TypeLinkSym(t) } diff --git a/src/cmd/compile/internal/x86/ssa.go b/src/cmd/compile/internal/x86/ssa.go index 2de978c28a..c21ac32297 100644 --- a/src/cmd/compile/internal/x86/ssa.go +++ b/src/cmd/compile/internal/x86/ssa.go @@ -261,8 +261,8 @@ func ssaGenValue(s *gc.SSAGenState, v *ssa.Value) { n.To.Reg = x86.REG_DX } - j.To.Val = n - j2.To.Val = s.Pc() + j.To.SetTarget(n) + j2.To.SetTarget(s.Pc()) } case ssa.Op386HMULL, ssa.Op386HMULLU: diff --git a/src/cmd/dist/test.go b/src/cmd/dist/test.go index a83ae35293..5ea5c81656 100644 --- a/src/cmd/dist/test.go +++ b/src/cmd/dist/test.go @@ -1106,8 +1106,9 @@ func (t *tester) cgoTest(dt *distTest) error { cmd := t.addCmd(dt, "misc/cgo/test", t.goTest()) cmd.Env = append(os.Environ(), "GOFLAGS=-ldflags=-linkmode=external") - // A -g argument in CGO_CFLAGS should not affect how the test runs. - cmd.Env = append(cmd.Env, "CGO_CFLAGS=-g0") + // cgo should be able to cope with both -g arguments and colored + // diagnostics. + cmd.Env = append(cmd.Env, "CGO_CFLAGS=-g0 -fdiagnostics-color") t.addCmd(dt, "misc/cgo/testtls", t.goTest(), "-ldflags", "-linkmode=auto") t.addCmd(dt, "misc/cgo/testtls", t.goTest(), "-ldflags", "-linkmode=external") diff --git a/src/cmd/fix/fix.go b/src/cmd/fix/fix.go index 2c64e9b414..b49db37571 100644 --- a/src/cmd/fix/fix.go +++ b/src/cmd/fix/fix.go @@ -7,13 +7,9 @@ package main import ( "fmt" "go/ast" - "go/parser" "go/token" - "os" "path" - "reflect" "strconv" - "strings" ) type fix struct { @@ -323,160 +319,12 @@ func declImports(gen *ast.GenDecl, path string) bool { return false } -// isPkgDot reports whether t is the expression "pkg.name" -// where pkg is an imported identifier. -func isPkgDot(t ast.Expr, pkg, name string) bool { - sel, ok := t.(*ast.SelectorExpr) - return ok && isTopName(sel.X, pkg) && sel.Sel.String() == name -} - -// isPtrPkgDot reports whether f is the expression "*pkg.name" -// where pkg is an imported identifier. -func isPtrPkgDot(t ast.Expr, pkg, name string) bool { - ptr, ok := t.(*ast.StarExpr) - return ok && isPkgDot(ptr.X, pkg, name) -} - // isTopName reports whether n is a top-level unresolved identifier with the given name. func isTopName(n ast.Expr, name string) bool { id, ok := n.(*ast.Ident) return ok && id.Name == name && id.Obj == nil } -// isName reports whether n is an identifier with the given name. -func isName(n ast.Expr, name string) bool { - id, ok := n.(*ast.Ident) - return ok && id.String() == name -} - -// isCall reports whether t is a call to pkg.name. -func isCall(t ast.Expr, pkg, name string) bool { - call, ok := t.(*ast.CallExpr) - return ok && isPkgDot(call.Fun, pkg, name) -} - -// If n is an *ast.Ident, isIdent returns it; otherwise isIdent returns nil. -func isIdent(n interface{}) *ast.Ident { - id, _ := n.(*ast.Ident) - return id -} - -// refersTo reports whether n is a reference to the same object as x. -func refersTo(n ast.Node, x *ast.Ident) bool { - id, ok := n.(*ast.Ident) - // The test of id.Name == x.Name handles top-level unresolved - // identifiers, which all have Obj == nil. - return ok && id.Obj == x.Obj && id.Name == x.Name -} - -// isBlank reports whether n is the blank identifier. -func isBlank(n ast.Expr) bool { - return isName(n, "_") -} - -// isEmptyString reports whether n is an empty string literal. -func isEmptyString(n ast.Expr) bool { - lit, ok := n.(*ast.BasicLit) - return ok && lit.Kind == token.STRING && len(lit.Value) == 2 -} - -func warn(pos token.Pos, msg string, args ...interface{}) { - if pos.IsValid() { - msg = "%s: " + msg - arg1 := []interface{}{fset.Position(pos).String()} - args = append(arg1, args...) - } - fmt.Fprintf(os.Stderr, msg+"\n", args...) -} - -// countUses returns the number of uses of the identifier x in scope. -func countUses(x *ast.Ident, scope []ast.Stmt) int { - count := 0 - ff := func(n interface{}) { - if n, ok := n.(ast.Node); ok && refersTo(n, x) { - count++ - } - } - for _, n := range scope { - walk(n, ff) - } - return count -} - -// rewriteUses replaces all uses of the identifier x and !x in scope -// with f(x.Pos()) and fnot(x.Pos()). -func rewriteUses(x *ast.Ident, f, fnot func(token.Pos) ast.Expr, scope []ast.Stmt) { - var lastF ast.Expr - ff := func(n interface{}) { - ptr, ok := n.(*ast.Expr) - if !ok { - return - } - nn := *ptr - - // The child node was just walked and possibly replaced. - // If it was replaced and this is a negation, replace with fnot(p). - not, ok := nn.(*ast.UnaryExpr) - if ok && not.Op == token.NOT && not.X == lastF { - *ptr = fnot(nn.Pos()) - return - } - if refersTo(nn, x) { - lastF = f(nn.Pos()) - *ptr = lastF - } - } - for _, n := range scope { - walk(n, ff) - } -} - -// assignsTo reports whether any of the code in scope assigns to or takes the address of x. -func assignsTo(x *ast.Ident, scope []ast.Stmt) bool { - assigned := false - ff := func(n interface{}) { - if assigned { - return - } - switch n := n.(type) { - case *ast.UnaryExpr: - // use of &x - if n.Op == token.AND && refersTo(n.X, x) { - assigned = true - return - } - case *ast.AssignStmt: - for _, l := range n.Lhs { - if refersTo(l, x) { - assigned = true - return - } - } - } - } - for _, n := range scope { - if assigned { - break - } - walk(n, ff) - } - return assigned -} - -// newPkgDot returns an ast.Expr referring to "pkg.name" at position pos. -func newPkgDot(pos token.Pos, pkg, name string) ast.Expr { - return &ast.SelectorExpr{ - X: &ast.Ident{ - NamePos: pos, - Name: pkg, - }, - Sel: &ast.Ident{ - NamePos: pos, - Name: name, - }, - } -} - // renameTop renames all references to the top-level name old. // It reports whether it makes any changes. func renameTop(f *ast.File, old, new string) bool { @@ -707,143 +555,3 @@ func rewriteImport(f *ast.File, oldPath, newPath string) (rewrote bool) { } return } - -func usesImport(f *ast.File, path string) (used bool) { - spec := importSpec(f, path) - if spec == nil { - return - } - - name := spec.Name.String() - switch name { - case "<nil>": - // If the package name is not explicitly specified, - // make an educated guess. This is not guaranteed to be correct. - lastSlash := strings.LastIndex(path, "/") - if lastSlash == -1 { - name = path - } else { - name = path[lastSlash+1:] - } - case "_", ".": - // Not sure if this import is used - err on the side of caution. - return true - } - - walk(f, func(n interface{}) { - sel, ok := n.(*ast.SelectorExpr) - if ok && isTopName(sel.X, name) { - used = true - } - }) - - return -} - -func expr(s string) ast.Expr { - x, err := parser.ParseExpr(s) - if err != nil { - panic("parsing " + s + ": " + err.Error()) - } - // Remove position information to avoid spurious newlines. - killPos(reflect.ValueOf(x)) - return x -} - -var posType = reflect.TypeOf(token.Pos(0)) - -func killPos(v reflect.Value) { - switch v.Kind() { - case reflect.Ptr, reflect.Interface: - if !v.IsNil() { - killPos(v.Elem()) - } - case reflect.Slice: - n := v.Len() - for i := 0; i < n; i++ { - killPos(v.Index(i)) - } - case reflect.Struct: - n := v.NumField() - for i := 0; i < n; i++ { - f := v.Field(i) - if f.Type() == posType { - f.SetInt(0) - continue - } - killPos(f) - } - } -} - -// A Rename describes a single renaming. -type rename struct { - OldImport string // only apply rename if this import is present - NewImport string // add this import during rewrite - Old string // old name: p.T or *p.T - New string // new name: p.T or *p.T -} - -func renameFix(tab []rename) func(*ast.File) bool { - return func(f *ast.File) bool { - return renameFixTab(f, tab) - } -} - -func parseName(s string) (ptr bool, pkg, nam string) { - i := strings.Index(s, ".") - if i < 0 { - panic("parseName: invalid name " + s) - } - if strings.HasPrefix(s, "*") { - ptr = true - s = s[1:] - i-- - } - pkg = s[:i] - nam = s[i+1:] - return -} - -func renameFixTab(f *ast.File, tab []rename) bool { - fixed := false - added := map[string]bool{} - check := map[string]bool{} - for _, t := range tab { - if !imports(f, t.OldImport) { - continue - } - optr, opkg, onam := parseName(t.Old) - walk(f, func(n interface{}) { - np, ok := n.(*ast.Expr) - if !ok { - return - } - x := *np - if optr { - p, ok := x.(*ast.StarExpr) - if !ok { - return - } - x = p.X - } - if !isPkgDot(x, opkg, onam) { - return - } - if t.NewImport != "" && !added[t.NewImport] { - addImport(f, t.NewImport) - added[t.NewImport] = true - } - *np = expr(t.New) - check[t.OldImport] = true - fixed = true - }) - } - - for ipath := range check { - if !usesImport(f, ipath) { - deleteImport(f, ipath) - } - } - return fixed -} diff --git a/src/cmd/go.mod b/src/cmd/go.mod index 21670b9996..0952dbb84c 100644 --- a/src/cmd/go.mod +++ b/src/cmd/go.mod @@ -7,8 +7,8 @@ require ( github.com/ianlancetaylor/demangle v0.0.0-20200414190113-039b1ae3a340 // indirect golang.org/x/arch v0.0.0-20200511175325-f7c78586839d golang.org/x/crypto v0.0.0-20200622213623-75b288015ac9 - golang.org/x/mod v0.3.1-0.20200625141748-0b26df4a2231 + golang.org/x/mod v0.3.1-0.20200828183125-ce943fd02449 golang.org/x/sys v0.0.0-20200501145240-bc7a7d42d5c3 // indirect - golang.org/x/tools v0.0.0-20200616133436-c1934b75d054 + golang.org/x/tools v0.0.0-20200901153117-6e59e24738da golang.org/x/xerrors v0.0.0-20200806184451-1a77d5e9f316 // indirect ) diff --git a/src/cmd/go.sum b/src/cmd/go.sum index 1b5ef515c2..adbc5a96ac 100644 --- a/src/cmd/go.sum +++ b/src/cmd/go.sum @@ -6,34 +6,34 @@ github.com/google/pprof v0.0.0-20200229191704-1ebb73c60ed3/go.mod h1:ZgVRPoUq/hf github.com/ianlancetaylor/demangle v0.0.0-20181102032728-5e5cf60278f6/go.mod h1:aSSvb/t6k1mPoxDqO4vJh6VOCGPwU4O0C2/Eqndh1Sc= github.com/ianlancetaylor/demangle v0.0.0-20200414190113-039b1ae3a340 h1:S1+yTUaFPXuDZnPDbO+TrDFIjPzQraYH8/CwSlu9Fac= github.com/ianlancetaylor/demangle v0.0.0-20200414190113-039b1ae3a340/go.mod h1:aSSvb/t6k1mPoxDqO4vJh6VOCGPwU4O0C2/Eqndh1Sc= -github.com/yuin/goldmark v1.1.27/go.mod h1:3hX8gzYuyVAZsxl0MRgGTJEmQBFcNTphYh9decYSb74= +github.com/yuin/goldmark v1.2.1/go.mod h1:3hX8gzYuyVAZsxl0MRgGTJEmQBFcNTphYh9decYSb74= golang.org/x/arch v0.0.0-20200511175325-f7c78586839d h1:YvwchuJby5xEAPdBGmdAVSiVME50C+RJfJJwJJsGEV8= golang.org/x/arch v0.0.0-20200511175325-f7c78586839d/go.mod h1:flIaEI6LNU6xOCD5PaJvn9wGP0agmIOqjrtsKGRguv4= golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACkg1iLfiJU5Ep61QUkGW8qpdssI0+w= golang.org/x/crypto v0.0.0-20191011191535-87dc89f01550/go.mod h1:yigFU9vqHzYiE8UmvKecakEJjdnWj3jj499lnFckfCI= golang.org/x/crypto v0.0.0-20200622213623-75b288015ac9 h1:psW17arqaxU48Z5kZ0CQnkZWQJsqcURM6tKiBApRjXI= golang.org/x/crypto v0.0.0-20200622213623-75b288015ac9/go.mod h1:LzIPMQfyMNhhGPhUkYOs5KpL4U8rLKemX1yGLhDgUto= -golang.org/x/mod v0.2.0/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA= -golang.org/x/mod v0.3.1-0.20200625141748-0b26df4a2231 h1:R11LxkoUvECaAHdM5/ZOevSR7n+016EgTw8nbE1l+XM= -golang.org/x/mod v0.3.1-0.20200625141748-0b26df4a2231/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA= +golang.org/x/mod v0.3.0/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA= +golang.org/x/mod v0.3.1-0.20200828183125-ce943fd02449 h1:xUIPaMhvROX9dhPvRCenIJtU78+lbEenGbgqB5hfHCQ= +golang.org/x/mod v0.3.1-0.20200828183125-ce943fd02449/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA= golang.org/x/net v0.0.0-20190404232315-eb5bcb51f2a3/go.mod h1:t9HGtf8HONx5eT2rtn7q6eTqICYqUVnKs3thJo3Qplg= golang.org/x/net v0.0.0-20190620200207-3b0461eec859/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s= -golang.org/x/net v0.0.0-20200226121028-0de0cce0169b/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s= +golang.org/x/net v0.0.0-20200822124328-c89045814202/go.mod h1:/O7V0waA8r7cgGh81Ro3o1hOxt32SMVPicZroKQ2sZA= golang.org/x/sync v0.0.0-20190423024810-112230192c58/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= -golang.org/x/sync v0.0.0-20190911185100-cd5d95a43a6e/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= +golang.org/x/sync v0.0.0-20200625203802-6e8e738ad208/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= golang.org/x/sys v0.0.0-20190412213103-97732733099d/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20191204072324-ce4227a45e2e/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= +golang.org/x/sys v0.0.0-20200323222414-85ca7c5b95cd/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20200501145240-bc7a7d42d5c3 h1:5B6i6EAiSYyejWfvc5Rc9BbI3rzIsrrXfAQBWnYfn+w= golang.org/x/sys v0.0.0-20200501145240-bc7a7d42d5c3/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= golang.org/x/tools v0.0.0-20191119224855-298f0cb1881e/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo= -golang.org/x/tools v0.0.0-20200616133436-c1934b75d054 h1:HHeAlu5H9b71C+Fx0K+1dGgVFN1DM1/wz4aoGOA5qS8= -golang.org/x/tools v0.0.0-20200616133436-c1934b75d054/go.mod h1:EkVYQZoAsY45+roYkvgYkIh4xh/qjgUK9TdY2XT94GE= +golang.org/x/tools v0.0.0-20200901153117-6e59e24738da h1:8nFbt74voFOsM+Hb5XtF+1SNbbf3dzikH5osZO1hyyo= +golang.org/x/tools v0.0.0-20200901153117-6e59e24738da/go.mod h1:Cj7w3i3Rnn0Xh82ur9kSqwfTHTeVxaDqrfMjpcNT6bE= golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= golang.org/x/xerrors v0.0.0-20191011141410-1b5146add898/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= -golang.org/x/xerrors v0.0.0-20191204190536-9bdfabe68543 h1:E7g+9GITq07hpfrRu66IVDexMakfv52eLZ2CXBWiKr4= -golang.org/x/xerrors v0.0.0-20191204190536-9bdfabe68543/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= +golang.org/x/xerrors v0.0.0-20200804184101-5ec99f83aff1/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= golang.org/x/xerrors v0.0.0-20200806184451-1a77d5e9f316 h1:Jhw4VC65LaKnpq9FvcK+a8ZzrFm3D+UygvMMrhkOw70= golang.org/x/xerrors v0.0.0-20200806184451-1a77d5e9f316/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= rsc.io/pdf v0.1.1/go.mod h1:n8OzWcQ6Sp37PL01nO98y4iUCRdTGarVfzxY20ICaU4= diff --git a/src/cmd/go/alldocs.go b/src/cmd/go/alldocs.go index 68bad3cff1..8ad4f66d09 100644 --- a/src/cmd/go/alldocs.go +++ b/src/cmd/go/alldocs.go @@ -916,6 +916,7 @@ // Dir string // directory holding files for this module, if any // GoMod string // path to go.mod file used when loading this module, if any // GoVersion string // go version used in module +// Retracted string // retraction information, if any (with -retracted or -u) // Error *ModuleError // error loading module // } // @@ -947,14 +948,16 @@ // The -u flag adds information about available upgrades. // When the latest version of a given module is newer than // the current one, list -u sets the Module's Update field -// to information about the newer module. +// to information about the newer module. list -u will also set +// the module's Retracted field if the current version is retracted. // The Module's String method indicates an available upgrade by // formatting the newer version in brackets after the current version. +// If a version is retracted, the string "(retracted)" will follow it. // For example, 'go list -m -u all' might print: // // my/main/module // golang.org/x/text v0.3.0 [v0.4.0] => /tmp/text -// rsc.io/pdf v0.1.1 [v0.1.2] +// rsc.io/pdf v0.1.1 (retracted) [v0.1.2] // // (For tools, 'go list -m -u -json all' may be more convenient to parse.) // @@ -964,6 +967,14 @@ // the default output format to display the module path followed by the // space-separated version list. // +// The -retracted flag causes list to report information about retracted +// module versions. When -retracted is used with -f or -json, the Retracted +// field will be set to a string explaining why the version was retracted. +// The string is taken from comments on the retract directive in the +// module's go.mod file. When -retracted is used with -versions, retracted +// versions are listed together with unretracted versions. The -retracted +// flag may be used with or without -m. +// // The arguments to list -m are interpreted as a list of modules, not packages. // The main module is the module containing the current directory. // The active modules are the main module and its dependencies. @@ -1100,9 +1111,14 @@ // module path and version pair. If the @v is omitted, a replacement without // a version on the left side is dropped. // +// The -retract=version and -dropretract=version flags add and drop a +// retraction on the given version. The version may be a single version +// like "v1.2.3" or a closed interval like "[v1.1.0-v1.1.9]". Note that +// -retract=version is a no-op if that retraction already exists. +// // The -require, -droprequire, -exclude, -dropexclude, -replace, -// and -dropreplace editing flags may be repeated, and the changes -// are applied in the order given. +// -dropreplace, -retract, and -dropretract editing flags may be repeated, +// and the changes are applied in the order given. // // The -go=version flag sets the expected Go language version. // @@ -1136,6 +1152,15 @@ // New Module // } // +// type Retract struct { +// Low string +// High string +// Rationale string +// } +// +// Retract entries representing a single version (not an interval) will have +// the "Low" and "High" fields set to the same value. +// // Note that this only describes the go.mod file itself, not other modules // referred to indirectly. For the full set of modules available to a build, // use 'go list -m -json all'. @@ -1894,15 +1919,17 @@ // require new/thing/v2 v2.3.4 // exclude old/thing v1.2.3 // replace bad/thing v1.4.5 => good/thing v1.4.5 +// retract v1.5.6 // // The verbs are // module, to define the module path; // go, to set the expected language version; // require, to require a particular module at a given version or later; -// exclude, to exclude a particular module version from use; and -// replace, to replace a module version with a different module version. +// exclude, to exclude a particular module version from use; +// replace, to replace a module version with a different module version; and +// retract, to indicate a previously released version should not be used. // Exclude and replace apply only in the main module's go.mod and are ignored -// in dependencies. See https://research.swtch.com/vgo-mvs for details. +// in dependencies. See https://golang.org/ref/mod for details. // // The leading verb can be factored out of adjacent lines to create a block, // like in Go imports: @@ -2145,7 +2172,10 @@ // before resolving dependencies or building the code. // // The -insecure flag permits fetching from repositories and resolving -// custom domains using insecure schemes such as HTTP. Use with caution. +// custom domains using insecure schemes such as HTTP. Use with caution. The +// GOINSECURE environment variable is usually a better alternative, since it +// provides control over which modules may be retrieved using an insecure scheme. +// See 'go help environment' for details. // // The -t flag instructs get to also download the packages required to build // the tests for the specified packages. diff --git a/src/cmd/go/internal/base/flag.go b/src/cmd/go/internal/base/flag.go index 6727196816..c97c744520 100644 --- a/src/cmd/go/internal/base/flag.go +++ b/src/cmd/go/internal/base/flag.go @@ -28,13 +28,42 @@ func (v *StringsFlag) String() string { return "<StringsFlag>" } +// explicitStringFlag is like a regular string flag, but it also tracks whether +// the string was set explicitly to a non-empty value. +type explicitStringFlag struct { + value *string + explicit *bool +} + +func (f explicitStringFlag) String() string { + if f.value == nil { + return "" + } + return *f.value +} + +func (f explicitStringFlag) Set(v string) error { + *f.value = v + if v != "" { + *f.explicit = true + } + return nil +} + // AddBuildFlagsNX adds the -n and -x build flags to the flag set. func AddBuildFlagsNX(flags *flag.FlagSet) { flags.BoolVar(&cfg.BuildN, "n", false, "") flags.BoolVar(&cfg.BuildX, "x", false, "") } -// AddLoadFlags adds the -mod build flag to the flag set. -func AddLoadFlags(flags *flag.FlagSet) { - flags.StringVar(&cfg.BuildMod, "mod", "", "") +// AddModFlag adds the -mod build flag to the flag set. +func AddModFlag(flags *flag.FlagSet) { + flags.Var(explicitStringFlag{value: &cfg.BuildMod, explicit: &cfg.BuildModExplicit}, "mod", "") +} + +// AddModCommonFlags adds the module-related flags common to build commands +// and 'go mod' subcommands. +func AddModCommonFlags(flags *flag.FlagSet) { + flags.BoolVar(&cfg.ModCacheRW, "modcacherw", false, "") + flags.StringVar(&cfg.ModFile, "modfile", "", "") } diff --git a/src/cmd/go/internal/cfg/cfg.go b/src/cmd/go/internal/cfg/cfg.go index f9bbcd9180..9bf1db73ef 100644 --- a/src/cmd/go/internal/cfg/cfg.go +++ b/src/cmd/go/internal/cfg/cfg.go @@ -27,7 +27,8 @@ var ( BuildBuildmode string // -buildmode flag BuildContext = defaultContext() BuildMod string // -mod flag - BuildModReason string // reason -mod flag is set, if set by default + BuildModExplicit bool // whether -mod was set explicitly + BuildModReason string // reason -mod was set, if set by default BuildI bool // -i flag BuildLinkshared bool // -linkshared flag BuildMSan bool // -msan flag @@ -48,6 +49,8 @@ var ( ModCacheRW bool // -modcacherw flag ModFile string // -modfile flag + Insecure bool // -insecure flag + CmdName string // "build", "install", "list", "mod tidy", etc. DebugActiongraph string // -debug-actiongraph flag (undocumented, unstable) diff --git a/src/cmd/go/internal/fmtcmd/fmt.go b/src/cmd/go/internal/fmtcmd/fmt.go index f96cff429c..b0c1c59b40 100644 --- a/src/cmd/go/internal/fmtcmd/fmt.go +++ b/src/cmd/go/internal/fmtcmd/fmt.go @@ -23,7 +23,8 @@ import ( func init() { base.AddBuildFlagsNX(&CmdFmt.Flag) - base.AddLoadFlags(&CmdFmt.Flag) + base.AddModFlag(&CmdFmt.Flag) + base.AddModCommonFlags(&CmdFmt.Flag) } var CmdFmt = &base.Command{ diff --git a/src/cmd/go/internal/get/get.go b/src/cmd/go/internal/get/get.go index e5bacadaa3..3f7a66384a 100644 --- a/src/cmd/go/internal/get/get.go +++ b/src/cmd/go/internal/get/get.go @@ -18,8 +18,11 @@ import ( "cmd/go/internal/load" "cmd/go/internal/search" "cmd/go/internal/str" + "cmd/go/internal/vcs" "cmd/go/internal/web" "cmd/go/internal/work" + + "golang.org/x/mod/module" ) var CmdGet = &base.Command{ @@ -41,7 +44,10 @@ The -fix flag instructs get to run the fix tool on the downloaded packages before resolving dependencies or building the code. The -insecure flag permits fetching from repositories and resolving -custom domains using insecure schemes such as HTTP. Use with caution. +custom domains using insecure schemes such as HTTP. Use with caution. The +GOINSECURE environment variable is usually a better alternative, since it +provides control over which modules may be retrieved using an insecure scheme. +See 'go help environment' for details. The -t flag instructs get to also download the packages required to build the tests for the specified packages. @@ -103,14 +109,12 @@ var ( getT = CmdGet.Flag.Bool("t", false, "") getU = CmdGet.Flag.Bool("u", false, "") getFix = CmdGet.Flag.Bool("fix", false, "") - - Insecure bool ) func init() { work.AddBuildFlags(CmdGet, work.OmitModFlag|work.OmitModCommonFlags) CmdGet.Run = runGet // break init loop - CmdGet.Flag.BoolVar(&Insecure, "insecure", Insecure, "") + CmdGet.Flag.BoolVar(&cfg.Insecure, "insecure", cfg.Insecure, "") } func runGet(ctx context.Context, cmd *base.Command, args []string) { @@ -403,17 +407,12 @@ func download(arg string, parent *load.Package, stk *load.ImportStack, mode int) // to make the first copy of or update a copy of the given package. func downloadPackage(p *load.Package) error { var ( - vcs *vcsCmd + vcsCmd *vcs.Cmd repo, rootPath string err error blindRepo bool // set if the repo has unusual configuration ) - security := web.SecureOnly - if Insecure { - security = web.Insecure - } - // p can be either a real package, or a pseudo-package whose “import path” is // actually a wildcard pattern. // Trim the path at the element containing the first wildcard, @@ -427,22 +426,26 @@ func downloadPackage(p *load.Package) error { } importPrefix = importPrefix[:slash] } - if err := CheckImportPath(importPrefix); err != nil { + if err := module.CheckImportPath(importPrefix); err != nil { return fmt.Errorf("%s: invalid import path: %v", p.ImportPath, err) } + security := web.SecureOnly + if cfg.Insecure || module.MatchPrefixPatterns(cfg.GOINSECURE, importPrefix) { + security = web.Insecure + } if p.Internal.Build.SrcRoot != "" { // Directory exists. Look for checkout along path to src. - vcs, rootPath, err = vcsFromDir(p.Dir, p.Internal.Build.SrcRoot) + vcsCmd, rootPath, err = vcs.FromDir(p.Dir, p.Internal.Build.SrcRoot) if err != nil { return err } repo = "<local>" // should be unused; make distinctive // Double-check where it came from. - if *getU && vcs.remoteRepo != nil { + if *getU && vcsCmd.RemoteRepo != nil { dir := filepath.Join(p.Internal.Build.SrcRoot, filepath.FromSlash(rootPath)) - remote, err := vcs.remoteRepo(vcs, dir) + remote, err := vcsCmd.RemoteRepo(vcsCmd, dir) if err != nil { // Proceed anyway. The package is present; we likely just don't understand // the repo configuration (e.g. unusual remote protocol). @@ -450,10 +453,10 @@ func downloadPackage(p *load.Package) error { } repo = remote if !*getF && err == nil { - if rr, err := RepoRootForImportPath(importPrefix, IgnoreMod, security); err == nil { + if rr, err := vcs.RepoRootForImportPath(importPrefix, vcs.IgnoreMod, security); err == nil { repo := rr.Repo - if rr.vcs.resolveRepo != nil { - resolved, err := rr.vcs.resolveRepo(rr.vcs, dir, repo) + if rr.VCS.ResolveRepo != nil { + resolved, err := rr.VCS.ResolveRepo(rr.VCS, dir, repo) if err == nil { repo = resolved } @@ -467,13 +470,13 @@ func downloadPackage(p *load.Package) error { } else { // Analyze the import path to determine the version control system, // repository, and the import path for the root of the repository. - rr, err := RepoRootForImportPath(importPrefix, IgnoreMod, security) + rr, err := vcs.RepoRootForImportPath(importPrefix, vcs.IgnoreMod, security) if err != nil { return err } - vcs, repo, rootPath = rr.vcs, rr.Repo, rr.Root + vcsCmd, repo, rootPath = rr.VCS, rr.Repo, rr.Root } - if !blindRepo && !vcs.isSecure(repo) && !Insecure { + if !blindRepo && !vcsCmd.IsSecure(repo) && security != web.Insecure { return fmt.Errorf("cannot download, %v uses insecure protocol", repo) } @@ -496,7 +499,7 @@ func downloadPackage(p *load.Package) error { } root := filepath.Join(p.Internal.Build.SrcRoot, filepath.FromSlash(rootPath)) - if err := checkNestedVCS(vcs, root, p.Internal.Build.SrcRoot); err != nil { + if err := vcs.CheckNested(vcsCmd, root, p.Internal.Build.SrcRoot); err != nil { return err } @@ -512,7 +515,7 @@ func downloadPackage(p *load.Package) error { // Check that this is an appropriate place for the repo to be checked out. // The target directory must either not exist or have a repo checked out already. - meta := filepath.Join(root, "."+vcs.cmd) + meta := filepath.Join(root, "."+vcsCmd.Cmd) if _, err := os.Stat(meta); err != nil { // Metadata file or directory does not exist. Prepare to checkout new copy. // Some version control tools require the target directory not to exist. @@ -533,12 +536,12 @@ func downloadPackage(p *load.Package) error { fmt.Fprintf(os.Stderr, "created GOPATH=%s; see 'go help gopath'\n", p.Internal.Build.Root) } - if err = vcs.create(root, repo); err != nil { + if err = vcsCmd.Create(root, repo); err != nil { return err } } else { // Metadata directory does exist; download incremental updates. - if err = vcs.download(root); err != nil { + if err = vcsCmd.Download(root); err != nil { return err } } @@ -547,12 +550,12 @@ func downloadPackage(p *load.Package) error { // Do not show tag sync in -n; it's noise more than anything, // and since we're not running commands, no tag will be found. // But avoid printing nothing. - fmt.Fprintf(os.Stderr, "# cd %s; %s sync/update\n", root, vcs.cmd) + fmt.Fprintf(os.Stderr, "# cd %s; %s sync/update\n", root, vcsCmd.Cmd) return nil } // Select and sync to appropriate version of the repository. - tags, err := vcs.tags(root) + tags, err := vcsCmd.Tags(root) if err != nil { return err } @@ -560,7 +563,7 @@ func downloadPackage(p *load.Package) error { if i := strings.Index(vers, " "); i >= 0 { vers = vers[:i] } - if err := vcs.tagSync(root, selectTag(vers, tags)); err != nil { + if err := vcsCmd.TagSync(root, selectTag(vers, tags)); err != nil { return err } diff --git a/src/cmd/go/internal/get/path.go b/src/cmd/go/internal/get/path.go deleted file mode 100644 index ce2e0cdd70..0000000000 --- a/src/cmd/go/internal/get/path.go +++ /dev/null @@ -1,192 +0,0 @@ -// Copyright 2018 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package get - -import ( - "fmt" - "strings" - "unicode" - "unicode/utf8" -) - -// The following functions are copied verbatim from golang.org/x/mod/module/module.go, -// with a change to additionally reject Windows short-names, -// and one to accept arbitrary letters (golang.org/issue/29101). -// -// TODO(bcmills): After the call site for this function is backported, -// consolidate this back down to a single copy. -// -// NOTE: DO NOT MERGE THESE UNTIL WE DECIDE ABOUT ARBITRARY LETTERS IN MODULE MODE. - -// CheckImportPath checks that an import path is valid. -func CheckImportPath(path string) error { - if err := checkPath(path, false); err != nil { - return fmt.Errorf("malformed import path %q: %v", path, err) - } - return nil -} - -// checkPath checks that a general path is valid. -// It returns an error describing why but not mentioning path. -// Because these checks apply to both module paths and import paths, -// the caller is expected to add the "malformed ___ path %q: " prefix. -// fileName indicates whether the final element of the path is a file name -// (as opposed to a directory name). -func checkPath(path string, fileName bool) error { - if !utf8.ValidString(path) { - return fmt.Errorf("invalid UTF-8") - } - if path == "" { - return fmt.Errorf("empty string") - } - if path[0] == '-' { - return fmt.Errorf("leading dash") - } - if strings.Contains(path, "//") { - return fmt.Errorf("double slash") - } - if path[len(path)-1] == '/' { - return fmt.Errorf("trailing slash") - } - elemStart := 0 - for i, r := range path { - if r == '/' { - if err := checkElem(path[elemStart:i], fileName); err != nil { - return err - } - elemStart = i + 1 - } - } - if err := checkElem(path[elemStart:], fileName); err != nil { - return err - } - return nil -} - -// checkElem checks whether an individual path element is valid. -// fileName indicates whether the element is a file name (not a directory name). -func checkElem(elem string, fileName bool) error { - if elem == "" { - return fmt.Errorf("empty path element") - } - if strings.Count(elem, ".") == len(elem) { - return fmt.Errorf("invalid path element %q", elem) - } - if elem[0] == '.' && !fileName { - return fmt.Errorf("leading dot in path element") - } - if elem[len(elem)-1] == '.' { - return fmt.Errorf("trailing dot in path element") - } - - charOK := pathOK - if fileName { - charOK = fileNameOK - } - for _, r := range elem { - if !charOK(r) { - return fmt.Errorf("invalid char %q", r) - } - } - - // Windows disallows a bunch of path elements, sadly. - // See https://docs.microsoft.com/en-us/windows/desktop/fileio/naming-a-file - short := elem - if i := strings.Index(short, "."); i >= 0 { - short = short[:i] - } - for _, bad := range badWindowsNames { - if strings.EqualFold(bad, short) { - return fmt.Errorf("disallowed path element %q", elem) - } - } - - // Reject path components that look like Windows short-names. - // Those usually end in a tilde followed by one or more ASCII digits. - if tilde := strings.LastIndexByte(short, '~'); tilde >= 0 && tilde < len(short)-1 { - suffix := short[tilde+1:] - suffixIsDigits := true - for _, r := range suffix { - if r < '0' || r > '9' { - suffixIsDigits = false - break - } - } - if suffixIsDigits { - return fmt.Errorf("trailing tilde and digits in path element") - } - } - - return nil -} - -// pathOK reports whether r can appear in an import path element. -// -// NOTE: This function DIVERGES from module mode pathOK by accepting Unicode letters. -func pathOK(r rune) bool { - if r < utf8.RuneSelf { - return r == '+' || r == '-' || r == '.' || r == '_' || r == '~' || - '0' <= r && r <= '9' || - 'A' <= r && r <= 'Z' || - 'a' <= r && r <= 'z' - } - return unicode.IsLetter(r) -} - -// fileNameOK reports whether r can appear in a file name. -// For now we allow all Unicode letters but otherwise limit to pathOK plus a few more punctuation characters. -// If we expand the set of allowed characters here, we have to -// work harder at detecting potential case-folding and normalization collisions. -// See note about "safe encoding" below. -func fileNameOK(r rune) bool { - if r < utf8.RuneSelf { - // Entire set of ASCII punctuation, from which we remove characters: - // ! " # $ % & ' ( ) * + , - . / : ; < = > ? @ [ \ ] ^ _ ` { | } ~ - // We disallow some shell special characters: " ' * < > ? ` | - // (Note that some of those are disallowed by the Windows file system as well.) - // We also disallow path separators / : and \ (fileNameOK is only called on path element characters). - // We allow spaces (U+0020) in file names. - const allowed = "!#$%&()+,-.=@[]^_{}~ " - if '0' <= r && r <= '9' || 'A' <= r && r <= 'Z' || 'a' <= r && r <= 'z' { - return true - } - for i := 0; i < len(allowed); i++ { - if rune(allowed[i]) == r { - return true - } - } - return false - } - // It may be OK to add more ASCII punctuation here, but only carefully. - // For example Windows disallows < > \, and macOS disallows :, so we must not allow those. - return unicode.IsLetter(r) -} - -// badWindowsNames are the reserved file path elements on Windows. -// See https://docs.microsoft.com/en-us/windows/desktop/fileio/naming-a-file -var badWindowsNames = []string{ - "CON", - "PRN", - "AUX", - "NUL", - "COM1", - "COM2", - "COM3", - "COM4", - "COM5", - "COM6", - "COM7", - "COM8", - "COM9", - "LPT1", - "LPT2", - "LPT3", - "LPT4", - "LPT5", - "LPT6", - "LPT7", - "LPT8", - "LPT9", -} diff --git a/src/cmd/go/internal/list/list.go b/src/cmd/go/internal/list/list.go index e68c39f392..23500dd9d8 100644 --- a/src/cmd/go/internal/list/list.go +++ b/src/cmd/go/internal/list/list.go @@ -10,6 +10,7 @@ import ( "bytes" "context" "encoding/json" + "fmt" "io" "os" "sort" @@ -215,6 +216,7 @@ applied to a Go struct, but now a Module struct: Dir string // directory holding files for this module, if any GoMod string // path to go.mod file used when loading this module, if any GoVersion string // go version used in module + Retracted string // retraction information, if any (with -retracted or -u) Error *ModuleError // error loading module } @@ -246,14 +248,16 @@ the replaced source code.) The -u flag adds information about available upgrades. When the latest version of a given module is newer than the current one, list -u sets the Module's Update field -to information about the newer module. +to information about the newer module. list -u will also set +the module's Retracted field if the current version is retracted. The Module's String method indicates an available upgrade by formatting the newer version in brackets after the current version. +If a version is retracted, the string "(retracted)" will follow it. For example, 'go list -m -u all' might print: my/main/module golang.org/x/text v0.3.0 [v0.4.0] => /tmp/text - rsc.io/pdf v0.1.1 [v0.1.2] + rsc.io/pdf v0.1.1 (retracted) [v0.1.2] (For tools, 'go list -m -u -json all' may be more convenient to parse.) @@ -263,6 +267,14 @@ to semantic versioning, earliest to latest. The flag also changes the default output format to display the module path followed by the space-separated version list. +The -retracted flag causes list to report information about retracted +module versions. When -retracted is used with -f or -json, the Retracted +field will be set to a string explaining why the version was retracted. +The string is taken from comments on the retract directive in the +module's go.mod file. When -retracted is used with -versions, retracted +versions are listed together with unretracted versions. The -retracted +flag may be used with or without -m. + The arguments to list -m are interpreted as a list of modules, not packages. The main module is the module containing the current directory. The active modules are the main module and its dependencies. @@ -296,17 +308,18 @@ func init() { } var ( - listCompiled = CmdList.Flag.Bool("compiled", false, "") - listDeps = CmdList.Flag.Bool("deps", false, "") - listE = CmdList.Flag.Bool("e", false, "") - listExport = CmdList.Flag.Bool("export", false, "") - listFmt = CmdList.Flag.String("f", "", "") - listFind = CmdList.Flag.Bool("find", false, "") - listJson = CmdList.Flag.Bool("json", false, "") - listM = CmdList.Flag.Bool("m", false, "") - listU = CmdList.Flag.Bool("u", false, "") - listTest = CmdList.Flag.Bool("test", false, "") - listVersions = CmdList.Flag.Bool("versions", false, "") + listCompiled = CmdList.Flag.Bool("compiled", false, "") + listDeps = CmdList.Flag.Bool("deps", false, "") + listE = CmdList.Flag.Bool("e", false, "") + listExport = CmdList.Flag.Bool("export", false, "") + listFmt = CmdList.Flag.String("f", "", "") + listFind = CmdList.Flag.Bool("find", false, "") + listJson = CmdList.Flag.Bool("json", false, "") + listM = CmdList.Flag.Bool("m", false, "") + listRetracted = CmdList.Flag.Bool("retracted", false, "") + listTest = CmdList.Flag.Bool("test", false, "") + listU = CmdList.Flag.Bool("u", false, "") + listVersions = CmdList.Flag.Bool("versions", false, "") ) var nl = []byte{'\n'} @@ -367,6 +380,16 @@ func runList(ctx context.Context, cmd *base.Command, args []string) { } } + modload.Init() + if *listRetracted { + if cfg.BuildMod == "vendor" { + base.Fatalf("go list -retracted cannot be used when vendoring is enabled") + } + if !modload.Enabled() { + base.Fatalf("go list -retracted can only be used in module-aware mode") + } + } + if *listM { // Module mode. if *listCompiled { @@ -414,9 +437,7 @@ func runList(ctx context.Context, cmd *base.Command, args []string) { } } - modload.LoadBuildList(ctx) - - mods := modload.ListModules(ctx, args, *listU, *listVersions) + mods := modload.ListModules(ctx, args, *listU, *listVersions, *listRetracted) if !*listE { for _, m := range mods { if m.Error != nil { @@ -522,7 +543,7 @@ func runList(ctx context.Context, cmd *base.Command, args []string) { // Note that -deps is applied after -test, // so that you only get descriptions of tests for the things named // explicitly on the command line, not for all dependencies. - pkgs = load.PackageList(pkgs) + pkgs = loadPackageList(pkgs) } // Do we need to run a build to gather information? @@ -557,7 +578,7 @@ func runList(ctx context.Context, cmd *base.Command, args []string) { if *listTest { all := pkgs if !*listDeps { - all = load.PackageList(pkgs) + all = loadPackageList(pkgs) } // Update import paths to distinguish the real package p // from p recompiled for q.test. @@ -607,6 +628,55 @@ func runList(ctx context.Context, cmd *base.Command, args []string) { } } + // TODO(golang.org/issue/40676): This mechanism could be extended to support + // -u without -m. + if *listRetracted { + // Load retractions for modules that provide packages that will be printed. + // TODO(golang.org/issue/40775): Packages from the same module refer to + // distinct ModulePublic instance. It would be nice if they could all point + // to the same instance. This would require additional global state in + // modload.loaded, so that should be refactored first. For now, we update + // all instances. + modToArg := make(map[*modinfo.ModulePublic]string) + argToMods := make(map[string][]*modinfo.ModulePublic) + var args []string + addModule := func(mod *modinfo.ModulePublic) { + if mod.Version == "" { + return + } + arg := fmt.Sprintf("%s@%s", mod.Path, mod.Version) + if argToMods[arg] == nil { + args = append(args, arg) + } + argToMods[arg] = append(argToMods[arg], mod) + modToArg[mod] = arg + } + for _, p := range pkgs { + if p.Module == nil { + continue + } + addModule(p.Module) + if p.Module.Replace != nil { + addModule(p.Module.Replace) + } + } + + if len(args) > 0 { + listU := false + listVersions := false + rmods := modload.ListModules(ctx, args, listU, listVersions, *listRetracted) + for i, arg := range args { + rmod := rmods[i] + for _, mod := range argToMods[arg] { + mod.Retracted = rmod.Retracted + if rmod.Error != nil && mod.Error == nil { + mod.Error = rmod.Error + } + } + } + } + } + // Record non-identity import mappings in p.ImportMap. for _, p := range pkgs { for i, srcPath := range p.Internal.RawImports { @@ -625,6 +695,23 @@ func runList(ctx context.Context, cmd *base.Command, args []string) { } } +// loadPackageList is like load.PackageList, but prints error messages and exits +// with nonzero status if listE is not set and any package in the expanded list +// has errors. +func loadPackageList(roots []*load.Package) []*load.Package { + pkgs := load.PackageList(roots) + + if !*listE { + for _, pkg := range pkgs { + if pkg.Error != nil { + base.Errorf("%v", pkg.Error) + } + } + } + + return pkgs +} + // TrackingWriter tracks the last byte written on every write so // we can avoid printing a newline if one was already written or // if there is no output at all. diff --git a/src/cmd/go/internal/load/test.go b/src/cmd/go/internal/load/test.go index a0e275095b..e0f13323df 100644 --- a/src/cmd/go/internal/load/test.go +++ b/src/cmd/go/internal/load/test.go @@ -191,6 +191,7 @@ func TestPackagesAndErrors(ctx context.Context, p *Package, cover *TestCover) (p GoFiles: p.XTestGoFiles, Imports: p.XTestImports, ForTest: p.ImportPath, + Module: p.Module, Error: pxtestErr, }, Internal: PackageInternal{ @@ -222,6 +223,7 @@ func TestPackagesAndErrors(ctx context.Context, p *Package, cover *TestCover) (p ImportPath: p.ImportPath + ".test", Root: p.Root, Imports: str.StringList(TestMainDeps), + Module: p.Module, }, Internal: PackageInternal{ Build: &build.Package{Name: "main"}, diff --git a/src/cmd/go/internal/modcmd/download.go b/src/cmd/go/internal/modcmd/download.go index d4c161fca1..6227fd9f33 100644 --- a/src/cmd/go/internal/modcmd/download.go +++ b/src/cmd/go/internal/modcmd/download.go @@ -12,9 +12,8 @@ import ( "cmd/go/internal/base" "cmd/go/internal/cfg" - "cmd/go/internal/modload" "cmd/go/internal/modfetch" - "cmd/go/internal/work" + "cmd/go/internal/modload" "golang.org/x/mod/module" ) @@ -64,7 +63,7 @@ func init() { // TODO(jayconrod): https://golang.org/issue/35849 Apply -x to other 'go mod' commands. cmdDownload.Flag.BoolVar(&cfg.BuildX, "x", false, "") - work.AddModCommonFlags(cmdDownload) + base.AddModCommonFlags(&cmdDownload.Flag) } type moduleJSON struct { @@ -136,9 +135,10 @@ func runDownload(ctx context.Context, cmd *base.Command, args []string) { var mods []*moduleJSON listU := false listVersions := false + listRetractions := false type token struct{} sem := make(chan token, runtime.GOMAXPROCS(0)) - for _, info := range modload.ListModules(ctx, args, listU, listVersions) { + for _, info := range modload.ListModules(ctx, args, listU, listVersions, listRetractions) { if info.Replace != nil { info = info.Replace } @@ -187,4 +187,7 @@ func runDownload(ctx context.Context, cmd *base.Command, args []string) { } base.ExitIfErrors() } + + // Update go.mod and especially go.sum if needed. + modload.WriteGoMod() } diff --git a/src/cmd/go/internal/modcmd/edit.go b/src/cmd/go/internal/modcmd/edit.go index a81c25270f..03a774b824 100644 --- a/src/cmd/go/internal/modcmd/edit.go +++ b/src/cmd/go/internal/modcmd/edit.go @@ -19,7 +19,6 @@ import ( "cmd/go/internal/lockedfile" "cmd/go/internal/modfetch" "cmd/go/internal/modload" - "cmd/go/internal/work" "golang.org/x/mod/modfile" "golang.org/x/mod/module" @@ -68,9 +67,14 @@ The -dropreplace=old[@v] flag drops a replacement of the given module path and version pair. If the @v is omitted, a replacement without a version on the left side is dropped. +The -retract=version and -dropretract=version flags add and drop a +retraction on the given version. The version may be a single version +like "v1.2.3" or a closed interval like "[v1.1.0-v1.1.9]". Note that +-retract=version is a no-op if that retraction already exists. + The -require, -droprequire, -exclude, -dropexclude, -replace, -and -dropreplace editing flags may be repeated, and the changes -are applied in the order given. +-dropreplace, -retract, and -dropretract editing flags may be repeated, +and the changes are applied in the order given. The -go=version flag sets the expected Go language version. @@ -104,6 +108,15 @@ writing it back to go.mod. The JSON output corresponds to these Go types: New Module } + type Retract struct { + Low string + High string + Rationale string + } + +Retract entries representing a single version (not an interval) will have +the "Low" and "High" fields set to the same value. + Note that this only describes the go.mod file itself, not other modules referred to indirectly. For the full set of modules available to a build, use 'go list -m -json all'. @@ -137,8 +150,10 @@ func init() { cmdEdit.Flag.Var(flagFunc(flagDropReplace), "dropreplace", "") cmdEdit.Flag.Var(flagFunc(flagReplace), "replace", "") cmdEdit.Flag.Var(flagFunc(flagDropExclude), "dropexclude", "") + cmdEdit.Flag.Var(flagFunc(flagRetract), "retract", "") + cmdEdit.Flag.Var(flagFunc(flagDropRetract), "dropretract", "") - work.AddModCommonFlags(cmdEdit) + base.AddModCommonFlags(&cmdEdit.Flag) base.AddBuildFlagsNX(&cmdEdit.Flag) } @@ -252,12 +267,7 @@ func parsePathVersion(flag, arg string) (path, version string) { base.Fatalf("go mod: -%s=%s: invalid path: %v", flag, arg, err) } - // We don't call modfile.CheckPathVersion, because that insists - // on versions being in semver form, but here we want to allow - // versions like "master" or "1234abcdef", which the go command will resolve - // the next time it runs (or during -fix). - // Even so, we need to make sure the version is a valid token. - if modfile.MustQuote(version) { + if !allowedVersionArg(version) { base.Fatalf("go mod: -%s=%s: invalid version %q", flag, arg, version) } @@ -289,12 +299,48 @@ func parsePathVersionOptional(adj, arg string, allowDirPath bool) (path, version return path, version, fmt.Errorf("invalid %s path: %v", adj, err) } } - if path != arg && modfile.MustQuote(version) { + if path != arg && !allowedVersionArg(version) { return path, version, fmt.Errorf("invalid %s version: %q", adj, version) } return path, version, nil } +// parseVersionInterval parses a single version like "v1.2.3" or a closed +// interval like "[v1.2.3,v1.4.5]". Note that a single version has the same +// representation as an interval with equal upper and lower bounds: both +// Low and High are set. +func parseVersionInterval(arg string) (modfile.VersionInterval, error) { + if !strings.HasPrefix(arg, "[") { + if !allowedVersionArg(arg) { + return modfile.VersionInterval{}, fmt.Errorf("invalid version: %q", arg) + } + return modfile.VersionInterval{Low: arg, High: arg}, nil + } + if !strings.HasSuffix(arg, "]") { + return modfile.VersionInterval{}, fmt.Errorf("invalid version interval: %q", arg) + } + s := arg[1 : len(arg)-1] + i := strings.Index(s, ",") + if i < 0 { + return modfile.VersionInterval{}, fmt.Errorf("invalid version interval: %q", arg) + } + low := strings.TrimSpace(s[:i]) + high := strings.TrimSpace(s[i+1:]) + if !allowedVersionArg(low) || !allowedVersionArg(high) { + return modfile.VersionInterval{}, fmt.Errorf("invalid version interval: %q", arg) + } + return modfile.VersionInterval{Low: low, High: high}, nil +} + +// allowedVersionArg returns whether a token may be used as a version in go.mod. +// We don't call modfile.CheckPathVersion, because that insists on versions +// being in semver form, but here we want to allow versions like "master" or +// "1234abcdef", which the go command will resolve the next time it runs (or +// during -fix). Even so, we need to make sure the version is a valid token. +func allowedVersionArg(arg string) bool { + return !modfile.MustQuote(arg) +} + // flagRequire implements the -require flag. func flagRequire(arg string) { path, version := parsePathVersion("require", arg) @@ -377,6 +423,32 @@ func flagDropReplace(arg string) { }) } +// flagRetract implements the -retract flag. +func flagRetract(arg string) { + vi, err := parseVersionInterval(arg) + if err != nil { + base.Fatalf("go mod: -retract=%s: %v", arg, err) + } + edits = append(edits, func(f *modfile.File) { + if err := f.AddRetract(vi, ""); err != nil { + base.Fatalf("go mod: -retract=%s: %v", arg, err) + } + }) +} + +// flagDropRetract implements the -dropretract flag. +func flagDropRetract(arg string) { + vi, err := parseVersionInterval(arg) + if err != nil { + base.Fatalf("go mod: -dropretract=%s: %v", arg, err) + } + edits = append(edits, func(f *modfile.File) { + if err := f.DropRetract(vi); err != nil { + base.Fatalf("go mod: -dropretract=%s: %v", arg, err) + } + }) +} + // fileJSON is the -json output data structure. type fileJSON struct { Module module.Version @@ -384,6 +456,7 @@ type fileJSON struct { Require []requireJSON Exclude []module.Version Replace []replaceJSON + Retract []retractJSON } type requireJSON struct { @@ -397,6 +470,12 @@ type replaceJSON struct { New module.Version } +type retractJSON struct { + Low string `json:",omitempty"` + High string `json:",omitempty"` + Rationale string `json:",omitempty"` +} + // editPrintJSON prints the -json output. func editPrintJSON(modFile *modfile.File) { var f fileJSON @@ -415,6 +494,9 @@ func editPrintJSON(modFile *modfile.File) { for _, r := range modFile.Replace { f.Replace = append(f.Replace, replaceJSON{r.Old, r.New}) } + for _, r := range modFile.Retract { + f.Retract = append(f.Retract, retractJSON{r.Low, r.High, r.Rationale}) + } data, err := json.MarshalIndent(&f, "", "\t") if err != nil { base.Fatalf("go: internal error: %v", err) diff --git a/src/cmd/go/internal/modcmd/graph.go b/src/cmd/go/internal/modcmd/graph.go index 6da12b9cab..a149b65605 100644 --- a/src/cmd/go/internal/modcmd/graph.go +++ b/src/cmd/go/internal/modcmd/graph.go @@ -15,7 +15,6 @@ import ( "cmd/go/internal/base" "cmd/go/internal/cfg" "cmd/go/internal/modload" - "cmd/go/internal/work" "golang.org/x/mod/module" ) @@ -33,7 +32,7 @@ path@version, except for the main module, which has no @version suffix. } func init() { - work.AddModCommonFlags(cmdGraph) + base.AddModCommonFlags(&cmdGraph.Flag) } func runGraph(ctx context.Context, cmd *base.Command, args []string) { @@ -48,7 +47,7 @@ func runGraph(ctx context.Context, cmd *base.Command, args []string) { base.Fatalf("go: cannot find main module; see 'go help modules'") } } - modload.LoadBuildList(ctx) + modload.LoadAllModules(ctx) reqs := modload.MinReqs() format := func(m module.Version) string { diff --git a/src/cmd/go/internal/modcmd/init.go b/src/cmd/go/internal/modcmd/init.go index b6cffd332d..21b235653e 100644 --- a/src/cmd/go/internal/modcmd/init.go +++ b/src/cmd/go/internal/modcmd/init.go @@ -9,7 +9,6 @@ package modcmd import ( "cmd/go/internal/base" "cmd/go/internal/modload" - "cmd/go/internal/work" "context" "os" "strings" @@ -30,7 +29,7 @@ To override this guess, supply the module path as an argument. } func init() { - work.AddModCommonFlags(cmdInit) + base.AddModCommonFlags(&cmdInit.Flag) } func runInit(ctx context.Context, cmd *base.Command, args []string) { diff --git a/src/cmd/go/internal/modcmd/tidy.go b/src/cmd/go/internal/modcmd/tidy.go index c7c53d7c0c..30df674ef6 100644 --- a/src/cmd/go/internal/modcmd/tidy.go +++ b/src/cmd/go/internal/modcmd/tidy.go @@ -10,7 +10,6 @@ import ( "cmd/go/internal/base" "cmd/go/internal/cfg" "cmd/go/internal/modload" - "cmd/go/internal/work" "context" ) @@ -32,7 +31,7 @@ to standard error. func init() { cmdTidy.Run = runTidy // break init cycle cmdTidy.Flag.BoolVar(&cfg.BuildV, "v", false, "") - work.AddModCommonFlags(cmdTidy) + base.AddModCommonFlags(&cmdTidy.Flag) } func runTidy(ctx context.Context, cmd *base.Command, args []string) { @@ -40,6 +39,18 @@ func runTidy(ctx context.Context, cmd *base.Command, args []string) { base.Fatalf("go mod tidy: no arguments allowed") } + // Tidy aims to make 'go test' reproducible for any package in 'all', so we + // need to include test dependencies. For modules that specify go 1.15 or + // earlier this is a no-op (because 'all' saturates transitive test + // dependencies). + // + // However, with lazy loading (go 1.16+) 'all' includes only the packages that + // are transitively imported by the main module, not the test dependencies of + // those packages. In order to make 'go test' reproducible for the packages + // that are in 'all' but outside of the main module, we must explicitly + // request that their test dependencies be included. + modload.LoadTests = true + modload.LoadALL(ctx) modload.TidyBuildList() modload.TrimGoSum() diff --git a/src/cmd/go/internal/modcmd/vendor.go b/src/cmd/go/internal/modcmd/vendor.go index e5353b5c7f..91d2509452 100644 --- a/src/cmd/go/internal/modcmd/vendor.go +++ b/src/cmd/go/internal/modcmd/vendor.go @@ -19,7 +19,6 @@ import ( "cmd/go/internal/cfg" "cmd/go/internal/imports" "cmd/go/internal/modload" - "cmd/go/internal/work" "golang.org/x/mod/module" "golang.org/x/mod/semver" @@ -41,7 +40,7 @@ modules and packages to standard error. func init() { cmdVendor.Flag.BoolVar(&cfg.BuildV, "v", false, "") - work.AddModCommonFlags(cmdVendor) + base.AddModCommonFlags(&cmdVendor.Flag) } func runVendor(ctx context.Context, cmd *base.Command, args []string) { @@ -77,7 +76,7 @@ func runVendor(ctx context.Context, cmd *base.Command, args []string) { } var buf bytes.Buffer - for _, m := range modload.BuildList()[1:] { + for _, m := range modload.LoadedModules()[1:] { if pkgs := modpkgs[m]; len(pkgs) > 0 || isExplicit[m] { line := moduleLine(m, modload.Replacement(m)) buf.WriteString(line) diff --git a/src/cmd/go/internal/modcmd/verify.go b/src/cmd/go/internal/modcmd/verify.go index 73ab714d10..7700588bde 100644 --- a/src/cmd/go/internal/modcmd/verify.go +++ b/src/cmd/go/internal/modcmd/verify.go @@ -17,7 +17,6 @@ import ( "cmd/go/internal/cfg" "cmd/go/internal/modfetch" "cmd/go/internal/modload" - "cmd/go/internal/work" "golang.org/x/mod/module" "golang.org/x/mod/sumdb/dirhash" @@ -38,7 +37,7 @@ non-zero status. } func init() { - work.AddModCommonFlags(cmdVerify) + base.AddModCommonFlags(&cmdVerify.Flag) } func runVerify(ctx context.Context, cmd *base.Command, args []string) { @@ -60,7 +59,7 @@ func runVerify(ctx context.Context, cmd *base.Command, args []string) { sem := make(chan token, runtime.GOMAXPROCS(0)) // Use a slice of result channels, so that the output is deterministic. - mods := modload.LoadBuildList(ctx)[1:] + mods := modload.LoadAllModules(ctx)[1:] errsChans := make([]<-chan []error, len(mods)) for i, mod := range mods { diff --git a/src/cmd/go/internal/modcmd/why.go b/src/cmd/go/internal/modcmd/why.go index da33fff89e..8454fdfec6 100644 --- a/src/cmd/go/internal/modcmd/why.go +++ b/src/cmd/go/internal/modcmd/why.go @@ -11,7 +11,6 @@ import ( "cmd/go/internal/base" "cmd/go/internal/modload" - "cmd/go/internal/work" "golang.org/x/mod/module" ) @@ -58,23 +57,26 @@ var ( func init() { cmdWhy.Run = runWhy // break init cycle - work.AddModCommonFlags(cmdWhy) + base.AddModCommonFlags(&cmdWhy.Flag) } func runWhy(ctx context.Context, cmd *base.Command, args []string) { loadALL := modload.LoadALL if *whyVendor { loadALL = modload.LoadVendor + } else { + modload.LoadTests = true } if *whyM { listU := false listVersions := false + listRetractions := false for _, arg := range args { if strings.Contains(arg, "@") { base.Fatalf("go mod why: module query not allowed") } } - mods := modload.ListModules(ctx, args, listU, listVersions) + mods := modload.ListModules(ctx, args, listU, listVersions, listRetractions) byModule := make(map[module.Version][]string) for _, path := range loadALL(ctx) { m := modload.PackageModule(path) diff --git a/src/cmd/go/internal/modfetch/fetch.go b/src/cmd/go/internal/modfetch/fetch.go index e29eb0a942..01d8f007ac 100644 --- a/src/cmd/go/internal/modfetch/fetch.go +++ b/src/cmd/go/internal/modfetch/fetch.go @@ -503,6 +503,9 @@ func checkGoMod(path, version string, data []byte) error { } // checkModSum checks that the recorded checksum for mod is h. +// +// mod.Version may have the additional suffix "/go.mod" to request the checksum +// for the module's go.mod file only. func checkModSum(mod module.Version, h string) error { // We lock goSum when manipulating it, // but we arrange to release the lock when calling checkSumDB, @@ -579,9 +582,16 @@ func addModSumLocked(mod module.Version, h string) { // checkSumDB checks the mod, h pair against the Go checksum database. // It calls base.Fatalf if the hash is to be rejected. func checkSumDB(mod module.Version, h string) error { + modWithoutSuffix := mod + noun := "module" + if strings.HasSuffix(mod.Version, "/go.mod") { + noun = "go.mod" + modWithoutSuffix.Version = strings.TrimSuffix(mod.Version, "/go.mod") + } + db, lines, err := lookupSumDB(mod) if err != nil { - return module.VersionError(mod, fmt.Errorf("verifying module: %v", err)) + return module.VersionError(modWithoutSuffix, fmt.Errorf("verifying %s: %v", noun, err)) } have := mod.Path + " " + mod.Version + " " + h @@ -591,7 +601,7 @@ func checkSumDB(mod module.Version, h string) error { return nil } if strings.HasPrefix(line, prefix) { - return module.VersionError(mod, fmt.Errorf("verifying module: checksum mismatch\n\tdownloaded: %v\n\t%s: %v"+sumdbMismatch, h, db, line[len(prefix)-len("h1:"):])) + return module.VersionError(modWithoutSuffix, fmt.Errorf("verifying %s: checksum mismatch\n\tdownloaded: %v\n\t%s: %v"+sumdbMismatch, noun, h, db, line[len(prefix)-len("h1:"):])) } } return nil diff --git a/src/cmd/go/internal/modfetch/insecure.go b/src/cmd/go/internal/modfetch/insecure.go index b692669cba..012d05f29d 100644 --- a/src/cmd/go/internal/modfetch/insecure.go +++ b/src/cmd/go/internal/modfetch/insecure.go @@ -6,12 +6,11 @@ package modfetch import ( "cmd/go/internal/cfg" - "cmd/go/internal/get" "golang.org/x/mod/module" ) // allowInsecure reports whether we are allowed to fetch this path in an insecure manner. func allowInsecure(path string) bool { - return get.Insecure || module.MatchPrefixPatterns(cfg.GOINSECURE, path) + return cfg.Insecure || module.MatchPrefixPatterns(cfg.GOINSECURE, path) } diff --git a/src/cmd/go/internal/modfetch/repo.go b/src/cmd/go/internal/modfetch/repo.go index 34f805d58a..eed4dd4258 100644 --- a/src/cmd/go/internal/modfetch/repo.go +++ b/src/cmd/go/internal/modfetch/repo.go @@ -13,9 +13,9 @@ import ( "time" "cmd/go/internal/cfg" - "cmd/go/internal/get" "cmd/go/internal/modfetch/codehost" "cmd/go/internal/par" + "cmd/go/internal/vcs" web "cmd/go/internal/web" "golang.org/x/mod/module" @@ -261,13 +261,13 @@ func lookupDirect(path string) (Repo, error) { if allowInsecure(path) { security = web.Insecure } - rr, err := get.RepoRootForImportPath(path, get.PreferMod, security) + rr, err := vcs.RepoRootForImportPath(path, vcs.PreferMod, security) if err != nil { // We don't know where to find code for a module with this path. return nil, notExistError{err: err} } - if rr.VCS == "mod" { + if rr.VCS.Name == "mod" { // Fetch module from proxy with base URL rr.Repo. return newProxyRepo(rr.Repo, path) } @@ -279,8 +279,8 @@ func lookupDirect(path string) (Repo, error) { return newCodeRepo(code, rr.Root, path) } -func lookupCodeRepo(rr *get.RepoRoot) (codehost.Repo, error) { - code, err := codehost.NewRepo(rr.VCS, rr.Repo) +func lookupCodeRepo(rr *vcs.RepoRoot) (codehost.Repo, error) { + code, err := codehost.NewRepo(rr.VCS.Cmd, rr.Repo) if err != nil { if _, ok := err.(*codehost.VCSError); ok { return nil, err @@ -306,7 +306,7 @@ func ImportRepoRev(path, rev string) (Repo, *RevInfo, error) { if allowInsecure(path) { security = web.Insecure } - rr, err := get.RepoRootForImportPath(path, get.IgnoreMod, security) + rr, err := vcs.RepoRootForImportPath(path, vcs.IgnoreMod, security) if err != nil { return nil, nil, err } diff --git a/src/cmd/go/internal/modfetch/sumdb.go b/src/cmd/go/internal/modfetch/sumdb.go index 783c4a433b..47a2571531 100644 --- a/src/cmd/go/internal/modfetch/sumdb.go +++ b/src/cmd/go/internal/modfetch/sumdb.go @@ -22,7 +22,6 @@ import ( "cmd/go/internal/base" "cmd/go/internal/cfg" - "cmd/go/internal/get" "cmd/go/internal/lockedfile" "cmd/go/internal/web" @@ -33,7 +32,7 @@ import ( // useSumDB reports whether to use the Go checksum database for the given module. func useSumDB(mod module.Version) bool { - return cfg.GOSUMDB != "off" && !get.Insecure && !module.MatchPrefixPatterns(cfg.GONOSUMDB, mod.Path) + return cfg.GOSUMDB != "off" && !cfg.Insecure && !module.MatchPrefixPatterns(cfg.GONOSUMDB, mod.Path) } // lookupSumDB returns the Go checksum database's go.sum lines for the given module, diff --git a/src/cmd/go/internal/modget/get.go b/src/cmd/go/internal/modget/get.go index ee9757912b..829cfe055a 100644 --- a/src/cmd/go/internal/modget/get.go +++ b/src/cmd/go/internal/modget/get.go @@ -17,7 +17,7 @@ import ( "sync" "cmd/go/internal/base" - "cmd/go/internal/get" + "cmd/go/internal/cfg" "cmd/go/internal/imports" "cmd/go/internal/load" "cmd/go/internal/modload" @@ -181,7 +181,7 @@ var ( getM = CmdGet.Flag.Bool("m", false, "") getT = CmdGet.Flag.Bool("t", false, "") getU upgradeFlag - // -insecure is get.Insecure + // -insecure is cfg.Insecure // -v is cfg.BuildV ) @@ -206,7 +206,7 @@ func (v *upgradeFlag) String() string { return "" } func init() { work.AddBuildFlags(CmdGet, work.OmitModFlag) CmdGet.Run = runGet // break init loop - CmdGet.Flag.BoolVar(&get.Insecure, "insecure", get.Insecure, "") + CmdGet.Flag.BoolVar(&cfg.Insecure, "insecure", cfg.Insecure, "") CmdGet.Flag.Var(&getU, "u", "") } @@ -278,7 +278,7 @@ func runGet(ctx context.Context, cmd *base.Command, args []string) { } modload.LoadTests = *getT - buildList := modload.LoadBuildList(ctx) + buildList := modload.LoadAllModules(ctx) buildList = buildList[:len(buildList):len(buildList)] // copy on append versionByPath := make(map[string]string) for _, m := range buildList { @@ -290,7 +290,7 @@ func runGet(ctx context.Context, cmd *base.Command, args []string) { // what was requested. modload.DisallowWriteGoMod() - // Allow looking up modules for import paths outside of a module. + // Allow looking up modules for import paths when outside of a module. // 'go get' is expected to do this, unlike other commands. modload.AllowMissingModuleImports() @@ -599,7 +599,7 @@ func runGet(ctx context.Context, cmd *base.Command, args []string) { base.ExitIfErrors() // Stop if no changes have been made to the build list. - buildList = modload.BuildList() + buildList = modload.LoadedModules() eq := len(buildList) == len(prevBuildList) for i := 0; eq && i < len(buildList); i++ { eq = buildList[i] == prevBuildList[i] @@ -617,7 +617,7 @@ func runGet(ctx context.Context, cmd *base.Command, args []string) { // Handle downgrades. var down []module.Version - for _, m := range modload.BuildList() { + for _, m := range modload.LoadedModules() { q := byPath[m.Path] if q != nil && semver.Compare(m.Version, q.m.Version) > 0 { down = append(down, module.Version{Path: m.Path, Version: q.m.Version}) @@ -628,6 +628,10 @@ func runGet(ctx context.Context, cmd *base.Command, args []string) { if err != nil { base.Fatalf("go: %v", err) } + + // TODO(bcmills) What should happen here under lazy loading? + // Downgrading may intentionally violate the lazy-loading invariants. + modload.SetBuildList(buildList) modload.ReloadBuildList() // note: does not update go.mod base.ExitIfErrors() @@ -637,7 +641,7 @@ func runGet(ctx context.Context, cmd *base.Command, args []string) { var lostUpgrades []*query if len(down) > 0 { versionByPath = make(map[string]string) - for _, m := range modload.BuildList() { + for _, m := range modload.LoadedModules() { versionByPath[m.Path] = m.Version } for _, q := range byPath { @@ -702,6 +706,15 @@ func runGet(ctx context.Context, cmd *base.Command, args []string) { // Everything succeeded. Update go.mod. modload.AllowWriteGoMod() modload.WriteGoMod() + modload.DisallowWriteGoMod() + + // Report warnings if any retracted versions are in the build list. + // This must be done after writing go.mod to avoid spurious '// indirect' + // comments. These functions read and write global state. + // TODO(golang.org/issue/40775): ListModules resets modload.loader, which + // contains information about direct dependencies that WriteGoMod uses. + // Refactor to avoid these kinds of global side effects. + reportRetractions(ctx) // If -d was specified, we're done after the module work. // We've already downloaded modules by loading packages above. @@ -804,6 +817,14 @@ func getQuery(ctx context.Context, path, vers string, prevM module.Version, forc base.Fatalf("go get: internal error: prevM may be set if and only if forceModulePath is set") } + // If vers is a query like "latest", we should ignore retracted and excluded + // versions. If vers refers to a specific version or commit like "v1.0.0" + // or "master", we should only ignore excluded versions. + allowed := modload.CheckAllowed + if modload.IsRevisionQuery(vers) { + allowed = modload.CheckExclusions + } + // If the query must be a module path, try only that module path. if forceModulePath { if path == modload.Target.Path { @@ -812,7 +833,7 @@ func getQuery(ctx context.Context, path, vers string, prevM module.Version, forc } } - info, err := modload.Query(ctx, path, vers, prevM.Version, modload.Allowed) + info, err := modload.Query(ctx, path, vers, prevM.Version, allowed) if err == nil { if info.Version != vers && info.Version != prevM.Version { logOncef("go: %s %s => %s", path, vers, info.Version) @@ -838,7 +859,7 @@ func getQuery(ctx context.Context, path, vers string, prevM module.Version, forc // If it turns out to only exist as a module, we can detect the resulting // PackageNotInModuleError and avoid a second round-trip through (potentially) // all of the configured proxies. - results, err := modload.QueryPattern(ctx, path, vers, modload.Allowed) + results, err := modload.QueryPattern(ctx, path, vers, allowed) if err != nil { // If the path doesn't contain a wildcard, check whether it was actually a // module path instead. If so, return that. @@ -864,190 +885,41 @@ func getQuery(ctx context.Context, path, vers string, prevM module.Version, forc return m, nil } -// An upgrader adapts an underlying mvs.Reqs to apply an -// upgrade policy to a list of targets and their dependencies. -type upgrader struct { - mvs.Reqs - - // cmdline maps a module path to a query made for that module at a - // specific target version. Each query corresponds to a module - // matched by a command line argument. - cmdline map[string]*query - - // upgrade is a set of modules providing dependencies of packages - // matched by command line arguments. If -u or -u=patch is set, - // these modules are upgraded accordingly. - upgrade map[string]bool -} - -// newUpgrader creates an upgrader. cmdline contains queries made at -// specific versions for modules matched by command line arguments. pkgs -// is the set of packages matched by command line arguments. If -u or -u=patch -// is set, modules providing dependencies of pkgs are upgraded accordingly. -func newUpgrader(cmdline map[string]*query, pkgs map[string]bool) *upgrader { - u := &upgrader{ - Reqs: modload.Reqs(), - cmdline: cmdline, - } - if getU != "" { - u.upgrade = make(map[string]bool) - - // Traverse package import graph. - // Initialize work queue with root packages. - seen := make(map[string]bool) - var work []string - add := func(path string) { - if !seen[path] { - seen[path] = true - work = append(work, path) - } - } - for pkg := range pkgs { - add(pkg) +// reportRetractions prints warnings if any modules in the build list are +// retracted. +func reportRetractions(ctx context.Context) { + // Query for retractions of modules in the build list. + // Use modload.ListModules, since that provides information in the same format + // as 'go list -m'. Don't query for "all", since that's not allowed outside a + // module. + buildList := modload.LoadedModules() + args := make([]string, 0, len(buildList)) + for _, m := range buildList { + if m.Version == "" { + // main module or dummy target module + continue } - for len(work) > 0 { - pkg := work[0] - work = work[1:] - m := modload.PackageModule(pkg) - u.upgrade[m.Path] = true - - // testImports is empty unless test imports were actually loaded, - // i.e., -t was set or "all" was one of the arguments. - imports, testImports := modload.PackageImports(pkg) - for _, imp := range imports { - add(imp) - } - for _, imp := range testImports { - add(imp) + args = append(args, m.Path+"@"+m.Version) + } + listU := false + listVersions := false + listRetractions := true + mods := modload.ListModules(ctx, args, listU, listVersions, listRetractions) + retractPath := "" + for _, mod := range mods { + if len(mod.Retracted) > 0 { + if retractPath == "" { + retractPath = mod.Path + } else { + retractPath = "<module>" } + rationale := modload.ShortRetractionRationale(mod.Retracted[0]) + logOncef("go: warning: %s@%s is retracted: %s", mod.Path, mod.Version, rationale) } } - return u -} - -// Required returns the requirement list for m. -// For the main module, we override requirements with the modules named -// one the command line, and we include new requirements. Otherwise, -// we defer to u.Reqs. -func (u *upgrader) Required(m module.Version) ([]module.Version, error) { - rs, err := u.Reqs.Required(m) - if err != nil { - return nil, err - } - if m != modload.Target { - return rs, nil - } - - overridden := make(map[string]bool) - for i, m := range rs { - if q := u.cmdline[m.Path]; q != nil && q.m.Version != "none" { - rs[i] = q.m - overridden[q.m.Path] = true - } - } - for _, q := range u.cmdline { - if !overridden[q.m.Path] && q.m.Path != modload.Target.Path && q.m.Version != "none" { - rs = append(rs, q.m) - } - } - return rs, nil -} - -// Upgrade returns the desired upgrade for m. -// -// If m was requested at a specific version on the command line, then -// Upgrade returns that version. -// -// If -u is set and m provides a dependency of a package matched by -// command line arguments, then Upgrade may provider a newer tagged version. -// If m is a tagged version, then Upgrade will return the latest tagged -// version (with the same minor version number if -u=patch). -// If m is a pseudo-version, then Upgrade returns the latest tagged version -// only if that version has a time-stamp newer than m. This special case -// prevents accidental downgrades when already using a pseudo-version -// newer than the latest tagged version. -// -// If none of the above cases apply, then Upgrade returns m. -func (u *upgrader) Upgrade(m module.Version) (module.Version, error) { - // Allow pkg@vers on the command line to override the upgrade choice v. - // If q's version is < m.Version, then we're going to downgrade anyway, - // and it's cleaner to avoid moving back and forth and picking up - // extraneous other newer dependencies. - // If q's version is > m.Version, then we're going to upgrade past - // m.Version anyway, and again it's cleaner to avoid moving back and forth - // picking up extraneous other newer dependencies. - if q := u.cmdline[m.Path]; q != nil { - return q.m, nil - } - - if !u.upgrade[m.Path] { - // Not involved in upgrade. Leave alone. - return m, nil - } - - // Run query required by upgrade semantics. - // Note that Query "latest" is not the same as using repo.Latest, - // which may return a pseudoversion for the latest commit. - // Query "latest" returns the newest tagged version or the newest - // prerelease version if there are no non-prereleases, or repo.Latest - // if there aren't any tagged versions. - // If we're querying "upgrade" or "patch", Query will compare the current - // version against the chosen version and will return the current version - // if it is newer. - info, err := modload.Query(context.TODO(), m.Path, string(getU), m.Version, modload.Allowed) - if err != nil { - // Report error but return m, to let version selection continue. - // (Reporting the error will fail the command at the next base.ExitIfErrors.) - - // Special case: if the error is for m.Version itself and m.Version has a - // replacement, then keep it and don't report the error: the fact that the - // version is invalid is likely the reason it was replaced to begin with. - var vErr *module.InvalidVersionError - if errors.As(err, &vErr) && vErr.Version == m.Version && modload.Replacement(m).Path != "" { - return m, nil - } - - // Special case: if the error is "no matching versions" then don't - // even report the error. Because Query does not consider pseudo-versions, - // it may happen that we have a pseudo-version but during -u=patch - // the query v0.0 matches no versions (not even the one we're using). - var noMatch *modload.NoMatchingVersionError - if !errors.As(err, &noMatch) { - base.Errorf("go get: upgrading %s@%s: %v", m.Path, m.Version, err) - } - return m, nil - } - - if info.Version != m.Version { - logOncef("go: %s %s => %s", m.Path, getU, info.Version) - } - return module.Version{Path: m.Path, Version: info.Version}, nil -} - -// buildListForLostUpgrade returns the build list for the module graph -// rooted at lost. Unlike mvs.BuildList, the target module (lost) is not -// treated specially. The returned build list may contain a newer version -// of lost. -// -// buildListForLostUpgrade is used after a downgrade has removed a module -// requested at a specific version. This helps us understand the requirements -// implied by each downgrade. -func buildListForLostUpgrade(lost module.Version, reqs mvs.Reqs) ([]module.Version, error) { - return mvs.BuildList(lostUpgradeRoot, &lostUpgradeReqs{Reqs: reqs, lost: lost}) -} - -var lostUpgradeRoot = module.Version{Path: "lost-upgrade-root", Version: ""} - -type lostUpgradeReqs struct { - mvs.Reqs - lost module.Version -} - -func (r *lostUpgradeReqs) Required(mod module.Version) ([]module.Version, error) { - if mod == lostUpgradeRoot { - return []module.Version{r.lost}, nil + if modload.HasModRoot() && retractPath != "" { + logOncef("go: run 'go get %s@latest' to switch to the latest unretracted version", retractPath) } - return r.Reqs.Required(mod) } var loggedLines sync.Map diff --git a/src/cmd/go/internal/modget/mvs.go b/src/cmd/go/internal/modget/mvs.go new file mode 100644 index 0000000000..19fffd2947 --- /dev/null +++ b/src/cmd/go/internal/modget/mvs.go @@ -0,0 +1,202 @@ +// Copyright 2020 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package modget + +import ( + "context" + "errors" + + "cmd/go/internal/base" + "cmd/go/internal/modload" + "cmd/go/internal/mvs" + + "golang.org/x/mod/module" +) + +// An upgrader adapts an underlying mvs.Reqs to apply an +// upgrade policy to a list of targets and their dependencies. +type upgrader struct { + mvs.Reqs + + // cmdline maps a module path to a query made for that module at a + // specific target version. Each query corresponds to a module + // matched by a command line argument. + cmdline map[string]*query + + // upgrade is a set of modules providing dependencies of packages + // matched by command line arguments. If -u or -u=patch is set, + // these modules are upgraded accordingly. + upgrade map[string]bool +} + +// newUpgrader creates an upgrader. cmdline contains queries made at +// specific versions for modules matched by command line arguments. pkgs +// is the set of packages matched by command line arguments. If -u or -u=patch +// is set, modules providing dependencies of pkgs are upgraded accordingly. +func newUpgrader(cmdline map[string]*query, pkgs map[string]bool) *upgrader { + u := &upgrader{ + Reqs: modload.Reqs(), + cmdline: cmdline, + } + if getU != "" { + u.upgrade = make(map[string]bool) + + // Traverse package import graph. + // Initialize work queue with root packages. + seen := make(map[string]bool) + var work []string + add := func(path string) { + if !seen[path] { + seen[path] = true + work = append(work, path) + } + } + for pkg := range pkgs { + add(pkg) + } + for len(work) > 0 { + pkg := work[0] + work = work[1:] + m := modload.PackageModule(pkg) + u.upgrade[m.Path] = true + + // testImports is empty unless test imports were actually loaded, + // i.e., -t was set or "all" was one of the arguments. + imports, testImports := modload.PackageImports(pkg) + for _, imp := range imports { + add(imp) + } + for _, imp := range testImports { + add(imp) + } + } + } + return u +} + +// Required returns the requirement list for m. +// For the main module, we override requirements with the modules named +// one the command line, and we include new requirements. Otherwise, +// we defer to u.Reqs. +func (u *upgrader) Required(m module.Version) ([]module.Version, error) { + rs, err := u.Reqs.Required(m) + if err != nil { + return nil, err + } + if m != modload.Target { + return rs, nil + } + + overridden := make(map[string]bool) + for i, m := range rs { + if q := u.cmdline[m.Path]; q != nil && q.m.Version != "none" { + rs[i] = q.m + overridden[q.m.Path] = true + } + } + for _, q := range u.cmdline { + if !overridden[q.m.Path] && q.m.Path != modload.Target.Path && q.m.Version != "none" { + rs = append(rs, q.m) + } + } + return rs, nil +} + +// Upgrade returns the desired upgrade for m. +// +// If m was requested at a specific version on the command line, then +// Upgrade returns that version. +// +// If -u is set and m provides a dependency of a package matched by +// command line arguments, then Upgrade may provider a newer tagged version. +// If m is a tagged version, then Upgrade will return the latest tagged +// version (with the same minor version number if -u=patch). +// If m is a pseudo-version, then Upgrade returns the latest tagged version +// only if that version has a time-stamp newer than m. This special case +// prevents accidental downgrades when already using a pseudo-version +// newer than the latest tagged version. +// +// If none of the above cases apply, then Upgrade returns m. +func (u *upgrader) Upgrade(m module.Version) (module.Version, error) { + // Allow pkg@vers on the command line to override the upgrade choice v. + // If q's version is < m.Version, then we're going to downgrade anyway, + // and it's cleaner to avoid moving back and forth and picking up + // extraneous other newer dependencies. + // If q's version is > m.Version, then we're going to upgrade past + // m.Version anyway, and again it's cleaner to avoid moving back and forth + // picking up extraneous other newer dependencies. + if q := u.cmdline[m.Path]; q != nil { + return q.m, nil + } + + if !u.upgrade[m.Path] { + // Not involved in upgrade. Leave alone. + return m, nil + } + + // Run query required by upgrade semantics. + // Note that Query "latest" is not the same as using repo.Latest, + // which may return a pseudoversion for the latest commit. + // Query "latest" returns the newest tagged version or the newest + // prerelease version if there are no non-prereleases, or repo.Latest + // if there aren't any tagged versions. + // If we're querying "upgrade" or "patch", Query will compare the current + // version against the chosen version and will return the current version + // if it is newer. + info, err := modload.Query(context.TODO(), m.Path, string(getU), m.Version, modload.CheckAllowed) + if err != nil { + // Report error but return m, to let version selection continue. + // (Reporting the error will fail the command at the next base.ExitIfErrors.) + + // Special case: if the error is for m.Version itself and m.Version has a + // replacement, then keep it and don't report the error: the fact that the + // version is invalid is likely the reason it was replaced to begin with. + var vErr *module.InvalidVersionError + if errors.As(err, &vErr) && vErr.Version == m.Version && modload.Replacement(m).Path != "" { + return m, nil + } + + // Special case: if the error is "no matching versions" then don't + // even report the error. Because Query does not consider pseudo-versions, + // it may happen that we have a pseudo-version but during -u=patch + // the query v0.0 matches no versions (not even the one we're using). + var noMatch *modload.NoMatchingVersionError + if !errors.As(err, &noMatch) { + base.Errorf("go get: upgrading %s@%s: %v", m.Path, m.Version, err) + } + return m, nil + } + + if info.Version != m.Version { + logOncef("go: %s %s => %s", m.Path, getU, info.Version) + } + return module.Version{Path: m.Path, Version: info.Version}, nil +} + +// buildListForLostUpgrade returns the build list for the module graph +// rooted at lost. Unlike mvs.BuildList, the target module (lost) is not +// treated specially. The returned build list may contain a newer version +// of lost. +// +// buildListForLostUpgrade is used after a downgrade has removed a module +// requested at a specific version. This helps us understand the requirements +// implied by each downgrade. +func buildListForLostUpgrade(lost module.Version, reqs mvs.Reqs) ([]module.Version, error) { + return mvs.BuildList(lostUpgradeRoot, &lostUpgradeReqs{Reqs: reqs, lost: lost}) +} + +var lostUpgradeRoot = module.Version{Path: "lost-upgrade-root", Version: ""} + +type lostUpgradeReqs struct { + mvs.Reqs + lost module.Version +} + +func (r *lostUpgradeReqs) Required(mod module.Version) ([]module.Version, error) { + if mod == lostUpgradeRoot { + return []module.Version{r.lost}, nil + } + return r.Reqs.Required(mod) +} diff --git a/src/cmd/go/internal/modinfo/info.go b/src/cmd/go/internal/modinfo/info.go index 07248d1a61..897be56397 100644 --- a/src/cmd/go/internal/modinfo/info.go +++ b/src/cmd/go/internal/modinfo/info.go @@ -21,6 +21,7 @@ type ModulePublic struct { Dir string `json:",omitempty"` // directory holding local copy of files, if any GoMod string `json:",omitempty"` // path to go.mod file describing module, if any GoVersion string `json:",omitempty"` // go version used in module + Retracted []string `json:",omitempty"` // retraction information, if any (with -retracted or -u) Error *ModuleError `json:",omitempty"` // error loading module } @@ -30,18 +31,26 @@ type ModuleError struct { func (m *ModulePublic) String() string { s := m.Path + versionString := func(mm *ModulePublic) string { + v := mm.Version + if len(mm.Retracted) == 0 { + return v + } + return v + " (retracted)" + } + if m.Version != "" { - s += " " + m.Version + s += " " + versionString(m) if m.Update != nil { - s += " [" + m.Update.Version + "]" + s += " [" + versionString(m.Update) + "]" } } if m.Replace != nil { s += " => " + m.Replace.Path if m.Replace.Version != "" { - s += " " + m.Replace.Version + s += " " + versionString(m.Replace) if m.Replace.Update != nil { - s += " [" + m.Replace.Update.Version + "]" + s += " [" + versionString(m.Replace.Update) + "]" } } } diff --git a/src/cmd/go/internal/modload/build.go b/src/cmd/go/internal/modload/build.go index a101681a1f..9ca6230500 100644 --- a/src/cmd/go/internal/modload/build.go +++ b/src/cmd/go/internal/modload/build.go @@ -8,6 +8,7 @@ import ( "bytes" "context" "encoding/hex" + "errors" "fmt" "internal/goroot" "os" @@ -58,7 +59,9 @@ func PackageModuleInfo(pkgpath string) *modinfo.ModulePublic { if !ok { return nil } - return moduleInfo(context.TODO(), m, true) + fromBuildList := true + listRetracted := false + return moduleInfo(context.TODO(), m, fromBuildList, listRetracted) } func ModuleInfo(ctx context.Context, path string) *modinfo.ModulePublic { @@ -66,13 +69,17 @@ func ModuleInfo(ctx context.Context, path string) *modinfo.ModulePublic { return nil } + listRetracted := false if i := strings.Index(path, "@"); i >= 0 { - return moduleInfo(ctx, module.Version{Path: path[:i], Version: path[i+1:]}, false) + m := module.Version{Path: path[:i], Version: path[i+1:]} + fromBuildList := false + return moduleInfo(ctx, m, fromBuildList, listRetracted) } - for _, m := range BuildList() { + for _, m := range LoadedModules() { if m.Path == path { - return moduleInfo(ctx, m, true) + fromBuildList := true + return moduleInfo(ctx, m, fromBuildList, listRetracted) } } @@ -90,7 +97,7 @@ func addUpdate(ctx context.Context, m *modinfo.ModulePublic) { return } - if info, err := Query(ctx, m.Path, "upgrade", m.Version, Allowed); err == nil && semver.Compare(info.Version, m.Version) > 0 { + if info, err := Query(ctx, m.Path, "upgrade", m.Version, CheckAllowed); err == nil && semver.Compare(info.Version, m.Version) > 0 { m.Update = &modinfo.ModulePublic{ Path: m.Path, Version: info.Version, @@ -100,11 +107,37 @@ func addUpdate(ctx context.Context, m *modinfo.ModulePublic) { } // addVersions fills in m.Versions with the list of known versions. -func addVersions(m *modinfo.ModulePublic) { - m.Versions, _ = versions(m.Path) +// Excluded versions will be omitted. If listRetracted is false, retracted +// versions will also be omitted. +func addVersions(ctx context.Context, m *modinfo.ModulePublic, listRetracted bool) { + allowed := CheckAllowed + if listRetracted { + allowed = CheckExclusions + } + m.Versions, _ = versions(ctx, m.Path, allowed) } -func moduleInfo(ctx context.Context, m module.Version, fromBuildList bool) *modinfo.ModulePublic { +// addRetraction fills in m.Retracted if the module was retracted by its author. +// m.Error is set if there's an error loading retraction information. +func addRetraction(ctx context.Context, m *modinfo.ModulePublic) { + if m.Version == "" { + return + } + + err := checkRetractions(ctx, module.Version{Path: m.Path, Version: m.Version}) + var rerr *retractedError + if errors.As(err, &rerr) { + if len(rerr.rationale) == 0 { + m.Retracted = []string{"retracted by module author"} + } else { + m.Retracted = rerr.rationale + } + } else if err != nil && m.Error == nil { + m.Error = &modinfo.ModuleError{Err: err.Error()} + } +} + +func moduleInfo(ctx context.Context, m module.Version, fromBuildList, listRetracted bool) *modinfo.ModulePublic { if m == Target { info := &modinfo.ModulePublic{ Path: m.Path, @@ -126,12 +159,14 @@ func moduleInfo(ctx context.Context, m module.Version, fromBuildList bool) *modi Version: m.Version, Indirect: fromBuildList && loaded != nil && !loaded.direct[m.Path], } - if loaded != nil { - info.GoVersion = loaded.goVersion[m.Path] + if v, ok := rawGoVersion.Load(m); ok { + info.GoVersion = v.(string) } // completeFromModCache fills in the extra fields in m using the module cache. completeFromModCache := func(m *modinfo.ModulePublic) { + mod := module.Version{Path: m.Path, Version: m.Version} + if m.Version != "" { if q, err := Query(ctx, m.Path, m.Version, "", nil); err != nil { m.Error = &modinfo.ModuleError{Err: err.Error()} @@ -140,7 +175,6 @@ func moduleInfo(ctx context.Context, m module.Version, fromBuildList bool) *modi m.Time = &q.Time } - mod := module.Version{Path: m.Path, Version: m.Version} gomod, err := modfetch.CachePath(mod, "mod") if err == nil { if info, err := os.Stat(gomod); err == nil && info.Mode().IsRegular() { @@ -151,10 +185,22 @@ func moduleInfo(ctx context.Context, m module.Version, fromBuildList bool) *modi if err == nil { m.Dir = dir } + + if listRetracted { + addRetraction(ctx, m) + } + } + + if m.GoVersion == "" { + if summary, err := rawGoModSummary(mod); err == nil && summary.goVersionV != "" { + m.GoVersion = summary.goVersionV[1:] + } } } if !fromBuildList { + // If this was an explicitly-versioned argument to 'go mod download' or + // 'go list -m', report the actual requested version, not its replacement. completeFromModCache(info) // Will set m.Error in vendor mode. return info } @@ -178,9 +224,11 @@ func moduleInfo(ctx context.Context, m module.Version, fromBuildList bool) *modi // worth the cost, and we're going to overwrite the GoMod and Dir from the // replacement anyway. See https://golang.org/issue/27859. info.Replace = &modinfo.ModulePublic{ - Path: r.Path, - Version: r.Version, - GoVersion: info.GoVersion, + Path: r.Path, + Version: r.Version, + } + if v, ok := rawGoVersion.Load(m); ok { + info.Replace.GoVersion = v.(string) } if r.Version == "" { if filepath.IsAbs(r.Path) { @@ -194,7 +242,9 @@ func moduleInfo(ctx context.Context, m module.Version, fromBuildList bool) *modi completeFromModCache(info.Replace) info.Dir = info.Replace.Dir info.GoMod = info.Replace.GoMod + info.Retracted = info.Replace.Retracted } + info.GoVersion = info.Replace.GoVersion return info } diff --git a/src/cmd/go/internal/modload/buildlist.go b/src/cmd/go/internal/modload/buildlist.go new file mode 100644 index 0000000000..581a1b944a --- /dev/null +++ b/src/cmd/go/internal/modload/buildlist.go @@ -0,0 +1,122 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package modload + +import ( + "cmd/go/internal/base" + "cmd/go/internal/cfg" + "cmd/go/internal/imports" + "cmd/go/internal/mvs" + "context" + "fmt" + "os" + + "golang.org/x/mod/module" +) + +// buildList is the list of modules to use for building packages. +// It is initialized by calling ImportPaths, ImportFromFiles, +// LoadALL, or LoadBuildList, each of which uses loaded.load. +// +// Ideally, exactly ONE of those functions would be called, +// and exactly once. Most of the time, that's true. +// During "go get" it may not be. TODO(rsc): Figure out if +// that restriction can be established, or else document why not. +// +var buildList []module.Version + +// LoadAllModules loads and returns the list of modules matching the "all" +// module pattern, starting with the Target module and in a deterministic +// (stable) order, without loading any packages. +// +// Modules are loaded automatically (and lazily) in ImportPaths: +// LoadAllModules need only be called if ImportPaths is not, +// typically in commands that care about modules but no particular package. +// +// The caller must not modify the returned list. +func LoadAllModules(ctx context.Context) []module.Version { + InitMod(ctx) + ReloadBuildList() + WriteGoMod() + return buildList +} + +// LoadedModules returns the list of module requirements loaded or set by a +// previous call (typically LoadAllModules or ImportPaths), starting with the +// Target module and in a deterministic (stable) order. +// +// The caller must not modify the returned list. +func LoadedModules() []module.Version { + return buildList +} + +// SetBuildList sets the module build list. +// The caller is responsible for ensuring that the list is valid. +// SetBuildList does not retain a reference to the original list. +func SetBuildList(list []module.Version) { + buildList = append([]module.Version{}, list...) +} + +// ReloadBuildList resets the state of loaded packages, then loads and returns +// the build list set in SetBuildList. +func ReloadBuildList() []module.Version { + loaded = loadFromRoots(loaderParams{ + tags: imports.Tags(), + listRoots: func() []string { return nil }, + allClosesOverTests: index.allPatternClosesOverTests(), // but doesn't matter because the root list is empty. + }) + return buildList +} + +// TidyBuildList trims the build list to the minimal requirements needed to +// retain the same versions of all packages from the preceding Load* or +// ImportPaths* call. +func TidyBuildList() { + used := map[module.Version]bool{Target: true} + for _, pkg := range loaded.pkgs { + used[pkg.mod] = true + } + + keep := []module.Version{Target} + var direct []string + for _, m := range buildList[1:] { + if used[m] { + keep = append(keep, m) + if loaded.direct[m.Path] { + direct = append(direct, m.Path) + } + } else if cfg.BuildV { + if _, ok := index.require[m]; ok { + fmt.Fprintf(os.Stderr, "unused %s\n", m.Path) + } + } + } + + min, err := mvs.Req(Target, direct, &mvsReqs{buildList: keep}) + if err != nil { + base.Fatalf("go: %v", err) + } + buildList = append([]module.Version{Target}, min...) +} + +// checkMultiplePaths verifies that a given module path is used as itself +// or as a replacement for another module, but not both at the same time. +// +// (See https://golang.org/issue/26607 and https://golang.org/issue/34650.) +func checkMultiplePaths() { + firstPath := make(map[module.Version]string, len(buildList)) + for _, mod := range buildList { + src := mod + if rep := Replacement(mod); rep.Path != "" { + src = rep + } + if prev, ok := firstPath[src]; !ok { + firstPath[src] = mod.Path + } else if prev != mod.Path { + base.Errorf("go: %s@%s used for two different module paths (%s and %s)", src.Path, src.Version, prev, mod.Path) + } + } + base.ExitIfErrors() +} diff --git a/src/cmd/go/internal/modload/help.go b/src/cmd/go/internal/modload/help.go index d80206b194..37f23d967f 100644 --- a/src/cmd/go/internal/modload/help.go +++ b/src/cmd/go/internal/modload/help.go @@ -432,15 +432,17 @@ verb followed by arguments. For example: require new/thing/v2 v2.3.4 exclude old/thing v1.2.3 replace bad/thing v1.4.5 => good/thing v1.4.5 + retract v1.5.6 The verbs are module, to define the module path; go, to set the expected language version; require, to require a particular module at a given version or later; - exclude, to exclude a particular module version from use; and - replace, to replace a module version with a different module version. + exclude, to exclude a particular module version from use; + replace, to replace a module version with a different module version; and + retract, to indicate a previously released version should not be used. Exclude and replace apply only in the main module's go.mod and are ignored -in dependencies. See https://research.swtch.com/vgo-mvs for details. +in dependencies. See https://golang.org/ref/mod for details. The leading verb can be factored out of adjacent lines to create a block, like in Go imports: diff --git a/src/cmd/go/internal/modload/import.go b/src/cmd/go/internal/modload/import.go index 5c51a79124..10b1e7f4b8 100644 --- a/src/cmd/go/internal/modload/import.go +++ b/src/cmd/go/internal/modload/import.go @@ -26,6 +26,8 @@ import ( "golang.org/x/mod/semver" ) +var errImportMissing = errors.New("import missing") + type ImportMissingError struct { Path string Module module.Version @@ -48,6 +50,11 @@ func (e *ImportMissingError) Error() string { } return "cannot find module providing package " + e.Path } + + if e.newMissingVersion != "" { + return fmt.Sprintf("package %s provided by %s at latest version %s but not at required version %s", e.Path, e.Module.Path, e.Module.Version, e.newMissingVersion) + } + return fmt.Sprintf("missing module for import: %s@%s provides %s", e.Module.Path, e.Module.Version, e.Path) } @@ -100,18 +107,39 @@ func (e *AmbiguousImportError) Error() string { var _ load.ImportPathError = &AmbiguousImportError{} -// Import finds the module and directory in the build list -// containing the package with the given import path. -// The answer must be unique: Import returns an error -// if multiple modules attempt to provide the same package. -// Import can return a module with an empty m.Path, for packages in the standard library. -// Import can return an empty directory string, for fake packages like "C" and "unsafe". +type invalidImportError struct { + importPath string + err error +} + +func (e *invalidImportError) ImportPath() string { + return e.importPath +} + +func (e *invalidImportError) Error() string { + return e.err.Error() +} + +func (e *invalidImportError) Unwrap() error { + return e.err +} + +var _ load.ImportPathError = &invalidImportError{} + +// importFromBuildList finds the module and directory in the build list +// containing the package with the given import path. The answer must be unique: +// importFromBuildList returns an error if multiple modules attempt to provide +// the same package. +// +// importFromBuildList can return a module with an empty m.Path, for packages in +// the standard library. +// +// importFromBuildList can return an empty directory string, for fake packages +// like "C" and "unsafe". // // If the package cannot be found in the current build list, -// Import returns an ImportMissingError as the error. -// If Import can identify a module that could be added to supply the package, -// the ImportMissingError records that module. -func Import(ctx context.Context, path string) (m module.Version, dir string, err error) { +// importFromBuildList returns errImportMissing as the error. +func importFromBuildList(ctx context.Context, path string) (m module.Version, dir string, err error) { if strings.Contains(path, "@") { return module.Version{}, "", fmt.Errorf("import path should not have @version") } @@ -190,29 +218,25 @@ func Import(ctx context.Context, path string) (m module.Version, dir string, err return module.Version{}, "", &AmbiguousImportError{importPath: path, Dirs: dirs, Modules: mods} } - // Look up module containing the package, for addition to the build list. - // Goal is to determine the module, download it to dir, and return m, dir, ErrMissing. - if cfg.BuildMod == "readonly" { - var queryErr error - if !pathIsStd { - if cfg.BuildModReason == "" { - queryErr = fmt.Errorf("import lookup disabled by -mod=%s", cfg.BuildMod) - } else { - queryErr = fmt.Errorf("import lookup disabled by -mod=%s\n\t(%s)", cfg.BuildMod, cfg.BuildModReason) - } - } - return module.Version{}, "", &ImportMissingError{Path: path, QueryErr: queryErr} - } + return module.Version{}, "", errImportMissing +} + +// queryImport attempts to locate a module that can be added to the current +// build list to provide the package with the given import path. +func queryImport(ctx context.Context, path string) (module.Version, error) { + pathIsStd := search.IsStandardImportPath(path) + if modRoot == "" && !allowMissingModuleImports { - return module.Version{}, "", &ImportMissingError{ + return module.Version{}, &ImportMissingError{ Path: path, QueryErr: errors.New("working directory is not part of a module"), } } // Not on build list. - // To avoid spurious remote fetches, next try the latest replacement for each module. - // (golang.org/issue/26241) + // To avoid spurious remote fetches, next try the latest replacement for each + // module (golang.org/issue/26241). This should give a useful message + // in -mod=readonly, and it will allow us to add a requirement with -mod=mod. if modFile != nil { latest := map[string]string{} // path -> version for _, r := range modFile.Replace { @@ -226,7 +250,7 @@ func Import(ctx context.Context, path string) (m module.Version, dir string, err } } - mods = make([]module.Version, 0, len(latest)) + mods := make([]module.Version, 0, len(latest)) for p, v := range latest { // If the replacement didn't specify a version, synthesize a // pseudo-version with an appropriate major version and a timestamp below @@ -252,19 +276,19 @@ func Import(ctx context.Context, path string) (m module.Version, dir string, err root, isLocal, err := fetch(ctx, m) if err != nil { // Report fetch error as above. - return module.Version{}, "", err + return module.Version{}, err } if _, ok, err := dirInModule(path, m.Path, root, isLocal); err != nil { - return m, "", err + return m, err } else if ok { - return m, "", &ImportMissingError{Path: path, Module: m} + return m, nil } } if len(mods) > 0 && module.CheckPath(path) != nil { // The package path is not valid to fetch remotely, // so it can only exist if in a replaced module, // and we know from the above loop that it is not. - return module.Version{}, "", &PackageNotInModuleError{ + return module.Version{}, &PackageNotInModuleError{ Mod: mods[0], Query: "latest", Pattern: path, @@ -273,6 +297,11 @@ func Import(ctx context.Context, path string) (m module.Version, dir string, err } } + // Before any further lookup, check that the path is valid. + if err := module.CheckImportPath(path); err != nil { + return module.Version{}, &invalidImportError{importPath: path, err: err} + } + if pathIsStd { // This package isn't in the standard library, isn't in any module already // in the build list, and isn't in any other module that the user has @@ -281,25 +310,39 @@ func Import(ctx context.Context, path string) (m module.Version, dir string, err // QueryPackage cannot possibly find a module containing this package. // // Instead of trying QueryPackage, report an ImportMissingError immediately. - return module.Version{}, "", &ImportMissingError{Path: path} + return module.Version{}, &ImportMissingError{Path: path} + } + + if cfg.BuildMod == "readonly" { + var queryErr error + if cfg.BuildModExplicit { + queryErr = fmt.Errorf("import lookup disabled by -mod=%s", cfg.BuildMod) + } else if cfg.BuildModReason != "" { + queryErr = fmt.Errorf("import lookup disabled by -mod=%s\n\t(%s)", cfg.BuildMod, cfg.BuildModReason) + } + return module.Version{}, &ImportMissingError{Path: path, QueryErr: queryErr} } + // Look up module containing the package, for addition to the build list. + // Goal is to determine the module, download it to dir, + // and return m, dir, ImpportMissingError. fmt.Fprintf(os.Stderr, "go: finding module for package %s\n", path) - candidates, err := QueryPackage(ctx, path, "latest", Allowed) + candidates, err := QueryPackage(ctx, path, "latest", CheckAllowed) if err != nil { if errors.Is(err, os.ErrNotExist) { // Return "cannot find module providing package […]" instead of whatever // low-level error QueryPackage produced. - return module.Version{}, "", &ImportMissingError{Path: path, QueryErr: err} + return module.Version{}, &ImportMissingError{Path: path, QueryErr: err} } else { - return module.Version{}, "", err + return module.Version{}, err } } - m = candidates[0].Mod - newMissingVersion := "" - for _, c := range candidates { + + candidate0MissingVersion := "" + for i, c := range candidates { cm := c.Mod + canAdd := true for _, bm := range buildList { if bm.Path == cm.Path && semver.Compare(bm.Version, cm.Version) > 0 { // QueryPackage proposed that we add module cm to provide the package, @@ -310,13 +353,22 @@ func Import(ctx context.Context, path string) (m module.Version, dir string, err // version (e.g., v1.0.0) of a module, but we have a newer version // of the same module in the build list (e.g., v1.0.1-beta), and // the package is not present there. - m = cm - newMissingVersion = bm.Version + canAdd = false + if i == 0 { + candidate0MissingVersion = bm.Version + } break } } + if canAdd { + return cm, nil + } + } + return module.Version{}, &ImportMissingError{ + Path: path, + Module: candidates[0].Mod, + newMissingVersion: candidate0MissingVersion, } - return m, "", &ImportMissingError{Path: path, Module: m, newMissingVersion: newMissingVersion} } // maybeInModule reports whether, syntactically, diff --git a/src/cmd/go/internal/modload/import_test.go b/src/cmd/go/internal/modload/import_test.go index 47ce89a084..22d5b82e21 100644 --- a/src/cmd/go/internal/modload/import_test.go +++ b/src/cmd/go/internal/modload/import_test.go @@ -10,15 +10,20 @@ import ( "regexp" "strings" "testing" + + "golang.org/x/mod/module" ) var importTests = []struct { path string + m module.Version err string }{ { path: "golang.org/x/net/context", - err: "missing module for import: golang.org/x/net@.* provides golang.org/x/net/context", + m: module.Version{ + Path: "golang.org/x/net", + }, }, { path: "golang.org/x/net", @@ -26,15 +31,23 @@ var importTests = []struct { }, { path: "golang.org/x/text", - err: "missing module for import: golang.org/x/text@.* provides golang.org/x/text", + m: module.Version{ + Path: "golang.org/x/text", + }, }, { path: "github.com/rsc/quote/buggy", - err: "missing module for import: github.com/rsc/quote@v1.5.2 provides github.com/rsc/quote/buggy", + m: module.Version{ + Path: "github.com/rsc/quote", + Version: "v1.5.2", + }, }, { path: "github.com/rsc/quote", - err: "missing module for import: github.com/rsc/quote@v1.5.2 provides github.com/rsc/quote", + m: module.Version{ + Path: "github.com/rsc/quote", + Version: "v1.5.2", + }, }, { path: "golang.org/x/foo/bar", @@ -42,7 +55,7 @@ var importTests = []struct { }, } -func TestImport(t *testing.T) { +func TestQueryImport(t *testing.T) { testenv.MustHaveExternalNetwork(t) testenv.MustHaveExecPath(t, "git") defer func(old bool) { @@ -55,12 +68,23 @@ func TestImport(t *testing.T) { for _, tt := range importTests { t.Run(strings.ReplaceAll(tt.path, "/", "_"), func(t *testing.T) { // Note that there is no build list, so Import should always fail. - m, dir, err := Import(ctx, tt.path) - if err == nil { - t.Fatalf("Import(%q) = %v, %v, nil; expected error", tt.path, m, dir) + m, err := queryImport(ctx, tt.path) + + if tt.err == "" { + if err != nil { + t.Fatalf("queryImport(_, %q): %v", tt.path, err) + } + } else { + if err == nil { + t.Fatalf("queryImport(_, %q) = %v, nil; expected error", tt.path, m) + } + if !regexp.MustCompile(tt.err).MatchString(err.Error()) { + t.Fatalf("queryImport(_, %q): error %q, want error matching %#q", tt.path, err, tt.err) + } } - if !regexp.MustCompile(tt.err).MatchString(err.Error()) { - t.Fatalf("Import(%q): error %q, want error matching %#q", tt.path, err, tt.err) + + if m.Path != tt.m.Path || (tt.m.Version != "" && m.Version != tt.m.Version) { + t.Errorf("queryImport(_, %q) = %v, _; want %v", tt.path, m, tt.m) } }) } diff --git a/src/cmd/go/internal/modload/init.go b/src/cmd/go/internal/modload/init.go index 93027c44c4..1f50dcb11c 100644 --- a/src/cmd/go/internal/modload/init.go +++ b/src/cmd/go/internal/modload/init.go @@ -368,13 +368,9 @@ func InitMod(ctx context.Context) { modFile = f index = indexModFile(data, f, fixed) - if len(f.Syntax.Stmt) == 0 || f.Module == nil { - // Empty mod file. Must add module path. - path, err := findModulePath(modRoot) - if err != nil { - base.Fatalf("go: %v", err) - } - f.AddModuleStmt(path) + if f.Module == nil { + // No module declaration. Must add module path. + base.Fatalf("go: no module declaration in go.mod.\n\tRun 'go mod edit -module=example.com/mod' to specify the module path.") } if len(f.Syntax.Stmt) == 1 && f.Module != nil { @@ -383,14 +379,61 @@ func InitMod(ctx context.Context) { legacyModInit() } - modFileToBuildList() + if err := checkModulePathLax(f.Module.Mod.Path); err != nil { + base.Fatalf("go: %v", err) + } + setDefaultBuildMod() + modFileToBuildList() if cfg.BuildMod == "vendor" { readVendorList() checkVendorConsistency() } } +// checkModulePathLax checks that the path meets some minimum requirements +// to avoid confusing users or the module cache. The requirements are weaker +// than those of module.CheckPath to allow room for weakening module path +// requirements in the future, but strong enough to help users avoid significant +// problems. +func checkModulePathLax(p string) error { + // TODO(matloob): Replace calls of this function in this CL with calls + // to module.CheckImportPath once it's been laxened, if it becomes laxened. + // See golang.org/issue/29101 for a discussion about whether to make CheckImportPath + // more lax or more strict. + + errorf := func(format string, args ...interface{}) error { + return fmt.Errorf("invalid module path %q: %s", p, fmt.Sprintf(format, args...)) + } + + // Disallow shell characters " ' * < > ? ` | to avoid triggering bugs + // with file systems and subcommands. Disallow file path separators : and \ + // because path separators other than / will confuse the module cache. + // See fileNameOK in golang.org/x/mod/module/module.go. + shellChars := "`" + `\"'*<>?|` + fsChars := `\:` + if i := strings.IndexAny(p, shellChars); i >= 0 { + return errorf("contains disallowed shell character %q", p[i]) + } + if i := strings.IndexAny(p, fsChars); i >= 0 { + return errorf("contains disallowed path separator character %q", p[i]) + } + + // Ensure path.IsAbs and build.IsLocalImport are false, and that the path is + // invariant under path.Clean, also to avoid confusing the module cache. + if path.IsAbs(p) { + return errorf("is an absolute path") + } + if build.IsLocalImport(p) { + return errorf("is a local import path") + } + if path.Clean(p) != p { + return errorf("is not clean") + } + + return nil +} + // fixVersion returns a modfile.VersionFixer implemented using the Query function. // // It resolves commit hashes and branch names to versions, @@ -459,7 +502,15 @@ func modFileToBuildList() { list := []module.Version{Target} for _, r := range modFile.Require { - list = append(list, r.Mod) + if index != nil && index.exclude[r.Mod] { + if cfg.BuildMod == "mod" { + fmt.Fprintf(os.Stderr, "go: dropping requirement on excluded version %s %s\n", r.Mod.Path, r.Mod.Version) + } else { + fmt.Fprintf(os.Stderr, "go: ignoring requirement on excluded version %s %s\n", r.Mod.Path, r.Mod.Version) + } + } else { + list = append(list, r.Mod) + } } buildList = list } @@ -467,46 +518,49 @@ func modFileToBuildList() { // setDefaultBuildMod sets a default value for cfg.BuildMod // if it is currently empty. func setDefaultBuildMod() { - if cfg.BuildMod != "" { + if cfg.BuildModExplicit { // Don't override an explicit '-mod=' argument. return } - cfg.BuildMod = "mod" + if cfg.CmdName == "get" || strings.HasPrefix(cfg.CmdName, "mod ") { - // Don't set -mod implicitly for commands whose purpose is to - // manipulate the build list. + // 'get' and 'go mod' commands may update go.mod automatically. + // TODO(jayconrod): should this narrower? Should 'go mod download' or + // 'go mod graph' update go.mod by default? + cfg.BuildMod = "mod" return } if modRoot == "" { + cfg.BuildMod = "mod" return } if fi, err := os.Stat(filepath.Join(modRoot, "vendor")); err == nil && fi.IsDir() { modGo := "unspecified" - if index.goVersion != "" { - if semver.Compare("v"+index.goVersion, "v1.14") >= 0 { + if index.goVersionV != "" { + if semver.Compare(index.goVersionV, "v1.14") >= 0 { // The Go version is at least 1.14, and a vendor directory exists. // Set -mod=vendor by default. cfg.BuildMod = "vendor" cfg.BuildModReason = "Go version in go.mod is at least 1.14 and vendor directory exists." return } else { - modGo = index.goVersion + modGo = index.goVersionV[1:] } } - // Since a vendor directory exists, we have a non-trivial reason for - // choosing -mod=mod, although it probably won't be used for anything. - // Record the reason anyway for consistency. - // It may be overridden if we switch to mod=readonly below. - cfg.BuildModReason = fmt.Sprintf("Go version in go.mod is %s.", modGo) + // Since a vendor directory exists, we should record why we didn't use it. + // This message won't normally be shown, but it may appear with import errors. + cfg.BuildModReason = fmt.Sprintf("Go version in go.mod is %s, so vendor directory was not used.", modGo) } p := ModFilePath() if fi, err := os.Stat(p); err == nil && !hasWritePerm(p, fi) { cfg.BuildMod = "readonly" cfg.BuildModReason = "go.mod file is read-only." + return } + cfg.BuildMod = "mod" } func legacyModInit() { @@ -674,16 +728,35 @@ func findModulePath(dir string) (string, error) { } // Look for path in GOPATH. + var badPathErr error for _, gpdir := range filepath.SplitList(cfg.BuildContext.GOPATH) { if gpdir == "" { continue } if rel := search.InDir(dir, filepath.Join(gpdir, "src")); rel != "" && rel != "." { - return filepath.ToSlash(rel), nil + path := filepath.ToSlash(rel) + // TODO(matloob): replace this with module.CheckImportPath + // once it's been laxened. + // Only checkModulePathLax here. There are some unpublishable + // module names that are compatible with checkModulePathLax + // but they already work in GOPATH so don't break users + // trying to do a build with modules. gorelease will alert users + // publishing their modules to fix their paths. + if err := checkModulePathLax(path); err != nil { + badPathErr = err + break + } + return path, nil } } - msg := `cannot determine module path for source directory %s (outside GOPATH, module path must be specified) + reason := "outside GOPATH, module path must be specified" + if badPathErr != nil { + // return a different error message if the module was in GOPATH, but + // the module path determined above would be an invalid path. + reason = fmt.Sprintf("bad module path inferred from directory in GOPATH: %v", badPathErr) + } + msg := `cannot determine module path for source directory %s (%s) Example usage: 'go mod init example.com/m' to initialize a v0 or v1 module @@ -691,7 +764,7 @@ Example usage: Run 'go help mod init' for more information. ` - return "", fmt.Errorf(msg, dir) + return "", fmt.Errorf(msg, dir, reason) } var ( @@ -787,19 +860,16 @@ func WriteGoMod() { // prefer to report a dirty go.mod over a dirty go.sum if cfg.BuildModReason != "" { base.Fatalf("go: updates to go.mod needed, disabled by -mod=readonly\n\t(%s)", cfg.BuildModReason) - } else { + } else if cfg.BuildModExplicit { base.Fatalf("go: updates to go.mod needed, disabled by -mod=readonly") } } - // Always update go.sum, even if we didn't change go.mod: we may have - // downloaded modules that we didn't have before. - modfetch.WriteGoSum(keepSums()) - if !dirty && cfg.CmdName != "mod tidy" { // The go.mod file has the same semantic content that it had before // (but not necessarily the same exact bytes). - // Ignore any intervening edits. + // Don't write go.mod, but write go.sum in case we added or trimmed sums. + modfetch.WriteGoSum(keepSums(true)) return } @@ -810,6 +880,9 @@ func WriteGoMod() { defer func() { // At this point we have determined to make the go.mod file on disk equal to new. index = indexModFile(new, modFile, false) + + // Update go.sum after releasing the side lock and refreshing the index. + modfetch.WriteGoSum(keepSums(true)) }() // Make a best-effort attempt to acquire the side lock, only to exclude @@ -850,7 +923,10 @@ func WriteGoMod() { // the last load function like ImportPaths, LoadALL, etc.). It also contains // entries for go.mod files needed for MVS (the version of these entries // ends with "/go.mod"). -func keepSums() map[module.Version]bool { +// +// If addDirect is true, the set also includes sums for modules directly +// required by go.mod, as represented by the index, with replacements applied. +func keepSums(addDirect bool) map[module.Version]bool { // Walk the module graph and keep sums needed by MVS. modkey := func(m module.Version) module.Version { return module.Version{Path: m.Path, Version: m.Version + "/go.mod"} @@ -862,9 +938,6 @@ func keepSums() map[module.Version]bool { walk = func(m module.Version) { // If we build using a replacement module, keep the sum for the replacement, // since that's the code we'll actually use during a build. - // - // TODO(golang.org/issue/29182): Perhaps we should keep both sums, and the - // sums for both sets of transitive requirements. r := Replacement(m) if r.Path == "" { keep[modkey(m)] = true @@ -894,9 +967,27 @@ func keepSums() map[module.Version]bool { } } + // Add entries for modules directly required by go.mod. + if addDirect { + for m := range index.require { + var kept module.Version + if r := Replacement(m); r.Path != "" { + kept = r + } else { + kept = m + } + keep[kept] = true + keep[module.Version{Path: kept.Path, Version: kept.Version + "/go.mod"}] = true + } + } + return keep } func TrimGoSum() { - modfetch.TrimGoSum(keepSums()) + // Don't retain sums for direct requirements in go.mod. When TrimGoSum is + // called, go.mod has not been updated, and it may contain requirements on + // modules deleted from the build list. + addDirect := false + modfetch.TrimGoSum(keepSums(addDirect)) } diff --git a/src/cmd/go/internal/modload/list.go b/src/cmd/go/internal/modload/list.go index 7bf4e86c8d..3491f941cd 100644 --- a/src/cmd/go/internal/modload/list.go +++ b/src/cmd/go/internal/modload/list.go @@ -20,12 +20,12 @@ import ( "golang.org/x/mod/module" ) -func ListModules(ctx context.Context, args []string, listU, listVersions bool) []*modinfo.ModulePublic { - mods := listModules(ctx, args, listVersions) +func ListModules(ctx context.Context, args []string, listU, listVersions, listRetracted bool) []*modinfo.ModulePublic { + mods := listModules(ctx, args, listVersions, listRetracted) type token struct{} sem := make(chan token, runtime.GOMAXPROCS(0)) - if listU || listVersions { + if listU || listVersions || listRetracted { for _, m := range mods { add := func(m *modinfo.ModulePublic) { sem <- token{} @@ -34,7 +34,10 @@ func ListModules(ctx context.Context, args []string, listU, listVersions bool) [ addUpdate(ctx, m) } if listVersions { - addVersions(m) + addVersions(ctx, m, listRetracted) + } + if listRetracted || listU { + addRetraction(ctx, m) } <-sem }() @@ -54,10 +57,10 @@ func ListModules(ctx context.Context, args []string, listU, listVersions bool) [ return mods } -func listModules(ctx context.Context, args []string, listVersions bool) []*modinfo.ModulePublic { - LoadBuildList(ctx) +func listModules(ctx context.Context, args []string, listVersions, listRetracted bool) []*modinfo.ModulePublic { + LoadAllModules(ctx) if len(args) == 0 { - return []*modinfo.ModulePublic{moduleInfo(ctx, buildList[0], true)} + return []*modinfo.ModulePublic{moduleInfo(ctx, buildList[0], true, listRetracted)} } var mods []*modinfo.ModulePublic @@ -83,7 +86,13 @@ func listModules(ctx context.Context, args []string, listVersions bool) []*modin } } - info, err := Query(ctx, path, vers, current, nil) + allowed := CheckAllowed + if IsRevisionQuery(vers) || listRetracted { + // Allow excluded and retracted versions if the user asked for a + // specific revision or used 'go list -retracted'. + allowed = nil + } + info, err := Query(ctx, path, vers, current, allowed) if err != nil { mods = append(mods, &modinfo.ModulePublic{ Path: path, @@ -92,7 +101,8 @@ func listModules(ctx context.Context, args []string, listVersions bool) []*modin }) continue } - mods = append(mods, moduleInfo(ctx, module.Version{Path: path, Version: info.Version}, false)) + mod := moduleInfo(ctx, module.Version{Path: path, Version: info.Version}, false, listRetracted) + mods = append(mods, mod) continue } @@ -117,7 +127,7 @@ func listModules(ctx context.Context, args []string, listVersions bool) []*modin matched = true if !matchedBuildList[i] { matchedBuildList[i] = true - mods = append(mods, moduleInfo(ctx, m, true)) + mods = append(mods, moduleInfo(ctx, m, true, listRetracted)) } } } @@ -129,7 +139,8 @@ func listModules(ctx context.Context, args []string, listVersions bool) []*modin // Instead, resolve the module, even if it isn't an existing dependency. info, err := Query(ctx, arg, "latest", "", nil) if err == nil { - mods = append(mods, moduleInfo(ctx, module.Version{Path: arg, Version: info.Version}, false)) + mod := moduleInfo(ctx, module.Version{Path: arg, Version: info.Version}, false, listRetracted) + mods = append(mods, mod) } else { mods = append(mods, &modinfo.ModulePublic{ Path: arg, diff --git a/src/cmd/go/internal/modload/load.go b/src/cmd/go/internal/modload/load.go index 686d491219..1664d8c5be 100644 --- a/src/cmd/go/internal/modload/load.go +++ b/src/cmd/go/internal/modload/load.go @@ -4,6 +4,95 @@ package modload +// This file contains the module-mode package loader, as well as some accessory +// functions pertaining to the package import graph. +// +// There are several exported entry points into package loading (such as +// ImportPathsQuiet and LoadALL), but they are all implemented in terms of +// loadFromRoots, which itself manipulates an instance of the loader struct. +// +// Although most of the loading state is maintained in the loader struct, +// one key piece - the build list - is a global, so that it can be modified +// separate from the loading operation, such as during "go get" +// upgrades/downgrades or in "go mod" operations. +// TODO(#40775): It might be nice to make the loader take and return +// a buildList rather than hard-coding use of the global. +// +// Loading is an iterative process. On each iteration, we try to load the +// requested packages and their transitive imports, then try to resolve modules +// for any imported packages that are still missing. +// +// The first step of each iteration identifies a set of “root” packages. +// Normally the root packages are exactly those matching the named pattern +// arguments. However, for the "all" meta-pattern and related functions +// (LoadALL, LoadVendor), the final set of packages is computed from the package +// import graph, and therefore cannot be an initial input to loading that graph. +// Instead, the root packages for the "all" pattern are those contained in the +// main module, and allPatternIsRoot parameter to the loader instructs it to +// dynamically expand those roots to the full "all" pattern as loading +// progresses. +// +// The pkgInAll flag on each loadPkg instance tracks whether that +// package is known to match the "all" meta-pattern. +// A package matches the "all" pattern if: +// - it is in the main module, or +// - it is imported by any test in the main module, or +// - it is imported by another package in "all", or +// - the main module specifies a go version ≤ 1.15, and the package is imported +// by a *test of* another package in "all". +// +// When we implement lazy loading, we will record the modules providing packages +// in "all" even when we are only loading individual packages, so we set the +// pkgInAll flag regardless of the whether the "all" pattern is a root. +// (This is necessary to maintain the “import invariant” described in +// https://golang.org/design/36460-lazy-module-loading.) +// +// Because "go mod vendor" prunes out the tests of vendored packages, the +// behavior of the "all" pattern with -mod=vendor in Go 1.11–1.15 is the same +// as the "all" pattern (regardless of the -mod flag) in 1.16+. +// The allClosesOverTests parameter to the loader indicates whether the "all" +// pattern should close over tests (as in Go 1.11–1.15) or stop at only those +// packages transitively imported by the packages and tests in the main module +// ("all" in Go 1.16+ and "go mod vendor" in Go 1.11+). +// +// Note that it is possible for a loaded package NOT to be in "all" even when we +// are loading the "all" pattern. For example, packages that are transitive +// dependencies of other roots named on the command line must be loaded, but are +// not in "all". (The mod_notall test illustrates this behavior.) +// Similarly, if the LoadTests flag is set but the "all" pattern does not close +// over test dependencies, then when we load the test of a package that is in +// "all" but outside the main module, the dependencies of that test will not +// necessarily themselves be in "all". That configuration does not arise in Go +// 1.11–1.15, but it will be possible with lazy loading in Go 1.16+. +// +// Loading proceeds from the roots, using a parallel work-queue with a limit on +// the amount of active work (to avoid saturating disks, CPU cores, and/or +// network connections). Each package is added to the queue the first time it is +// imported by another package. When we have finished identifying the imports of +// a package, we add the test for that package if it is needed. A test may be +// needed if: +// - the package matches a root pattern and tests of the roots were requested, or +// - the package is in the main module and the "all" pattern is requested +// (because the "all" pattern includes the dependencies of tests in the main +// module), or +// - the package is in "all" and the definition of "all" we are using includes +// dependencies of tests (as is the case in Go ≤1.15). +// +// After all available packages have been loaded, we examine the results to +// identify any requested or imported packages that are still missing, and if +// so, which modules we could add to the module graph in order to make the +// missing packages available. We add those to the module graph and iterate, +// until either all packages resolve successfully or we cannot identify any +// module that would resolve any remaining missing package. +// +// If the main module is “tidy” (that is, if "go mod tidy" is a no-op for it) +// and all requested packages are in "all", then loading completes in a single +// iteration. +// TODO(bcmills): We should also be able to load in a single iteration if the +// requested packages all come from modules that are themselves tidy, regardless +// of whether those packages are in "all". Today, that requires two iterations +// if those packages are not found in existing dependencies of the main module. + import ( "bytes" "context" @@ -14,8 +103,12 @@ import ( "path" pathpkg "path" "path/filepath" + "reflect" + "runtime" "sort" "strings" + "sync" + "sync/atomic" "cmd/go/internal/base" "cmd/go/internal/cfg" @@ -25,28 +118,12 @@ import ( "cmd/go/internal/par" "cmd/go/internal/search" "cmd/go/internal/str" - "cmd/go/internal/trace" "golang.org/x/mod/module" ) -// buildList is the list of modules to use for building packages. -// It is initialized by calling ImportPaths, ImportFromFiles, -// LoadALL, or LoadBuildList, each of which uses loaded.load. -// -// Ideally, exactly ONE of those functions would be called, -// and exactly once. Most of the time, that's true. -// During "go get" it may not be. TODO(rsc): Figure out if -// that restriction can be established, or else document why not. -// -var buildList []module.Version - // loaded is the most recently-used package loader. // It holds details about individual packages. -// -// Note that loaded.buildList is only valid during a load operation; -// afterward, it is copied back into the global buildList, -// which should be used instead. var loaded *loader // ImportPaths returns the set of packages matching the args (patterns), @@ -63,7 +140,18 @@ func ImportPaths(ctx context.Context, patterns []string) []*search.Match { // packages. The build tags should typically be imports.Tags() or // imports.AnyTags(); a nil map has no special meaning. func ImportPathsQuiet(ctx context.Context, patterns []string, tags map[string]bool) []*search.Match { - updateMatches := func(matches []*search.Match, iterating bool) { + InitMod(ctx) + + allPatternIsRoot := false + var matches []*search.Match + for _, pattern := range search.CleanPatterns(patterns) { + matches = append(matches, search.NewMatch(pattern)) + if pattern == "all" { + allPatternIsRoot = true + } + } + + updateMatches := func(ld *loader) { for _, m := range matches { switch { case m.IsLocal(): @@ -90,7 +178,7 @@ func ImportPathsQuiet(ctx context.Context, patterns []string, tags map[string]bo // indicates that. ModRoot() - if !iterating { + if ld != nil { m.AddError(err) } continue @@ -103,19 +191,18 @@ func ImportPathsQuiet(ctx context.Context, patterns []string, tags map[string]bo case strings.Contains(m.Pattern(), "..."): m.Errs = m.Errs[:0] - matchPackages(ctx, m, loaded.tags, includeStd, buildList) + matchPackages(ctx, m, tags, includeStd, buildList) case m.Pattern() == "all": - loaded.testAll = true - if iterating { - // Enumerate the packages in the main module. - // We'll load the dependencies as we find them. + if ld == nil { + // The initial roots are the packages in the main module. + // loadFromRoots will expand that to "all". m.Errs = m.Errs[:0] - matchPackages(ctx, m, loaded.tags, omitStd, []module.Version{Target}) + matchPackages(ctx, m, tags, omitStd, []module.Version{Target}) } else { // Starting with the packages in the main module, // enumerate the full list of "all". - m.Pkgs = loaded.computePatternAll(m.Pkgs) + m.Pkgs = ld.computePatternAll() } case m.Pattern() == "std" || m.Pattern() == "cmd": @@ -129,51 +216,28 @@ func ImportPathsQuiet(ctx context.Context, patterns []string, tags map[string]bo } } - InitMod(ctx) - - var matches []*search.Match - for _, pattern := range search.CleanPatterns(patterns) { - matches = append(matches, search.NewMatch(pattern)) - } + loaded = loadFromRoots(loaderParams{ + tags: tags, + allPatternIsRoot: allPatternIsRoot, + allClosesOverTests: index.allPatternClosesOverTests(), - loaded = newLoader(tags) - loaded.load(func() []string { - var roots []string - updateMatches(matches, true) - for _, m := range matches { - roots = append(roots, m.Pkgs...) - } - return roots + listRoots: func() (roots []string) { + updateMatches(nil) + for _, m := range matches { + roots = append(roots, m.Pkgs...) + } + return roots + }, }) // One last pass to finalize wildcards. - updateMatches(matches, false) + updateMatches(loaded) checkMultiplePaths() WriteGoMod() return matches } -// checkMultiplePaths verifies that a given module path is used as itself -// or as a replacement for another module, but not both at the same time. -// -// (See https://golang.org/issue/26607 and https://golang.org/issue/34650.) -func checkMultiplePaths() { - firstPath := make(map[module.Version]string, len(buildList)) - for _, mod := range buildList { - src := mod - if rep := Replacement(mod); rep.Path != "" { - src = rep - } - if prev, ok := firstPath[src]; !ok { - firstPath[src] = mod.Path - } else if prev != mod.Path { - base.Errorf("go: %s@%s used for two different module paths (%s and %s)", src.Path, src.Version, prev, mod.Path) - } - } - base.ExitIfErrors() -} - // matchLocalDirs is like m.MatchDirs, but tries to avoid scanning directories // outside of the standard library and active modules. func matchLocalDirs(m *search.Match) { @@ -310,7 +374,7 @@ var ( // pathInModuleCache returns the import path of the directory dir, // if dir is in the module cache copy of a module in our build list. func pathInModuleCache(dir string) string { - for _, m := range buildList[1:] { + tryMod := func(m module.Version) (string, bool) { var root string var err error if repl := Replacement(m); repl.Path != "" && repl.Version == "" { @@ -324,13 +388,26 @@ func pathInModuleCache(dir string) string { root, err = modfetch.DownloadDir(m) } if err != nil { - continue + return "", false } - if sub := search.InDir(dir, root); sub != "" { - sub = filepath.ToSlash(sub) - if !strings.Contains(sub, "/vendor/") && !strings.HasPrefix(sub, "vendor/") && !strings.Contains(sub, "@") { - return path.Join(m.Path, filepath.ToSlash(sub)) - } + + sub := search.InDir(dir, root) + if sub == "" { + return "", false + } + sub = filepath.ToSlash(sub) + if strings.Contains(sub, "/vendor/") || strings.HasPrefix(sub, "vendor/") || strings.Contains(sub, "@") { + return "", false + } + + return path.Join(m.Path, filepath.ToSlash(sub)), true + } + + for _, m := range buildList[1:] { + if importPath, ok := tryMod(m); ok { + // checkMultiplePaths ensures that a module can be used for at most one + // requirement, so this must be it. + return importPath } } return "" @@ -347,12 +424,14 @@ func ImportFromFiles(ctx context.Context, gofiles []string) { base.Fatalf("go: %v", err) } - loaded = newLoader(tags) - loaded.load(func() []string { - var roots []string - roots = append(roots, imports...) - roots = append(roots, testImports...) - return roots + loaded = loadFromRoots(loaderParams{ + tags: tags, + listRoots: func() (roots []string) { + roots = append(roots, imports...) + roots = append(roots, testImports...) + return roots + }, + allClosesOverTests: index.allPatternClosesOverTests(), }) WriteGoMod() } @@ -383,34 +462,19 @@ func DirImportPath(dir string) string { return "." } -// LoadBuildList loads and returns the build list from go.mod. -// The loading of the build list happens automatically in ImportPaths: -// LoadBuildList need only be called if ImportPaths is not -// (typically in commands that care about the module but -// no particular package). -func LoadBuildList(ctx context.Context) []module.Version { - ctx, span := trace.StartSpan(ctx, "LoadBuildList") - defer span.Done() - InitMod(ctx) - ReloadBuildList() - WriteGoMod() - return buildList -} - -func ReloadBuildList() []module.Version { - loaded = newLoader(imports.Tags()) - loaded.load(func() []string { return nil }) - return buildList -} - // LoadALL returns the set of all packages in the current module // and their dependencies in any other modules, without filtering // due to build tags, except "+build ignore". // It adds modules to the build list as needed to satisfy new imports. // This set is useful for deciding whether a particular import is needed // anywhere in a module. +// +// In modules that specify "go 1.16" or higher, ALL follows only one layer of +// test dependencies. In "go 1.15" or lower, ALL follows the imports of tests of +// dependencies of tests. func LoadALL(ctx context.Context) []string { - return loadAll(ctx, true) + InitMod(ctx) + return loadAll(ctx, index.allPatternClosesOverTests()) } // LoadVendor is like LoadALL but only follows test dependencies @@ -418,20 +482,20 @@ func LoadALL(ctx context.Context) []string { // ignored completely. // This set is useful for identifying the which packages to include in a vendor directory. func LoadVendor(ctx context.Context) []string { - return loadAll(ctx, false) -} - -func loadAll(ctx context.Context, testAll bool) []string { InitMod(ctx) + // 'go mod vendor' has never followed test dependencies since Go 1.11. + const closeOverTests = false + return loadAll(ctx, closeOverTests) +} - loaded = newLoader(imports.AnyTags()) - loaded.isALL = true - loaded.testAll = testAll - if !testAll { - loaded.testRoots = true - } - all := TargetPackages(ctx, "...") - loaded.load(func() []string { return all.Pkgs }) +func loadAll(ctx context.Context, closeOverTests bool) []string { + inTarget := TargetPackages(ctx, "...") + loaded = loadFromRoots(loaderParams{ + tags: imports.AnyTags(), + listRoots: func() []string { return inTarget.Pkgs }, + allPatternIsRoot: true, + allClosesOverTests: closeOverTests, + }) checkMultiplePaths() WriteGoMod() @@ -443,7 +507,7 @@ func loadAll(ctx context.Context, testAll bool) []string { } paths = append(paths, pkg.path) } - for _, err := range all.Errs { + for _, err := range inTarget.Errs { base.Errorf("%v", err) } base.ExitIfErrors() @@ -463,52 +527,6 @@ func TargetPackages(ctx context.Context, pattern string) *search.Match { return m } -// BuildList returns the module build list, -// typically constructed by a previous call to -// LoadBuildList or ImportPaths. -// The caller must not modify the returned list. -func BuildList() []module.Version { - return buildList -} - -// SetBuildList sets the module build list. -// The caller is responsible for ensuring that the list is valid. -// SetBuildList does not retain a reference to the original list. -func SetBuildList(list []module.Version) { - buildList = append([]module.Version{}, list...) -} - -// TidyBuildList trims the build list to the minimal requirements needed to -// retain the same versions of all packages from the preceding Load* or -// ImportPaths* call. -func TidyBuildList() { - used := map[module.Version]bool{Target: true} - for _, pkg := range loaded.pkgs { - used[pkg.mod] = true - } - - keep := []module.Version{Target} - var direct []string - for _, m := range buildList[1:] { - if used[m] { - keep = append(keep, m) - if loaded.direct[m.Path] { - direct = append(direct, m.Path) - } - } else if cfg.BuildV { - if _, ok := index.require[m]; ok { - fmt.Fprintf(os.Stderr, "unused %s\n", m.Path) - } - } - } - - min, err := mvs.Req(Target, direct, &mvsReqs{buildList: keep}) - if err != nil { - base.Fatalf("go: %v", err) - } - buildList = append([]module.Version{Target}, min...) -} - // ImportMap returns the actual package import path // for an import path found in source code. // If the given import path does not appear in the source code @@ -563,12 +581,6 @@ func PackageImports(path string) (imports, testImports []string) { return imports, testImports } -// ModuleUsedDirectly reports whether the main module directly imports -// some package in the module with the given path. -func ModuleUsedDirectly(path string) bool { - return loaded.direct[path] -} - // Lookup returns the source directory, import path, and any loading error for // the package at path as imported from the package in parentDir. // Lookup requires that one of the Load functions in this package has already @@ -604,76 +616,148 @@ func Lookup(parentPath string, parentIsStd bool, path string) (dir, realPath str // the required packages for a particular build, // checking that the packages are available in the module set, // and updating the module set if needed. -// Loading is an iterative process: try to load all the needed packages, -// but if imports are missing, try to resolve those imports, and repeat. -// -// Although most of the loading state is maintained in the loader struct, -// one key piece - the build list - is a global, so that it can be modified -// separate from the loading operation, such as during "go get" -// upgrades/downgrades or in "go mod" operations. -// TODO(rsc): It might be nice to make the loader take and return -// a buildList rather than hard-coding use of the global. type loader struct { - tags map[string]bool // tags for scanDir - testRoots bool // include tests for roots - isALL bool // created with LoadALL - testAll bool // include tests for all packages - forceStdVendor bool // if true, load standard-library dependencies from the vendor subtree + loaderParams + + work *par.Queue // reset on each iteration roots []*loadPkg - pkgs []*loadPkg - work *par.Work // current work queue - pkgCache *par.Cache // map from string to *loadPkg + pkgCache *par.Cache // package path (string) → *loadPkg + pkgs []*loadPkg // transitive closure of loaded packages and tests; populated in buildStacks // computed at end of iterations - direct map[string]bool // imported directly by main module - goVersion map[string]string // go version recorded in each module + direct map[string]bool // imported directly by main module +} + +type loaderParams struct { + tags map[string]bool // tags for scanDir + listRoots func() []string + allPatternIsRoot bool // Is the "all" pattern an additional root? + allClosesOverTests bool // Does the "all" pattern include the transitive closure of tests of packages in "all"? } // LoadTests controls whether the loaders load tests of the root packages. var LoadTests bool -func newLoader(tags map[string]bool) *loader { - ld := new(loader) - ld.tags = tags - ld.testRoots = LoadTests - - // Inside the "std" and "cmd" modules, we prefer to use the vendor directory - // unless the command explicitly changes the module graph. - if !targetInGorootSrc || (cfg.CmdName != "get" && !strings.HasPrefix(cfg.CmdName, "mod ")) { - ld.forceStdVendor = true +func (ld *loader) reset() { + select { + case <-ld.work.Idle(): + default: + panic("loader.reset when not idle") } - return ld -} - -func (ld *loader) reset() { ld.roots = nil - ld.pkgs = nil - ld.work = new(par.Work) ld.pkgCache = new(par.Cache) + ld.pkgs = nil } // A loadPkg records information about a single loaded package. type loadPkg struct { - path string // import path + // Populated at construction time: + path string // import path + testOf *loadPkg + + // Populated at construction time and updated by (*loader).applyPkgFlags: + flags atomicLoadPkgFlags + + // Populated by (*loader).load: mod module.Version // module providing package dir string // directory containing source code - imports []*loadPkg // packages imported by this one err error // error loading package - stack *loadPkg // package importing this one in minimal import stack for this pkg - test *loadPkg // package with test imports, if we need test - testOf *loadPkg - testImports []string // test-only imports, saved for use by pkg.test. + imports []*loadPkg // packages imported by this one + testImports []string // test-only imports, saved for use by pkg.test. + inStd bool + + // Populated by (*loader).pkgTest: + testOnce sync.Once + test *loadPkg + + // Populated by postprocessing in (*loader).buildStacks: + stack *loadPkg // package importing this one in minimal import stack for this pkg +} + +// loadPkgFlags is a set of flags tracking metadata about a package. +type loadPkgFlags int8 + +const ( + // pkgInAll indicates that the package is in the "all" package pattern, + // regardless of whether we are loading the "all" package pattern. + // + // When the pkgInAll flag and pkgImportsLoaded flags are both set, the caller + // who set the last of those flags must propagate the pkgInAll marking to all + // of the imports of the marked package. + // + // A test is marked with pkgInAll if that test would promote the packages it + // imports to be in "all" (such as when the test is itself within the main + // module, or when ld.allClosesOverTests is true). + pkgInAll loadPkgFlags = 1 << iota + + // pkgIsRoot indicates that the package matches one of the root package + // patterns requested by the caller. + // + // If LoadTests is set, then when pkgIsRoot and pkgImportsLoaded are both set, + // the caller who set the last of those flags must populate a test for the + // package (in the pkg.test field). + // + // If the "all" pattern is included as a root, then non-test packages in "all" + // are also roots (and must be marked pkgIsRoot). + pkgIsRoot + + // pkgImportsLoaded indicates that the imports and testImports fields of a + // loadPkg have been populated. + pkgImportsLoaded +) + +// has reports whether all of the flags in cond are set in f. +func (f loadPkgFlags) has(cond loadPkgFlags) bool { + return f&cond == cond +} + +// An atomicLoadPkgFlags stores a loadPkgFlags for which individual flags can be +// added atomically. +type atomicLoadPkgFlags struct { + bits int32 +} + +// update sets the given flags in af (in addition to any flags already set). +// +// update returns the previous flag state so that the caller may determine which +// flags were newly-set. +func (af *atomicLoadPkgFlags) update(flags loadPkgFlags) (old loadPkgFlags) { + for { + old := atomic.LoadInt32(&af.bits) + new := old | int32(flags) + if new == old || atomic.CompareAndSwapInt32(&af.bits, old, new) { + return loadPkgFlags(old) + } + } +} + +// has reports whether all of the flags in cond are set in af. +func (af *atomicLoadPkgFlags) has(cond loadPkgFlags) bool { + return loadPkgFlags(atomic.LoadInt32(&af.bits))&cond == cond +} + +// isTest reports whether pkg is a test of another package. +func (pkg *loadPkg) isTest() bool { + return pkg.testOf != nil } var errMissing = errors.New("cannot find package") -// load attempts to load the build graph needed to process a set of root packages. -// The set of root packages is defined by the addRoots function, -// which must call add(path) with the import path of each root package. -func (ld *loader) load(roots func() []string) { +// loadFromRoots attempts to load the build graph needed to process a set of +// root packages and their dependencies. +// +// The set of root packages is returned by the params.listRoots function, and +// expanded to the full set of packages by tracing imports (and possibly tests) +// as needed. +func loadFromRoots(params loaderParams) *loader { + ld := &loader{ + loaderParams: params, + work: par.NewQueue(runtime.GOMAXPROCS(0)), + } + var err error reqs := Reqs() buildList, err = mvs.BuildList(Target, reqs) @@ -681,47 +765,34 @@ func (ld *loader) load(roots func() []string) { base.Fatalf("go: %v", err) } - added := make(map[string]bool) + addedModuleFor := make(map[string]bool) for { ld.reset() - if roots != nil { - // Note: the returned roots can change on each iteration, - // since the expansion of package patterns depends on the - // build list we're using. - for _, path := range roots() { - ld.work.Add(ld.pkg(path, true)) + + // Load the root packages and their imports. + // Note: the returned roots can change on each iteration, + // since the expansion of package patterns depends on the + // build list we're using. + inRoots := map[*loadPkg]bool{} + for _, path := range ld.listRoots() { + root := ld.pkg(path, pkgIsRoot) + if !inRoots[root] { + ld.roots = append(ld.roots, root) + inRoots[root] = true } } - ld.work.Do(10, ld.doPkg) + + // ld.pkg adds imported packages to the work queue and calls applyPkgFlags, + // which adds tests (and test dependencies) as needed. + // + // When all of the work in the queue has completed, we'll know that the + // transitive closure of dependencies has been loaded. + <-ld.work.Idle() + ld.buildStacks() - numAdded := 0 - haveMod := make(map[module.Version]bool) - for _, m := range buildList { - haveMod[m] = true - } - modAddedBy := make(map[module.Version]*loadPkg) - for _, pkg := range ld.pkgs { - if err, ok := pkg.err.(*ImportMissingError); ok && err.Module.Path != "" { - if err.newMissingVersion != "" { - base.Fatalf("go: %s: package provided by %s at latest version %s but not at required version %s", pkg.stackText(), err.Module.Path, err.Module.Version, err.newMissingVersion) - } - fmt.Fprintf(os.Stderr, "go: found %s in %s %s\n", pkg.path, err.Module.Path, err.Module.Version) - if added[pkg.path] { - base.Fatalf("go: %s: looping trying to add package", pkg.stackText()) - } - added[pkg.path] = true - numAdded++ - if !haveMod[err.Module] { - haveMod[err.Module] = true - modAddedBy[err.Module] = pkg - buildList = append(buildList, err.Module) - } - continue - } - // Leave other errors for Import or load.Packages to report. - } - base.ExitIfErrors() - if numAdded == 0 { + + modAddedBy := ld.resolveMissingImports(addedModuleFor) + if len(modAddedBy) == 0 { break } @@ -754,99 +825,264 @@ func (ld *loader) load(roots func() []string) { } } - // Add Go versions, computed during walk. - ld.goVersion = make(map[string]string) - for _, m := range buildList { - v, _ := reqs.(*mvsReqs).versions.Load(m) - ld.goVersion[m.Path], _ = v.(string) - } - - // Mix in direct markings (really, lack of indirect markings) - // from go.mod, unless we scanned the whole module - // and can therefore be sure we know better than go.mod. - if !ld.isALL && modFile != nil { + // If we didn't scan all of the imports from the main module, or didn't use + // imports.AnyTags, then we didn't necessarily load every package that + // contributes “direct” imports — so we can't safely mark existing + // dependencies as indirect-only. + // Conservatively mark those dependencies as direct. + if modFile != nil && (!ld.allPatternIsRoot || !reflect.DeepEqual(ld.tags, imports.AnyTags())) { for _, r := range modFile.Require { if !r.Indirect { ld.direct[r.Mod.Path] = true } } } + + return ld } -// pkg returns the *loadPkg for path, creating and queuing it if needed. -// If the package should be tested, its test is created but not queued -// (the test is queued after processing pkg). -// If isRoot is true, the pkg is being queued as one of the roots of the work graph. -func (ld *loader) pkg(path string, isRoot bool) *loadPkg { - return ld.pkgCache.Do(path, func() interface{} { - pkg := &loadPkg{ - path: path, +// resolveMissingImports adds module dependencies to the global build list +// in order to resolve missing packages from pkgs. +// +// The newly-resolved packages are added to the addedModuleFor map, and +// resolveMissingImports returns a map from each newly-added module version to +// the first package for which that module was added. +func (ld *loader) resolveMissingImports(addedModuleFor map[string]bool) (modAddedBy map[module.Version]*loadPkg) { + var needPkgs []*loadPkg + for _, pkg := range ld.pkgs { + if pkg.isTest() { + // If we are missing a test, we are also missing its non-test version, and + // we should only add the missing import once. + continue } - if ld.testRoots && isRoot || ld.testAll { - test := &loadPkg{ - path: path, - testOf: pkg, - } - pkg.test = test + if pkg.err != errImportMissing { + // Leave other errors for Import or load.Packages to report. + continue + } + + needPkgs = append(needPkgs, pkg) + + pkg := pkg + ld.work.Add(func() { + pkg.mod, pkg.err = queryImport(context.TODO(), pkg.path) + }) + } + <-ld.work.Idle() + + modAddedBy = map[module.Version]*loadPkg{} + for _, pkg := range needPkgs { + if pkg.err != nil { + continue } - if isRoot { - ld.roots = append(ld.roots, pkg) + + fmt.Fprintf(os.Stderr, "go: found %s in %s %s\n", pkg.path, pkg.mod.Path, pkg.mod.Version) + if addedModuleFor[pkg.path] { + // TODO(bcmills): This should only be an error if pkg.mod is the same + // version we already tried to add previously. + base.Fatalf("go: %s: looping trying to add package", pkg.stackText()) + } + if modAddedBy[pkg.mod] == nil { + modAddedBy[pkg.mod] = pkg + buildList = append(buildList, pkg.mod) + } + } + + return modAddedBy +} + +// pkg locates the *loadPkg for path, creating and queuing it for loading if +// needed, and updates its state to reflect the given flags. +// +// The imports of the returned *loadPkg will be loaded asynchronously in the +// ld.work queue, and its test (if requested) will also be populated once +// imports have been resolved. When ld.work goes idle, all transitive imports of +// the requested package (and its test, if requested) will have been loaded. +func (ld *loader) pkg(path string, flags loadPkgFlags) *loadPkg { + if flags.has(pkgImportsLoaded) { + panic("internal error: (*loader).pkg called with pkgImportsLoaded flag set") + } + + pkg := ld.pkgCache.Do(path, func() interface{} { + pkg := &loadPkg{ + path: path, } - ld.work.Add(pkg) + ld.applyPkgFlags(pkg, flags) + + ld.work.Add(func() { ld.load(pkg) }) return pkg }).(*loadPkg) + + ld.applyPkgFlags(pkg, flags) + return pkg } -// doPkg processes a package on the work queue. -func (ld *loader) doPkg(item interface{}) { - // TODO: what about replacements? - pkg := item.(*loadPkg) - var imports []string - if pkg.testOf != nil { - pkg.dir = pkg.testOf.dir - pkg.mod = pkg.testOf.mod - imports = pkg.testOf.testImports - } else { - if strings.Contains(pkg.path, "@") { - // Leave for error during load. - return - } - if build.IsLocalImport(pkg.path) || filepath.IsAbs(pkg.path) { - // Leave for error during load. - // (Module mode does not allow local imports.) - return - } +// applyPkgFlags updates pkg.flags to set the given flags and propagate the +// (transitive) effects of those flags, possibly loading or enqueueing further +// packages as a result. +func (ld *loader) applyPkgFlags(pkg *loadPkg, flags loadPkgFlags) { + if flags == 0 { + return + } - // TODO(matloob): Handle TODO context. This needs to be threaded through Do. - pkg.mod, pkg.dir, pkg.err = Import(context.TODO(), pkg.path) - if pkg.dir == "" { - return + if flags.has(pkgInAll) && ld.allPatternIsRoot && !pkg.isTest() { + // This package matches a root pattern by virtue of being in "all". + flags |= pkgIsRoot + } + + old := pkg.flags.update(flags) + new := old | flags + if new == old || !new.has(pkgImportsLoaded) { + // We either didn't change the state of pkg, or we don't know anything about + // its dependencies yet. Either way, we can't usefully load its test or + // update its dependencies. + return + } + + if !pkg.isTest() { + // Check whether we should add (or update the flags for) a test for pkg. + // ld.pkgTest is idempotent and extra invocations are inexpensive, + // so it's ok if we call it more than is strictly necessary. + wantTest := false + switch { + case ld.allPatternIsRoot && pkg.mod == Target: + // We are loading the "all" pattern, which includes packages imported by + // tests in the main module. This package is in the main module, so we + // need to identify the imports of its test even if LoadTests is not set. + // + // (We will filter out the extra tests explicitly in computePatternAll.) + wantTest = true + + case ld.allPatternIsRoot && ld.allClosesOverTests && new.has(pkgInAll): + // This variant of the "all" pattern includes imports of tests of every + // package that is itself in "all", and pkg is in "all", so its test is + // also in "all" (as above). + wantTest = true + + case LoadTests && new.has(pkgIsRoot): + // LoadTest explicitly requests tests of “the root packages”. + wantTest = true } - var testImports []string - var err error - imports, testImports, err = scanDir(pkg.dir, ld.tags) - if err != nil { - pkg.err = err - return + + if wantTest { + var testFlags loadPkgFlags + if pkg.mod == Target || (ld.allClosesOverTests && new.has(pkgInAll)) { + // Tests of packages in the main module are in "all", in the sense that + // they cause the packages they import to also be in "all". So are tests + // of packages in "all" if "all" closes over test dependencies. + testFlags |= pkgInAll + } + ld.pkgTest(pkg, testFlags) } - if pkg.test != nil { - pkg.testImports = testImports + } + + if new.has(pkgInAll) && !old.has(pkgInAll|pkgImportsLoaded) { + // We have just marked pkg with pkgInAll, or we have just loaded its + // imports, or both. Now is the time to propagate pkgInAll to the imports. + for _, dep := range pkg.imports { + ld.applyPkgFlags(dep, pkgInAll) } } +} + +// load loads an individual package. +func (ld *loader) load(pkg *loadPkg) { + if strings.Contains(pkg.path, "@") { + // Leave for error during load. + return + } + if build.IsLocalImport(pkg.path) || filepath.IsAbs(pkg.path) { + // Leave for error during load. + // (Module mode does not allow local imports.) + return + } - inStd := (search.IsStandardImportPath(pkg.path) && search.InDir(pkg.dir, cfg.GOROOTsrc) != "") + pkg.mod, pkg.dir, pkg.err = importFromBuildList(context.TODO(), pkg.path) + if pkg.dir == "" { + return + } + if pkg.mod == Target { + // Go ahead and mark pkg as in "all". This provides the invariant that a + // package that is *only* imported by other packages in "all" is always + // marked as such before loading its imports. + // + // We don't actually rely on that invariant at the moment, but it may + // improve efficiency somewhat and makes the behavior a bit easier to reason + // about (by reducing churn on the flag bits of dependencies), and costs + // essentially nothing (these atomic flag ops are essentially free compared + // to scanning source code for imports). + ld.applyPkgFlags(pkg, pkgInAll) + } + + imports, testImports, err := scanDir(pkg.dir, ld.tags) + if err != nil { + pkg.err = err + return + } + + pkg.inStd = (search.IsStandardImportPath(pkg.path) && search.InDir(pkg.dir, cfg.GOROOTsrc) != "") + + pkg.imports = make([]*loadPkg, 0, len(imports)) + var importFlags loadPkgFlags + if pkg.flags.has(pkgInAll) { + importFlags = pkgInAll + } for _, path := range imports { - if inStd { + if pkg.inStd { + // Imports from packages in "std" and "cmd" should resolve using + // GOROOT/src/vendor even when "std" is not the main module. path = ld.stdVendor(pkg.path, path) } - pkg.imports = append(pkg.imports, ld.pkg(path, false)) + pkg.imports = append(pkg.imports, ld.pkg(path, importFlags)) } + pkg.testImports = testImports - // Now that pkg.dir, pkg.mod, pkg.testImports are set, we can queue pkg.test. - // TODO: All that's left is creating new imports. Why not just do it now? - if pkg.test != nil { - ld.work.Add(pkg.test) + ld.applyPkgFlags(pkg, pkgImportsLoaded) +} + +// pkgTest locates the test of pkg, creating it if needed, and updates its state +// to reflect the given flags. +// +// pkgTest requires that the imports of pkg have already been loaded (flagged +// with pkgImportsLoaded). +func (ld *loader) pkgTest(pkg *loadPkg, testFlags loadPkgFlags) *loadPkg { + if pkg.isTest() { + panic("pkgTest called on a test package") + } + + createdTest := false + pkg.testOnce.Do(func() { + pkg.test = &loadPkg{ + path: pkg.path, + testOf: pkg, + mod: pkg.mod, + dir: pkg.dir, + err: pkg.err, + inStd: pkg.inStd, + } + ld.applyPkgFlags(pkg.test, testFlags) + createdTest = true + }) + + test := pkg.test + if createdTest { + test.imports = make([]*loadPkg, 0, len(pkg.testImports)) + var importFlags loadPkgFlags + if test.flags.has(pkgInAll) { + importFlags = pkgInAll + } + for _, path := range pkg.testImports { + if pkg.inStd { + path = ld.stdVendor(test.path, path) + } + test.imports = append(test.imports, ld.pkg(path, importFlags)) + } + pkg.testImports = nil + ld.applyPkgFlags(test, pkgImportsLoaded) + } else { + ld.applyPkgFlags(test, testFlags) } + + return test } // stdVendor returns the canonical import path for the package with the given @@ -857,13 +1093,21 @@ func (ld *loader) stdVendor(parentPath, path string) string { } if str.HasPathPrefix(parentPath, "cmd") { - if ld.forceStdVendor || Target.Path != "cmd" { + if Target.Path != "cmd" { vendorPath := pathpkg.Join("cmd", "vendor", path) if _, err := os.Stat(filepath.Join(cfg.GOROOTsrc, filepath.FromSlash(vendorPath))); err == nil { return vendorPath } } - } else if ld.forceStdVendor || Target.Path != "std" { + } else if Target.Path != "std" || str.HasPathPrefix(parentPath, "vendor") { + // If we are outside of the 'std' module, resolve imports from within 'std' + // to the vendor directory. + // + // Do the same for importers beginning with the prefix 'vendor/' even if we + // are *inside* of the 'std' module: the 'vendor/' packages that resolve + // globally from GOROOT/src/vendor (and are listed as part of 'go list std') + // are distinct from the real module dependencies, and cannot import internal + // packages from the real module. vendorPath := pathpkg.Join("vendor", path) if _, err := os.Stat(filepath.Join(cfg.GOROOTsrc, filepath.FromSlash(vendorPath))); err == nil { return vendorPath @@ -876,30 +1120,13 @@ func (ld *loader) stdVendor(parentPath, path string) string { // computePatternAll returns the list of packages matching pattern "all", // starting with a list of the import paths for the packages in the main module. -func (ld *loader) computePatternAll(paths []string) []string { - seen := make(map[*loadPkg]bool) - var all []string - var walk func(*loadPkg) - walk = func(pkg *loadPkg) { - if seen[pkg] { - return - } - seen[pkg] = true - if pkg.testOf == nil { +func (ld *loader) computePatternAll() (all []string) { + for _, pkg := range ld.pkgs { + if pkg.flags.has(pkgInAll) && !pkg.isTest() { all = append(all, pkg.path) } - for _, p := range pkg.imports { - walk(p) - } - if p := pkg.test; p != nil { - walk(p) - } - } - for _, path := range paths { - walk(ld.pkg(path, false)) } sort.Strings(all) - return all } diff --git a/src/cmd/go/internal/modload/modfile.go b/src/cmd/go/internal/modload/modfile.go index 9f4ec5a49f..18dd293ac9 100644 --- a/src/cmd/go/internal/modload/modfile.go +++ b/src/cmd/go/internal/modload/modfile.go @@ -5,13 +5,31 @@ package modload import ( + "context" + "errors" + "fmt" + "path/filepath" + "strings" + "sync" + "unicode" + "cmd/go/internal/base" "cmd/go/internal/cfg" + "cmd/go/internal/lockedfile" + "cmd/go/internal/modfetch" + "cmd/go/internal/par" + "cmd/go/internal/trace" "golang.org/x/mod/modfile" "golang.org/x/mod/module" + "golang.org/x/mod/semver" ) +// lazyLoadingVersion is the Go version (plus leading "v") at which lazy module +// loading takes effect. +const lazyLoadingVersionV = "v1.16" +const go116EnableLazyLoading = true + var modFile *modfile.File // A modFileIndex is an index of data corresponding to a modFile @@ -20,7 +38,7 @@ type modFileIndex struct { data []byte dataNeedsFix bool // true if fixVersion applied a change while parsing data module module.Version - goVersion string + goVersionV string // GoVersion with "v" prefix require map[module.Version]requireMeta replace map[module.Version]module.Version exclude map[module.Version]bool @@ -33,9 +51,151 @@ type requireMeta struct { indirect bool } -// Allowed reports whether module m is allowed (not excluded) by the main module's go.mod. -func Allowed(m module.Version) bool { - return index == nil || !index.exclude[m] +// CheckAllowed returns an error equivalent to ErrDisallowed if m is excluded by +// the main module's go.mod or retracted by its author. Most version queries use +// this to filter out versions that should not be used. +func CheckAllowed(ctx context.Context, m module.Version) error { + if err := CheckExclusions(ctx, m); err != nil { + return err + } + if err := checkRetractions(ctx, m); err != nil { + return err + } + return nil +} + +// ErrDisallowed is returned by version predicates passed to Query and similar +// functions to indicate that a version should not be considered. +var ErrDisallowed = errors.New("disallowed module version") + +// CheckExclusions returns an error equivalent to ErrDisallowed if module m is +// excluded by the main module's go.mod file. +func CheckExclusions(ctx context.Context, m module.Version) error { + if index != nil && index.exclude[m] { + return module.VersionError(m, errExcluded) + } + return nil +} + +var errExcluded = &excludedError{} + +type excludedError struct{} + +func (e *excludedError) Error() string { return "excluded by go.mod" } +func (e *excludedError) Is(err error) bool { return err == ErrDisallowed } + +// checkRetractions returns an error if module m has been retracted by +// its author. +func checkRetractions(ctx context.Context, m module.Version) error { + if m.Version == "" { + // Main module, standard library, or file replacement module. + // Cannot be retracted. + return nil + } + + // Look up retraction information from the latest available version of + // the module. Cache retraction information so we don't parse the go.mod + // file repeatedly. + type entry struct { + retract []retraction + err error + } + path := m.Path + e := retractCache.Do(path, func() (v interface{}) { + ctx, span := trace.StartSpan(ctx, "checkRetractions "+path) + defer span.Done() + + if repl := Replacement(module.Version{Path: m.Path}); repl.Path != "" { + // All versions of the module were replaced with a local directory. + // Don't load retractions. + return &entry{nil, nil} + } + + // Find the latest version of the module. + // Ignore exclusions from the main module's go.mod. + // We may need to account for the current version: for example, + // v2.0.0+incompatible is not "latest" if v1.0.0 is current. + rev, err := Query(ctx, path, "latest", findCurrentVersion(path), nil) + if err != nil { + return &entry{err: err} + } + + // Load go.mod for that version. + // If the version is replaced, we'll load retractions from the replacement. + // If there's an error loading the go.mod, we'll return it here. + // These errors should generally be ignored by callers of checkRetractions, + // since they happen frequently when we're offline. These errors are not + // equivalent to ErrDisallowed, so they may be distinguished from + // retraction errors. + summary, err := goModSummary(module.Version{Path: path, Version: rev.Version}) + if err != nil { + return &entry{err: err} + } + return &entry{retract: summary.retract} + }).(*entry) + + if e.err != nil { + return fmt.Errorf("loading module retractions: %v", e.err) + } + + var rationale []string + isRetracted := false + for _, r := range e.retract { + if semver.Compare(r.Low, m.Version) <= 0 && semver.Compare(m.Version, r.High) <= 0 { + isRetracted = true + if r.Rationale != "" { + rationale = append(rationale, r.Rationale) + } + } + } + if isRetracted { + return &retractedError{rationale: rationale} + } + return nil +} + +var retractCache par.Cache + +type retractedError struct { + rationale []string +} + +func (e *retractedError) Error() string { + msg := "retracted by module author" + if len(e.rationale) > 0 { + // This is meant to be a short error printed on a terminal, so just + // print the first rationale. + msg += ": " + ShortRetractionRationale(e.rationale[0]) + } + return msg +} + +func (e *retractedError) Is(err error) bool { + return err == ErrDisallowed +} + +// ShortRetractionRationale returns a retraction rationale string that is safe +// to print in a terminal. It returns hard-coded strings if the rationale +// is empty, too long, or contains non-printable characters. +func ShortRetractionRationale(rationale string) string { + const maxRationaleBytes = 500 + if i := strings.Index(rationale, "\n"); i >= 0 { + rationale = rationale[:i] + } + rationale = strings.TrimSpace(rationale) + if rationale == "" { + return "retracted by module author" + } + if len(rationale) > maxRationaleBytes { + return "(rationale omitted: too long)" + } + for _, r := range rationale { + if !unicode.IsGraphic(r) && !unicode.IsSpace(r) { + return "(rationale omitted: contains non-printable characters)" + } + } + // NOTE: the go.mod parser rejects invalid UTF-8, so we don't check that here. + return rationale } // Replacement returns the replacement for mod, if any, from go.mod. @@ -66,9 +226,11 @@ func indexModFile(data []byte, modFile *modfile.File, needsFix bool) *modFileInd i.module = modFile.Module.Mod } - i.goVersion = "" + i.goVersionV = "" if modFile.Go != nil { - i.goVersion = modFile.Go.Version + // We're going to use the semver package to compare Go versions, so go ahead + // and add the "v" prefix it expects once instead of every time. + i.goVersionV = "v" + modFile.Go.Version } i.require = make(map[module.Version]requireMeta, len(modFile.Require)) @@ -92,6 +254,23 @@ func indexModFile(data []byte, modFile *modfile.File, needsFix bool) *modFileInd return i } +// allPatternClosesOverTests reports whether the "all" pattern includes +// dependencies of tests outside the main module (as in Go 1.11–1.15). +// (Otherwise — as in Go 1.16+ — the "all" pattern includes only the packages +// transitively *imported by* the packages and tests in the main module.) +func (i *modFileIndex) allPatternClosesOverTests() bool { + if !go116EnableLazyLoading { + return true + } + if i != nil && semver.Compare(i.goVersionV, lazyLoadingVersionV) < 0 { + // The module explicitly predates the change in "all" for lazy loading, so + // continue to use the older interpretation. (If i == nil, we not in any + // module at all and should use the latest semantics.) + return true + } + return false +} + // modFileIsDirty reports whether the go.mod file differs meaningfully // from what was indexed. // If modFile has been changed (even cosmetically) since it was first read, @@ -114,11 +293,11 @@ func (i *modFileIndex) modFileIsDirty(modFile *modfile.File) bool { } if modFile.Go == nil { - if i.goVersion != "" { + if i.goVersionV != "" { return true } - } else if modFile.Go.Version != i.goVersion { - if i.goVersion == "" && cfg.BuildMod == "readonly" { + } else if "v"+modFile.Go.Version != i.goVersionV { + if i.goVersionV == "" && cfg.BuildMod == "readonly" { // go.mod files did not always require a 'go' version, so do not error out // if one is missing — we may be inside an older module in the module // cache, and should bias toward providing useful behavior. @@ -162,3 +341,190 @@ func (i *modFileIndex) modFileIsDirty(modFile *modfile.File) bool { return false } + +// rawGoVersion records the Go version parsed from each module's go.mod file. +// +// If a module is replaced, the version of the replacement is keyed by the +// replacement module.Version, not the version being replaced. +var rawGoVersion sync.Map // map[module.Version]string + +// A modFileSummary is a summary of a go.mod file for which we do not need to +// retain complete information — for example, the go.mod file of a dependency +// module. +type modFileSummary struct { + module module.Version + goVersionV string // GoVersion with "v" prefix + require []module.Version + retract []retraction +} + +// A retraction consists of a retracted version interval and rationale. +// retraction is like modfile.Retract, but it doesn't point to the syntax tree. +type retraction struct { + modfile.VersionInterval + Rationale string +} + +// goModSummary returns a summary of the go.mod file for module m, +// taking into account any replacements for m, exclusions of its dependencies, +// and/or vendoring. +// +// goModSummary cannot be used on the Target module, as its requirements +// may change. +// +// The caller must not modify the returned summary. +func goModSummary(m module.Version) (*modFileSummary, error) { + if m == Target { + panic("internal error: goModSummary called on the Target module") + } + + type cached struct { + summary *modFileSummary + err error + } + c := goModSummaryCache.Do(m, func() interface{} { + if cfg.BuildMod == "vendor" { + summary := &modFileSummary{ + module: module.Version{Path: m.Path}, + } + if vendorVersion[m.Path] != m.Version { + // This module is not vendored, so packages cannot be loaded from it and + // it cannot be relevant to the build. + return cached{summary, nil} + } + + // For every module other than the target, + // return the full list of modules from modules.txt. + readVendorList() + + // TODO(#36876): Load the "go" version from vendor/modules.txt and store it + // in rawGoVersion with the appropriate key. + + // We don't know what versions the vendored module actually relies on, + // so assume that it requires everything. + summary.require = vendorList + return cached{summary, nil} + } + + actual := Replacement(m) + if actual.Path == "" { + actual = m + } + summary, err := rawGoModSummary(actual) + if err != nil { + return cached{nil, err} + } + + if actual.Version == "" { + // The actual module is a filesystem-local replacement, for which we have + // unfortunately not enforced any sort of invariants about module lines or + // matching module paths. Anything goes. + // + // TODO(bcmills): Remove this special-case, update tests, and add a + // release note. + } else { + if summary.module.Path == "" { + return cached{nil, module.VersionError(actual, errors.New("parsing go.mod: missing module line"))} + } + + // In theory we should only allow mpath to be unequal to m.Path here if the + // version that we fetched lacks an explicit go.mod file: if the go.mod file + // is explicit, then it should match exactly (to ensure that imports of other + // packages within the module are interpreted correctly). Unfortunately, we + // can't determine that information from the module proxy protocol: we'll have + // to leave that validation for when we load actual packages from within the + // module. + if mpath := summary.module.Path; mpath != m.Path && mpath != actual.Path { + return cached{nil, module.VersionError(actual, fmt.Errorf(`parsing go.mod: + module declares its path as: %s + but was required as: %s`, mpath, m.Path))} + } + } + + if index != nil && len(index.exclude) > 0 { + // Drop any requirements on excluded versions. + nonExcluded := summary.require[:0] + for _, r := range summary.require { + if !index.exclude[r] { + nonExcluded = append(nonExcluded, r) + } + } + summary.require = nonExcluded + } + return cached{summary, nil} + }).(cached) + + return c.summary, c.err +} + +var goModSummaryCache par.Cache // module.Version → goModSummary result + +// rawGoModSummary returns a new summary of the go.mod file for module m, +// ignoring all replacements that may apply to m and excludes that may apply to +// its dependencies. +// +// rawGoModSummary cannot be used on the Target module. +func rawGoModSummary(m module.Version) (*modFileSummary, error) { + if m == Target { + panic("internal error: rawGoModSummary called on the Target module") + } + + summary := new(modFileSummary) + var f *modfile.File + if m.Version == "" { + // m is a replacement module with only a file path. + dir := m.Path + if !filepath.IsAbs(dir) { + dir = filepath.Join(ModRoot(), dir) + } + gomod := filepath.Join(dir, "go.mod") + + data, err := lockedfile.Read(gomod) + if err != nil { + return nil, module.VersionError(m, fmt.Errorf("reading %s: %v", base.ShortPath(gomod), err)) + } + f, err = modfile.ParseLax(gomod, data, nil) + if err != nil { + return nil, module.VersionError(m, fmt.Errorf("parsing %s: %v", base.ShortPath(gomod), err)) + } + } else { + if !semver.IsValid(m.Version) { + // Disallow the broader queries supported by fetch.Lookup. + base.Fatalf("go: internal error: %s@%s: unexpected invalid semantic version", m.Path, m.Version) + } + + data, err := modfetch.GoMod(m.Path, m.Version) + if err != nil { + return nil, err + } + f, err = modfile.ParseLax("go.mod", data, nil) + if err != nil { + return nil, module.VersionError(m, fmt.Errorf("parsing go.mod: %v", err)) + } + } + + if f.Module != nil { + summary.module = f.Module.Mod + } + if f.Go != nil && f.Go.Version != "" { + rawGoVersion.LoadOrStore(m, f.Go.Version) + summary.goVersionV = "v" + f.Go.Version + } + if len(f.Require) > 0 { + summary.require = make([]module.Version, 0, len(f.Require)) + for _, req := range f.Require { + summary.require = append(summary.require, req.Mod) + } + } + if len(f.Retract) > 0 { + summary.retract = make([]retraction, 0, len(f.Retract)) + for _, ret := range f.Retract { + summary.retract = append(summary.retract, retraction{ + VersionInterval: ret.VersionInterval, + Rationale: ret.Rationale, + }) + } + } + + return summary, nil +} diff --git a/src/cmd/go/internal/modload/mvs.go b/src/cmd/go/internal/modload/mvs.go index 67eb2c2e19..24856260d4 100644 --- a/src/cmd/go/internal/modload/mvs.go +++ b/src/cmd/go/internal/modload/mvs.go @@ -11,16 +11,10 @@ import ( "os" "path/filepath" "sort" - "sync" - "cmd/go/internal/base" - "cmd/go/internal/cfg" - "cmd/go/internal/lockedfile" "cmd/go/internal/modfetch" "cmd/go/internal/mvs" - "cmd/go/internal/par" - "golang.org/x/mod/modfile" "golang.org/x/mod/module" "golang.org/x/mod/semver" ) @@ -29,8 +23,6 @@ import ( // with any exclusions or replacements applied internally. type mvsReqs struct { buildList []module.Version - cache par.Cache - versions sync.Map } // Reqs returns the current module requirement graph. @@ -44,118 +36,21 @@ func Reqs() mvs.Reqs { } func (r *mvsReqs) Required(mod module.Version) ([]module.Version, error) { - type cached struct { - list []module.Version - err error - } - - c := r.cache.Do(mod, func() interface{} { - list, err := r.required(mod) - if err != nil { - return cached{nil, err} - } - for i, mv := range list { - if index != nil { - for index.exclude[mv] { - mv1, err := r.next(mv) - if err != nil { - return cached{nil, err} - } - if mv1.Version == "none" { - return cached{nil, fmt.Errorf("%s(%s) depends on excluded %s(%s) with no newer version available", mod.Path, mod.Version, mv.Path, mv.Version)} - } - mv = mv1 - } - } - list[i] = mv - } - - return cached{list, nil} - }).(cached) - - return c.list, c.err -} - -func (r *mvsReqs) modFileToList(f *modfile.File) []module.Version { - list := make([]module.Version, 0, len(f.Require)) - for _, r := range f.Require { - list = append(list, r.Mod) - } - return list -} - -// required returns a unique copy of the requirements of mod. -func (r *mvsReqs) required(mod module.Version) ([]module.Version, error) { if mod == Target { - if modFile != nil && modFile.Go != nil { - r.versions.LoadOrStore(mod, modFile.Go.Version) - } - return append([]module.Version(nil), r.buildList[1:]...), nil - } - - if cfg.BuildMod == "vendor" { - // For every module other than the target, - // return the full list of modules from modules.txt. - readVendorList() - return append([]module.Version(nil), vendorList...), nil - } - - origPath := mod.Path - if repl := Replacement(mod); repl.Path != "" { - if repl.Version == "" { - // TODO: need to slip the new version into the tags list etc. - dir := repl.Path - if !filepath.IsAbs(dir) { - dir = filepath.Join(ModRoot(), dir) - } - gomod := filepath.Join(dir, "go.mod") - data, err := lockedfile.Read(gomod) - if err != nil { - return nil, fmt.Errorf("parsing %s: %v", base.ShortPath(gomod), err) - } - f, err := modfile.ParseLax(gomod, data, nil) - if err != nil { - return nil, fmt.Errorf("parsing %s: %v", base.ShortPath(gomod), err) - } - if f.Go != nil { - r.versions.LoadOrStore(mod, f.Go.Version) - } - return r.modFileToList(f), nil - } - mod = repl + // Use the build list as it existed when r was constructed, not the current + // global build list. + return r.buildList[1:], nil } if mod.Version == "none" { return nil, nil } - if !semver.IsValid(mod.Version) { - // Disallow the broader queries supported by fetch.Lookup. - base.Fatalf("go: internal error: %s@%s: unexpected invalid semantic version", mod.Path, mod.Version) - } - - data, err := modfetch.GoMod(mod.Path, mod.Version) + summary, err := goModSummary(mod) if err != nil { return nil, err } - f, err := modfile.ParseLax("go.mod", data, nil) - if err != nil { - return nil, module.VersionError(mod, fmt.Errorf("parsing go.mod: %v", err)) - } - - if f.Module == nil { - return nil, module.VersionError(mod, errors.New("parsing go.mod: missing module line")) - } - if mpath := f.Module.Mod.Path; mpath != origPath && mpath != mod.Path { - return nil, module.VersionError(mod, fmt.Errorf(`parsing go.mod: - module declares its path as: %s - but was required as: %s`, mpath, origPath)) - } - if f.Go != nil { - r.versions.LoadOrStore(mod, f.Go.Version) - } - - return r.modFileToList(f), nil + return summary.require, nil } // Max returns the maximum of v1 and v2 according to semver.Compare. @@ -177,16 +72,29 @@ func (*mvsReqs) Upgrade(m module.Version) (module.Version, error) { return m, nil } -func versions(path string) ([]string, error) { +func versions(ctx context.Context, path string, allowed AllowedFunc) ([]string, error) { // Note: modfetch.Lookup and repo.Versions are cached, // so there's no need for us to add extra caching here. var versions []string err := modfetch.TryProxies(func(proxy string) error { repo, err := modfetch.Lookup(proxy, path) - if err == nil { - versions, err = repo.Versions("") + if err != nil { + return err + } + allVersions, err := repo.Versions("") + if err != nil { + return err + } + allowedVersions := make([]string, 0, len(allVersions)) + for _, v := range allVersions { + if err := allowed(ctx, module.Version{Path: path, Version: v}); err == nil { + allowedVersions = append(allowedVersions, v) + } else if !errors.Is(err, ErrDisallowed) { + return err + } } - return err + versions = allowedVersions + return nil }) return versions, err } @@ -194,7 +102,8 @@ func versions(path string) ([]string, error) { // Previous returns the tagged version of m.Path immediately prior to // m.Version, or version "none" if no prior version is tagged. func (*mvsReqs) Previous(m module.Version) (module.Version, error) { - list, err := versions(m.Path) + // TODO(golang.org/issue/38714): thread tracing context through MVS. + list, err := versions(context.TODO(), m.Path, CheckAllowed) if err != nil { return module.Version{}, err } @@ -209,7 +118,8 @@ func (*mvsReqs) Previous(m module.Version) (module.Version, error) { // It is only used by the exclusion processing in the Required method, // not called directly by MVS. func (*mvsReqs) next(m module.Version) (module.Version, error) { - list, err := versions(m.Path) + // TODO(golang.org/issue/38714): thread tracing context through MVS. + list, err := versions(context.TODO(), m.Path, CheckAllowed) if err != nil { return module.Version{}, err } diff --git a/src/cmd/go/internal/modload/query.go b/src/cmd/go/internal/modload/query.go index e82eb1506f..f67a738677 100644 --- a/src/cmd/go/internal/modload/query.go +++ b/src/cmd/go/internal/modload/query.go @@ -52,12 +52,16 @@ import ( // version that would otherwise be chosen. This prevents accidental downgrades // from newer pre-release or development versions. // -// If the allowed function is non-nil, Query excludes any versions for which -// allowed returns false. +// The allowed function (which may be nil) is used to filter out unsuitable +// versions (see AllowedFunc documentation for details). If the query refers to +// a specific revision (for example, "master"; see IsRevisionQuery), and the +// revision is disallowed by allowed, Query returns the error. If the query +// does not refer to a specific revision (for example, "latest"), Query +// acts as if versions disallowed by allowed do not exist. // // If path is the path of the main module and the query is "latest", // Query returns Target.Version as the version. -func Query(ctx context.Context, path, query, current string, allowed func(module.Version) bool) (*modfetch.RevInfo, error) { +func Query(ctx context.Context, path, query, current string, allowed AllowedFunc) (*modfetch.RevInfo, error) { var info *modfetch.RevInfo err := modfetch.TryProxies(func(proxy string) (err error) { info, err = queryProxy(ctx, proxy, path, query, current, allowed) @@ -66,6 +70,17 @@ func Query(ctx context.Context, path, query, current string, allowed func(module return info, err } +// AllowedFunc is used by Query and other functions to filter out unsuitable +// versions, for example, those listed in exclude directives in the main +// module's go.mod file. +// +// An AllowedFunc returns an error equivalent to ErrDisallowed for an unsuitable +// version. Any other error indicates the function was unable to determine +// whether the version should be allowed, for example, the function was unable +// to fetch or parse a go.mod file containing retractions. Typically, errors +// other than ErrDisallowd may be ignored. +type AllowedFunc func(context.Context, module.Version) error + var errQueryDisabled error = queryDisabledError{} type queryDisabledError struct{} @@ -77,7 +92,7 @@ func (queryDisabledError) Error() string { return fmt.Sprintf("cannot query module due to -mod=%s\n\t(%s)", cfg.BuildMod, cfg.BuildModReason) } -func queryProxy(ctx context.Context, proxy, path, query, current string, allowed func(module.Version) bool) (*modfetch.RevInfo, error) { +func queryProxy(ctx context.Context, proxy, path, query, current string, allowed AllowedFunc) (*modfetch.RevInfo, error) { ctx, span := trace.StartSpan(ctx, "modload.queryProxy "+path+" "+query) defer span.Done() @@ -88,7 +103,7 @@ func queryProxy(ctx context.Context, proxy, path, query, current string, allowed return nil, errQueryDisabled } if allowed == nil { - allowed = func(module.Version) bool { return true } + allowed = func(context.Context, module.Version) error { return nil } } // Parse query to detect parse errors (and possibly handle query) @@ -104,7 +119,8 @@ func queryProxy(ctx context.Context, proxy, path, query, current string, allowed return module.CheckPathMajor(v, pathMajor) == nil } var ( - ok func(module.Version) bool + match = func(m module.Version) bool { return true } + prefix string preferOlder bool mayUseLatest bool @@ -112,21 +128,18 @@ func queryProxy(ctx context.Context, proxy, path, query, current string, allowed ) switch { case query == "latest": - ok = allowed mayUseLatest = true case query == "upgrade": - ok = allowed mayUseLatest = true case query == "patch": if current == "" { - ok = allowed mayUseLatest = true } else { prefix = semver.MajorMinor(current) - ok = func(m module.Version) bool { - return matchSemverPrefix(prefix, m.Version) && allowed(m) + match = func(m module.Version) bool { + return matchSemverPrefix(prefix, m.Version) } } @@ -139,8 +152,8 @@ func queryProxy(ctx context.Context, proxy, path, query, current string, allowed // Refuse to say whether <=v1.2 allows v1.2.3 (remember, @v1.2 might mean v1.2.3). return nil, fmt.Errorf("ambiguous semantic version %q in range %q", v, query) } - ok = func(m module.Version) bool { - return semver.Compare(m.Version, v) <= 0 && allowed(m) + match = func(m module.Version) bool { + return semver.Compare(m.Version, v) <= 0 } if !matchesMajor(v) { preferIncompatible = true @@ -151,8 +164,8 @@ func queryProxy(ctx context.Context, proxy, path, query, current string, allowed if !semver.IsValid(v) { return badVersion(v) } - ok = func(m module.Version) bool { - return semver.Compare(m.Version, v) < 0 && allowed(m) + match = func(m module.Version) bool { + return semver.Compare(m.Version, v) < 0 } if !matchesMajor(v) { preferIncompatible = true @@ -163,8 +176,8 @@ func queryProxy(ctx context.Context, proxy, path, query, current string, allowed if !semver.IsValid(v) { return badVersion(v) } - ok = func(m module.Version) bool { - return semver.Compare(m.Version, v) >= 0 && allowed(m) + match = func(m module.Version) bool { + return semver.Compare(m.Version, v) >= 0 } preferOlder = true if !matchesMajor(v) { @@ -180,8 +193,8 @@ func queryProxy(ctx context.Context, proxy, path, query, current string, allowed // Refuse to say whether >v1.2 allows v1.2.3 (remember, @v1.2 might mean v1.2.3). return nil, fmt.Errorf("ambiguous semantic version %q in range %q", v, query) } - ok = func(m module.Version) bool { - return semver.Compare(m.Version, v) > 0 && allowed(m) + match = func(m module.Version) bool { + return semver.Compare(m.Version, v) > 0 } preferOlder = true if !matchesMajor(v) { @@ -189,8 +202,8 @@ func queryProxy(ctx context.Context, proxy, path, query, current string, allowed } case semver.IsValid(query) && isSemverPrefix(query): - ok = func(m module.Version) bool { - return matchSemverPrefix(query, m.Version) && allowed(m) + match = func(m module.Version) bool { + return matchSemverPrefix(query, m.Version) } prefix = query + "." if !matchesMajor(query) { @@ -219,8 +232,8 @@ func queryProxy(ctx context.Context, proxy, path, query, current string, allowed return nil, queryErr } } - if !allowed(module.Version{Path: path, Version: info.Version}) { - return nil, fmt.Errorf("%s@%s excluded", path, info.Version) + if err := allowed(ctx, module.Version{Path: path, Version: info.Version}); errors.Is(err, ErrDisallowed) { + return nil, err } return info, nil } @@ -229,8 +242,8 @@ func queryProxy(ctx context.Context, proxy, path, query, current string, allowed if query != "latest" { return nil, fmt.Errorf("can't query specific version (%q) for the main module (%s)", query, path) } - if !allowed(Target) { - return nil, fmt.Errorf("internal error: main module version is not allowed") + if err := allowed(ctx, Target); err != nil { + return nil, fmt.Errorf("internal error: main module version is not allowed: %w", err) } return &modfetch.RevInfo{Version: Target.Version}, nil } @@ -248,7 +261,13 @@ func queryProxy(ctx context.Context, proxy, path, query, current string, allowed if err != nil { return nil, err } - releases, prereleases, err := filterVersions(ctx, path, versions, ok, preferIncompatible) + matchAndAllowed := func(ctx context.Context, m module.Version) error { + if !match(m) { + return ErrDisallowed + } + return allowed(ctx, m) + } + releases, prereleases, err := filterVersions(ctx, path, versions, matchAndAllowed, preferIncompatible) if err != nil { return nil, err } @@ -288,11 +307,12 @@ func queryProxy(ctx context.Context, proxy, path, query, current string, allowed } if mayUseLatest { - // Special case for "latest": if no tags match, use latest commit in repo, - // provided it is not excluded. + // Special case for "latest": if no tags match, use latest commit in repo + // if it is allowed. latest, err := repo.Latest() if err == nil { - if allowed(module.Version{Path: path, Version: latest.Version}) { + m := module.Version{Path: path, Version: latest.Version} + if err := allowed(ctx, m); !errors.Is(err, ErrDisallowed) { return lookup(latest.Version) } } else if !errors.Is(err, os.ErrNotExist) { @@ -303,6 +323,22 @@ func queryProxy(ctx context.Context, proxy, path, query, current string, allowed return nil, &NoMatchingVersionError{query: query, current: current} } +// IsRevisionQuery returns true if vers is a version query that may refer to +// a particular version or revision in a repository like "v1.0.0", "master", +// or "0123abcd". IsRevisionQuery returns false if vers is a query that +// chooses from among available versions like "latest" or ">v1.0.0". +func IsRevisionQuery(vers string) bool { + if vers == "latest" || + vers == "upgrade" || + vers == "patch" || + strings.HasPrefix(vers, "<") || + strings.HasPrefix(vers, ">") || + (semver.IsValid(vers) && isSemverPrefix(vers)) { + return false + } + return true +} + // isSemverPrefix reports whether v is a semantic version prefix: v1 or v1.2 (not v1.2.3). // The caller is assumed to have checked that semver.IsValid(v) is true. func isSemverPrefix(v string) bool { @@ -329,13 +365,16 @@ func matchSemverPrefix(p, v string) bool { // filterVersions classifies versions into releases and pre-releases, filtering // out: -// 1. versions that do not satisfy the 'ok' predicate, and +// 1. versions that do not satisfy the 'allowed' predicate, and // 2. "+incompatible" versions, if a compatible one satisfies the predicate // and the incompatible version is not preferred. -func filterVersions(ctx context.Context, path string, versions []string, ok func(module.Version) bool, preferIncompatible bool) (releases, prereleases []string, err error) { +// +// If the allowed predicate returns an error not equivalent to ErrDisallowed, +// filterVersions returns that error. +func filterVersions(ctx context.Context, path string, versions []string, allowed AllowedFunc, preferIncompatible bool) (releases, prereleases []string, err error) { var lastCompatible string for _, v := range versions { - if !ok(module.Version{Path: path, Version: v}) { + if err := allowed(ctx, module.Version{Path: path, Version: v}); errors.Is(err, ErrDisallowed) { continue } @@ -385,7 +424,7 @@ type QueryResult struct { // If the package is in the main module, QueryPackage considers only the main // module and only the version "latest", without checking for other possible // modules. -func QueryPackage(ctx context.Context, path, query string, allowed func(module.Version) bool) ([]QueryResult, error) { +func QueryPackage(ctx context.Context, path, query string, allowed AllowedFunc) ([]QueryResult, error) { m := search.NewMatch(path) if m.IsLocal() || !m.IsLiteral() { return nil, fmt.Errorf("pattern %s is not an importable package", path) @@ -406,7 +445,7 @@ func QueryPackage(ctx context.Context, path, query string, allowed func(module.V // If any matching package is in the main module, QueryPattern considers only // the main module and only the version "latest", without checking for other // possible modules. -func QueryPattern(ctx context.Context, pattern, query string, allowed func(module.Version) bool) ([]QueryResult, error) { +func QueryPattern(ctx context.Context, pattern, query string, allowed AllowedFunc) ([]QueryResult, error) { ctx, span := trace.StartSpan(ctx, "modload.QueryPattern "+pattern+" "+query) defer span.Done() @@ -450,8 +489,8 @@ func QueryPattern(ctx context.Context, pattern, query string, allowed func(modul if query != "latest" { return nil, fmt.Errorf("can't query specific version for package %s in the main module (%s)", pattern, Target.Path) } - if !allowed(Target) { - return nil, fmt.Errorf("internal error: package %s is in the main module (%s), but version is not allowed", pattern, Target.Path) + if err := allowed(ctx, Target); err != nil { + return nil, fmt.Errorf("internal error: package %s is in the main module (%s), but version is not allowed: %w", pattern, Target.Path, err) } return []QueryResult{{ Mod: Target, diff --git a/src/cmd/go/internal/modload/query_test.go b/src/cmd/go/internal/modload/query_test.go index 77080e9b5b..351826f2ab 100644 --- a/src/cmd/go/internal/modload/query_test.go +++ b/src/cmd/go/internal/modload/query_test.go @@ -187,9 +187,11 @@ func TestQuery(t *testing.T) { if allow == "" { allow = "*" } - allowed := func(m module.Version) bool { - ok, _ := path.Match(allow, m.Version) - return ok + allowed := func(ctx context.Context, m module.Version) error { + if ok, _ := path.Match(allow, m.Version); !ok { + return ErrDisallowed + } + return nil } tt := tt t.Run(strings.ReplaceAll(tt.path, "/", "_")+"/"+tt.query+"/"+tt.current+"/"+allow, func(t *testing.T) { diff --git a/src/cmd/go/internal/modload/vendor.go b/src/cmd/go/internal/modload/vendor.go index 71f68efbcc..9f34b829fc 100644 --- a/src/cmd/go/internal/modload/vendor.go +++ b/src/cmd/go/internal/modload/vendor.go @@ -133,7 +133,7 @@ func checkVendorConsistency() { readVendorList() pre114 := false - if modFile.Go == nil || semver.Compare("v"+modFile.Go.Version, "v1.14") < 0 { + if semver.Compare(index.goVersionV, "v1.14") < 0 { // Go versions before 1.14 did not include enough information in // vendor/modules.txt to check for consistency. // If we know that we're on an earlier version, relax the consistency check. @@ -150,6 +150,8 @@ func checkVendorConsistency() { } } + // Iterate over the Require directives in their original (not indexed) order + // so that the errors match the original file. for _, r := range modFile.Require { if !vendorMeta[r.Mod].Explicit { if pre114 { diff --git a/src/cmd/go/internal/mvs/errors.go b/src/cmd/go/internal/mvs/errors.go new file mode 100644 index 0000000000..5564965fb5 --- /dev/null +++ b/src/cmd/go/internal/mvs/errors.go @@ -0,0 +1,101 @@ +// Copyright 2020 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package mvs + +import ( + "fmt" + "strings" + + "golang.org/x/mod/module" +) + +// BuildListError decorates an error that occurred gathering requirements +// while constructing a build list. BuildListError prints the chain +// of requirements to the module where the error occurred. +type BuildListError struct { + Err error + stack []buildListErrorElem +} + +type buildListErrorElem struct { + m module.Version + + // nextReason is the reason this module depends on the next module in the + // stack. Typically either "requires", or "updating to". + nextReason string +} + +// NewBuildListError returns a new BuildListError wrapping an error that +// occurred at a module found along the given path of requirements and/or +// upgrades, which must be non-empty. +// +// The isUpgrade function reports whether a path step is due to an upgrade. +// A nil isUpgrade function indicates that none of the path steps are due to upgrades. +func NewBuildListError(err error, path []module.Version, isUpgrade func(from, to module.Version) bool) *BuildListError { + stack := make([]buildListErrorElem, 0, len(path)) + for len(path) > 1 { + reason := "requires" + if isUpgrade != nil && isUpgrade(path[0], path[1]) { + reason = "updating to" + } + stack = append(stack, buildListErrorElem{ + m: path[0], + nextReason: reason, + }) + path = path[1:] + } + stack = append(stack, buildListErrorElem{m: path[0]}) + + return &BuildListError{ + Err: err, + stack: stack, + } +} + +// Module returns the module where the error occurred. If the module stack +// is empty, this returns a zero value. +func (e *BuildListError) Module() module.Version { + if len(e.stack) == 0 { + return module.Version{} + } + return e.stack[len(e.stack)-1].m +} + +func (e *BuildListError) Error() string { + b := &strings.Builder{} + stack := e.stack + + // Don't print modules at the beginning of the chain without a + // version. These always seem to be the main module or a + // synthetic module ("target@"). + for len(stack) > 0 && stack[0].m.Version == "" { + stack = stack[1:] + } + + if len(stack) == 0 { + b.WriteString(e.Err.Error()) + } else { + for _, elem := range stack[:len(stack)-1] { + fmt.Fprintf(b, "%s %s\n\t", elem.m, elem.nextReason) + } + // Ensure that the final module path and version are included as part of the + // error message. + m := stack[len(stack)-1].m + if mErr, ok := e.Err.(*module.ModuleError); ok { + actual := module.Version{Path: mErr.Path, Version: mErr.Version} + if v, ok := mErr.Err.(*module.InvalidVersionError); ok { + actual.Version = v.Version + } + if actual == m { + fmt.Fprintf(b, "%v", e.Err) + } else { + fmt.Fprintf(b, "%s (replaced by %s): %v", m, actual, mErr.Err) + } + } else { + fmt.Fprintf(b, "%v", module.VersionError(m, e.Err)) + } + } + return b.String() +} diff --git a/src/cmd/go/internal/mvs/mvs.go b/src/cmd/go/internal/mvs/mvs.go index 1f8eaa1f60..ea23a9f45e 100644 --- a/src/cmd/go/internal/mvs/mvs.go +++ b/src/cmd/go/internal/mvs/mvs.go @@ -9,7 +9,6 @@ package mvs import ( "fmt" "sort" - "strings" "sync" "sync/atomic" @@ -61,59 +60,6 @@ type Reqs interface { Previous(m module.Version) (module.Version, error) } -// BuildListError decorates an error that occurred gathering requirements -// while constructing a build list. BuildListError prints the chain -// of requirements to the module where the error occurred. -type BuildListError struct { - Err error - stack []buildListErrorElem -} - -type buildListErrorElem struct { - m module.Version - - // nextReason is the reason this module depends on the next module in the - // stack. Typically either "requires", or "upgraded to". - nextReason string -} - -// Module returns the module where the error occurred. If the module stack -// is empty, this returns a zero value. -func (e *BuildListError) Module() module.Version { - if len(e.stack) == 0 { - return module.Version{} - } - return e.stack[0].m -} - -func (e *BuildListError) Error() string { - b := &strings.Builder{} - stack := e.stack - - // Don't print modules at the beginning of the chain without a - // version. These always seem to be the main module or a - // synthetic module ("target@"). - for len(stack) > 0 && stack[len(stack)-1].m.Version == "" { - stack = stack[:len(stack)-1] - } - - for i := len(stack) - 1; i >= 1; i-- { - fmt.Fprintf(b, "%s@%s %s\n\t", stack[i].m.Path, stack[i].m.Version, stack[i].nextReason) - } - if len(stack) == 0 { - b.WriteString(e.Err.Error()) - } else { - // Ensure that the final module path and version are included as part of the - // error message. - if _, ok := e.Err.(*module.ModuleError); ok { - fmt.Fprintf(b, "%v", e.Err) - } else { - fmt.Fprintf(b, "%v", module.VersionError(stack[0].m, e.Err)) - } - } - return b.String() -} - // BuildList returns the build list for the target module. // // target is the root vertex of a module requirement graph. For cmd/go, this is @@ -202,18 +148,30 @@ func buildList(target module.Version, reqs Reqs, upgrade func(module.Version) (m q = q[1:] if node.err != nil { - err := &BuildListError{ - Err: node.err, - stack: []buildListErrorElem{{m: node.m}}, - } + pathUpgrade := map[module.Version]module.Version{} + + // Construct the error path reversed (from the error to the main module), + // then reverse it to obtain the usual order (from the main module to + // the error). + errPath := []module.Version{node.m} for n, prev := neededBy[node], node; n != nil; n, prev = neededBy[n], n { - reason := "requires" if n.upgrade == prev.m { - reason = "updating to" + pathUpgrade[n.m] = prev.m } - err.stack = append(err.stack, buildListErrorElem{m: n.m, nextReason: reason}) + errPath = append(errPath, n.m) } - return nil, err + i, j := 0, len(errPath)-1 + for i < j { + errPath[i], errPath[j] = errPath[j], errPath[i] + i++ + j-- + } + + isUpgrade := func(from, to module.Version) bool { + return pathUpgrade[from] == to + } + + return nil, NewBuildListError(node.err, errPath, isUpgrade) } neighbors := node.required diff --git a/src/cmd/go/internal/par/queue.go b/src/cmd/go/internal/par/queue.go new file mode 100644 index 0000000000..180bc75e34 --- /dev/null +++ b/src/cmd/go/internal/par/queue.go @@ -0,0 +1,88 @@ +// Copyright 2020 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package par + +import "fmt" + +// Queue manages a set of work items to be executed in parallel. The number of +// active work items is limited, and excess items are queued sequentially. +type Queue struct { + maxActive int + st chan queueState +} + +type queueState struct { + active int // number of goroutines processing work; always nonzero when len(backlog) > 0 + backlog []func() + idle chan struct{} // if non-nil, closed when active becomes 0 +} + +// NewQueue returns a Queue that executes up to maxActive items in parallel. +// +// maxActive must be positive. +func NewQueue(maxActive int) *Queue { + if maxActive < 1 { + panic(fmt.Sprintf("par.NewQueue called with nonpositive limit (%d)", maxActive)) + } + + q := &Queue{ + maxActive: maxActive, + st: make(chan queueState, 1), + } + q.st <- queueState{} + return q +} + +// Add adds f as a work item in the queue. +// +// Add returns immediately, but the queue will be marked as non-idle until after +// f (and any subsequently-added work) has completed. +func (q *Queue) Add(f func()) { + st := <-q.st + if st.active == q.maxActive { + st.backlog = append(st.backlog, f) + q.st <- st + return + } + if st.active == 0 { + // Mark q as non-idle. + st.idle = nil + } + st.active++ + q.st <- st + + go func() { + for { + f() + + st := <-q.st + if len(st.backlog) == 0 { + if st.active--; st.active == 0 && st.idle != nil { + close(st.idle) + } + q.st <- st + return + } + f, st.backlog = st.backlog[0], st.backlog[1:] + q.st <- st + } + }() +} + +// Idle returns a channel that will be closed when q has no (active or enqueued) +// work outstanding. +func (q *Queue) Idle() <-chan struct{} { + st := <-q.st + defer func() { q.st <- st }() + + if st.idle == nil { + st.idle = make(chan struct{}) + if st.active == 0 { + close(st.idle) + } + } + + return st.idle +} diff --git a/src/cmd/go/internal/par/queue_test.go b/src/cmd/go/internal/par/queue_test.go new file mode 100644 index 0000000000..1331e65f98 --- /dev/null +++ b/src/cmd/go/internal/par/queue_test.go @@ -0,0 +1,79 @@ +// Copyright 2020 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package par + +import ( + "sync" + "testing" +) + +func TestQueueIdle(t *testing.T) { + q := NewQueue(1) + select { + case <-q.Idle(): + default: + t.Errorf("NewQueue(1) is not initially idle.") + } + + started := make(chan struct{}) + unblock := make(chan struct{}) + q.Add(func() { + close(started) + <-unblock + }) + + <-started + idle := q.Idle() + select { + case <-idle: + t.Errorf("NewQueue(1) is marked idle while processing work.") + default: + } + + close(unblock) + <-idle // Should be closed as soon as the Add callback returns. +} + +func TestQueueBacklog(t *testing.T) { + const ( + maxActive = 2 + totalWork = 3 * maxActive + ) + + q := NewQueue(maxActive) + t.Logf("q = NewQueue(%d)", maxActive) + + var wg sync.WaitGroup + wg.Add(totalWork) + started := make([]chan struct{}, totalWork) + unblock := make(chan struct{}) + for i := range started { + started[i] = make(chan struct{}) + i := i + q.Add(func() { + close(started[i]) + <-unblock + wg.Done() + }) + } + + for i, c := range started { + if i < maxActive { + <-c // Work item i should be started immediately. + } else { + select { + case <-c: + t.Errorf("Work item %d started before previous items finished.", i) + default: + } + } + } + + close(unblock) + for _, c := range started[maxActive:] { + <-c + } + wg.Wait() +} diff --git a/src/cmd/go/internal/str/str_test.go b/src/cmd/go/internal/str/str_test.go new file mode 100644 index 0000000000..147ce1a63e --- /dev/null +++ b/src/cmd/go/internal/str/str_test.go @@ -0,0 +1,27 @@ +// Copyright 2020 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package str + +import "testing" + +var foldDupTests = []struct { + list []string + f1, f2 string +}{ + {StringList("math/rand", "math/big"), "", ""}, + {StringList("math", "strings"), "", ""}, + {StringList("strings"), "", ""}, + {StringList("strings", "strings"), "strings", "strings"}, + {StringList("Rand", "rand", "math", "math/rand", "math/Rand"), "Rand", "rand"}, +} + +func TestFoldDup(t *testing.T) { + for _, tt := range foldDupTests { + f1, f2 := FoldDup(tt.list) + if f1 != tt.f1 || f2 != tt.f2 { + t.Errorf("foldDup(%q) = %q, %q, want %q, %q", tt.list, f1, f2, tt.f1, tt.f2) + } + } +} diff --git a/src/cmd/go/internal/test/flagdefs_test.go b/src/cmd/go/internal/test/flagdefs_test.go index 7562415298..ab5440b380 100644 --- a/src/cmd/go/internal/test/flagdefs_test.go +++ b/src/cmd/go/internal/test/flagdefs_test.go @@ -16,9 +16,14 @@ func TestPassFlagToTestIncludesAllTestFlags(t *testing.T) { return } name := strings.TrimPrefix(f.Name, "test.") - if name != "testlogfile" && !passFlagToTest[name] { - t.Errorf("passFlagToTest missing entry for %q (flag test.%s)", name, name) - t.Logf("(Run 'go generate cmd/go/internal/test' if it should be added.)") + switch name { + case "testlogfile", "paniconexit0": + // These are internal flags. + default: + if !passFlagToTest[name] { + t.Errorf("passFlagToTest missing entry for %q (flag test.%s)", name, name) + t.Logf("(Run 'go generate cmd/go/internal/test' if it should be added.)") + } } }) diff --git a/src/cmd/go/internal/test/genflags.go b/src/cmd/go/internal/test/genflags.go index 512fa1671e..5e83d53980 100644 --- a/src/cmd/go/internal/test/genflags.go +++ b/src/cmd/go/internal/test/genflags.go @@ -62,9 +62,10 @@ func testFlags() []string { } name := strings.TrimPrefix(f.Name, "test.") - if name == "testlogfile" { - // test.testlogfile is “for use only by cmd/go” - } else { + switch name { + case "testlogfile", "paniconexit0": + // These flags are only for use by cmd/go. + default: names = append(names, name) } }) diff --git a/src/cmd/go/internal/test/test.go b/src/cmd/go/internal/test/test.go index 3aee6939d2..1ea6d2881e 100644 --- a/src/cmd/go/internal/test/test.go +++ b/src/cmd/go/internal/test/test.go @@ -1164,7 +1164,8 @@ func (c *runCache) builderRunTest(b *work.Builder, ctx context.Context, a *work. if !c.disableCache && len(execCmd) == 0 { testlogArg = []string{"-test.testlogfile=" + a.Objdir + "testlog.txt"} } - args := str.StringList(execCmd, a.Deps[0].BuiltTarget(), testlogArg, testArgs) + panicArg := "-test.paniconexit0" + args := str.StringList(execCmd, a.Deps[0].BuiltTarget(), testlogArg, panicArg, testArgs) if testCoverProfile != "" { // Write coverage to temporary profile, for merging later. diff --git a/src/cmd/go/internal/get/discovery.go b/src/cmd/go/internal/vcs/discovery.go index afa6ef455f..327b44cb9a 100644 --- a/src/cmd/go/internal/get/discovery.go +++ b/src/cmd/go/internal/vcs/discovery.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -package get +package vcs import ( "encoding/xml" diff --git a/src/cmd/go/internal/get/pkg_test.go b/src/cmd/go/internal/vcs/discovery_test.go index fc6a179c2e..eb99fdf64c 100644 --- a/src/cmd/go/internal/get/pkg_test.go +++ b/src/cmd/go/internal/vcs/discovery_test.go @@ -2,35 +2,14 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -package get +package vcs import ( - "cmd/go/internal/str" "reflect" "strings" "testing" ) -var foldDupTests = []struct { - list []string - f1, f2 string -}{ - {str.StringList("math/rand", "math/big"), "", ""}, - {str.StringList("math", "strings"), "", ""}, - {str.StringList("strings"), "", ""}, - {str.StringList("strings", "strings"), "strings", "strings"}, - {str.StringList("Rand", "rand", "math", "math/rand", "math/Rand"), "Rand", "rand"}, -} - -func TestFoldDup(t *testing.T) { - for _, tt := range foldDupTests { - f1, f2 := str.FoldDup(tt.list) - if f1 != tt.f1 || f2 != tt.f2 { - t.Errorf("foldDup(%q) = %q, %q, want %q, %q", tt.list, f1, f2, tt.f1, tt.f2) - } - } -} - var parseMetaGoImportsTests = []struct { in string mod ModuleMode diff --git a/src/cmd/go/internal/get/vcs.go b/src/cmd/go/internal/vcs/vcs.go index fd37fcb76f..e535998d89 100644 --- a/src/cmd/go/internal/get/vcs.go +++ b/src/cmd/go/internal/vcs/vcs.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -package get +package vcs import ( "encoding/json" @@ -27,23 +27,23 @@ import ( // A vcsCmd describes how to use a version control system // like Mercurial, Git, or Subversion. -type vcsCmd struct { - name string - cmd string // name of binary to invoke command +type Cmd struct { + Name string + Cmd string // name of binary to invoke command - createCmd []string // commands to download a fresh copy of a repository - downloadCmd []string // commands to download updates into an existing repository + CreateCmd []string // commands to download a fresh copy of a repository + DownloadCmd []string // commands to download updates into an existing repository - tagCmd []tagCmd // commands to list tags - tagLookupCmd []tagCmd // commands to lookup tags before running tagSyncCmd - tagSyncCmd []string // commands to sync to specific tag - tagSyncDefault []string // commands to sync to default tag + TagCmd []tagCmd // commands to list tags + TagLookupCmd []tagCmd // commands to lookup tags before running tagSyncCmd + TagSyncCmd []string // commands to sync to specific tag + TagSyncDefault []string // commands to sync to default tag - scheme []string - pingCmd string + Scheme []string + PingCmd string - remoteRepo func(v *vcsCmd, rootDir string) (remoteRepo string, err error) - resolveRepo func(v *vcsCmd, rootDir, remoteRepo string) (realRepo string, err error) + RemoteRepo func(v *Cmd, rootDir string) (remoteRepo string, err error) + ResolveRepo func(v *Cmd, rootDir, remoteRepo string) (realRepo string, err error) } var defaultSecureScheme = map[string]bool{ @@ -54,7 +54,7 @@ var defaultSecureScheme = map[string]bool{ "ssh": true, } -func (v *vcsCmd) isSecure(repo string) bool { +func (v *Cmd) IsSecure(repo string) bool { u, err := urlpkg.Parse(repo) if err != nil { // If repo is not a URL, it's not secure. @@ -63,8 +63,8 @@ func (v *vcsCmd) isSecure(repo string) bool { return v.isSecureScheme(u.Scheme) } -func (v *vcsCmd) isSecureScheme(scheme string) bool { - switch v.cmd { +func (v *Cmd) isSecureScheme(scheme string) bool { + switch v.Cmd { case "git": // GIT_ALLOW_PROTOCOL is an environment variable defined by Git. It is a // colon-separated list of schemes that are allowed to be used with git @@ -89,7 +89,7 @@ type tagCmd struct { } // vcsList lists the known version control systems -var vcsList = []*vcsCmd{ +var vcsList = []*Cmd{ vcsHg, vcsGit, vcsSvn, @@ -97,11 +97,15 @@ var vcsList = []*vcsCmd{ vcsFossil, } +// vcsMod is a stub for the "mod" scheme. It's returned by +// repoRootForImportPathDynamic, but is otherwise not treated as a VCS command. +var vcsMod = &Cmd{Name: "mod"} + // vcsByCmd returns the version control system for the given // command name (hg, git, svn, bzr). -func vcsByCmd(cmd string) *vcsCmd { +func vcsByCmd(cmd string) *Cmd { for _, vcs := range vcsList { - if vcs.cmd == cmd { + if vcs.Cmd == cmd { return vcs } } @@ -109,31 +113,31 @@ func vcsByCmd(cmd string) *vcsCmd { } // vcsHg describes how to use Mercurial. -var vcsHg = &vcsCmd{ - name: "Mercurial", - cmd: "hg", +var vcsHg = &Cmd{ + Name: "Mercurial", + Cmd: "hg", - createCmd: []string{"clone -U -- {repo} {dir}"}, - downloadCmd: []string{"pull"}, + CreateCmd: []string{"clone -U -- {repo} {dir}"}, + DownloadCmd: []string{"pull"}, // We allow both tag and branch names as 'tags' // for selecting a version. This lets people have // a go.release.r60 branch and a go1 branch // and make changes in both, without constantly // editing .hgtags. - tagCmd: []tagCmd{ + TagCmd: []tagCmd{ {"tags", `^(\S+)`}, {"branches", `^(\S+)`}, }, - tagSyncCmd: []string{"update -r {tag}"}, - tagSyncDefault: []string{"update default"}, + TagSyncCmd: []string{"update -r {tag}"}, + TagSyncDefault: []string{"update default"}, - scheme: []string{"https", "http", "ssh"}, - pingCmd: "identify -- {scheme}://{repo}", - remoteRepo: hgRemoteRepo, + Scheme: []string{"https", "http", "ssh"}, + PingCmd: "identify -- {scheme}://{repo}", + RemoteRepo: hgRemoteRepo, } -func hgRemoteRepo(vcsHg *vcsCmd, rootDir string) (remoteRepo string, err error) { +func hgRemoteRepo(vcsHg *Cmd, rootDir string) (remoteRepo string, err error) { out, err := vcsHg.runOutput(rootDir, "paths default") if err != nil { return "", err @@ -142,45 +146,45 @@ func hgRemoteRepo(vcsHg *vcsCmd, rootDir string) (remoteRepo string, err error) } // vcsGit describes how to use Git. -var vcsGit = &vcsCmd{ - name: "Git", - cmd: "git", +var vcsGit = &Cmd{ + Name: "Git", + Cmd: "git", - createCmd: []string{"clone -- {repo} {dir}", "-go-internal-cd {dir} submodule update --init --recursive"}, - downloadCmd: []string{"pull --ff-only", "submodule update --init --recursive"}, + CreateCmd: []string{"clone -- {repo} {dir}", "-go-internal-cd {dir} submodule update --init --recursive"}, + DownloadCmd: []string{"pull --ff-only", "submodule update --init --recursive"}, - tagCmd: []tagCmd{ + TagCmd: []tagCmd{ // tags/xxx matches a git tag named xxx // origin/xxx matches a git branch named xxx on the default remote repository {"show-ref", `(?:tags|origin)/(\S+)$`}, }, - tagLookupCmd: []tagCmd{ + TagLookupCmd: []tagCmd{ {"show-ref tags/{tag} origin/{tag}", `((?:tags|origin)/\S+)$`}, }, - tagSyncCmd: []string{"checkout {tag}", "submodule update --init --recursive"}, + TagSyncCmd: []string{"checkout {tag}", "submodule update --init --recursive"}, // both createCmd and downloadCmd update the working dir. // No need to do more here. We used to 'checkout master' // but that doesn't work if the default branch is not named master. // DO NOT add 'checkout master' here. // See golang.org/issue/9032. - tagSyncDefault: []string{"submodule update --init --recursive"}, + TagSyncDefault: []string{"submodule update --init --recursive"}, - scheme: []string{"git", "https", "http", "git+ssh", "ssh"}, + Scheme: []string{"git", "https", "http", "git+ssh", "ssh"}, // Leave out the '--' separator in the ls-remote command: git 2.7.4 does not // support such a separator for that command, and this use should be safe // without it because the {scheme} value comes from the predefined list above. // See golang.org/issue/33836. - pingCmd: "ls-remote {scheme}://{repo}", + PingCmd: "ls-remote {scheme}://{repo}", - remoteRepo: gitRemoteRepo, + RemoteRepo: gitRemoteRepo, } // scpSyntaxRe matches the SCP-like addresses used by Git to access // repositories by SSH. var scpSyntaxRe = lazyregexp.New(`^([a-zA-Z0-9_]+)@([a-zA-Z0-9._-]+):(.*)$`) -func gitRemoteRepo(vcsGit *vcsCmd, rootDir string) (remoteRepo string, err error) { +func gitRemoteRepo(vcsGit *Cmd, rootDir string) (remoteRepo string, err error) { cmd := "config remote.origin.url" errParse := errors.New("unable to parse output of git " + cmd) errRemoteOriginNotFound := errors.New("remote origin not found") @@ -216,7 +220,7 @@ func gitRemoteRepo(vcsGit *vcsCmd, rootDir string) (remoteRepo string, err error // Iterate over insecure schemes too, because this function simply // reports the state of the repo. If we can't see insecure schemes then // we can't report the actual repo URL. - for _, s := range vcsGit.scheme { + for _, s := range vcsGit.Scheme { if repoURL.Scheme == s { return repoURL.String(), nil } @@ -225,27 +229,27 @@ func gitRemoteRepo(vcsGit *vcsCmd, rootDir string) (remoteRepo string, err error } // vcsBzr describes how to use Bazaar. -var vcsBzr = &vcsCmd{ - name: "Bazaar", - cmd: "bzr", +var vcsBzr = &Cmd{ + Name: "Bazaar", + Cmd: "bzr", - createCmd: []string{"branch -- {repo} {dir}"}, + CreateCmd: []string{"branch -- {repo} {dir}"}, // Without --overwrite bzr will not pull tags that changed. // Replace by --overwrite-tags after http://pad.lv/681792 goes in. - downloadCmd: []string{"pull --overwrite"}, + DownloadCmd: []string{"pull --overwrite"}, - tagCmd: []tagCmd{{"tags", `^(\S+)`}}, - tagSyncCmd: []string{"update -r {tag}"}, - tagSyncDefault: []string{"update -r revno:-1"}, + TagCmd: []tagCmd{{"tags", `^(\S+)`}}, + TagSyncCmd: []string{"update -r {tag}"}, + TagSyncDefault: []string{"update -r revno:-1"}, - scheme: []string{"https", "http", "bzr", "bzr+ssh"}, - pingCmd: "info -- {scheme}://{repo}", - remoteRepo: bzrRemoteRepo, - resolveRepo: bzrResolveRepo, + Scheme: []string{"https", "http", "bzr", "bzr+ssh"}, + PingCmd: "info -- {scheme}://{repo}", + RemoteRepo: bzrRemoteRepo, + ResolveRepo: bzrResolveRepo, } -func bzrRemoteRepo(vcsBzr *vcsCmd, rootDir string) (remoteRepo string, err error) { +func bzrRemoteRepo(vcsBzr *Cmd, rootDir string) (remoteRepo string, err error) { outb, err := vcsBzr.runOutput(rootDir, "config parent_location") if err != nil { return "", err @@ -253,7 +257,7 @@ func bzrRemoteRepo(vcsBzr *vcsCmd, rootDir string) (remoteRepo string, err error return strings.TrimSpace(string(outb)), nil } -func bzrResolveRepo(vcsBzr *vcsCmd, rootDir, remoteRepo string) (realRepo string, err error) { +func bzrResolveRepo(vcsBzr *Cmd, rootDir, remoteRepo string) (realRepo string, err error) { outb, err := vcsBzr.runOutput(rootDir, "info "+remoteRepo) if err != nil { return "", err @@ -287,22 +291,22 @@ func bzrResolveRepo(vcsBzr *vcsCmd, rootDir, remoteRepo string) (realRepo string } // vcsSvn describes how to use Subversion. -var vcsSvn = &vcsCmd{ - name: "Subversion", - cmd: "svn", +var vcsSvn = &Cmd{ + Name: "Subversion", + Cmd: "svn", - createCmd: []string{"checkout -- {repo} {dir}"}, - downloadCmd: []string{"update"}, + CreateCmd: []string{"checkout -- {repo} {dir}"}, + DownloadCmd: []string{"update"}, // There is no tag command in subversion. // The branch information is all in the path names. - scheme: []string{"https", "http", "svn", "svn+ssh"}, - pingCmd: "info -- {scheme}://{repo}", - remoteRepo: svnRemoteRepo, + Scheme: []string{"https", "http", "svn", "svn+ssh"}, + PingCmd: "info -- {scheme}://{repo}", + RemoteRepo: svnRemoteRepo, } -func svnRemoteRepo(vcsSvn *vcsCmd, rootDir string) (remoteRepo string, err error) { +func svnRemoteRepo(vcsSvn *Cmd, rootDir string) (remoteRepo string, err error) { outb, err := vcsSvn.runOutput(rootDir, "info") if err != nil { return "", err @@ -337,22 +341,22 @@ func svnRemoteRepo(vcsSvn *vcsCmd, rootDir string) (remoteRepo string, err error const fossilRepoName = ".fossil" // vcsFossil describes how to use Fossil (fossil-scm.org) -var vcsFossil = &vcsCmd{ - name: "Fossil", - cmd: "fossil", +var vcsFossil = &Cmd{ + Name: "Fossil", + Cmd: "fossil", - createCmd: []string{"-go-internal-mkdir {dir} clone -- {repo} " + filepath.Join("{dir}", fossilRepoName), "-go-internal-cd {dir} open .fossil"}, - downloadCmd: []string{"up"}, + CreateCmd: []string{"-go-internal-mkdir {dir} clone -- {repo} " + filepath.Join("{dir}", fossilRepoName), "-go-internal-cd {dir} open .fossil"}, + DownloadCmd: []string{"up"}, - tagCmd: []tagCmd{{"tag ls", `(.*)`}}, - tagSyncCmd: []string{"up tag:{tag}"}, - tagSyncDefault: []string{"up trunk"}, + TagCmd: []tagCmd{{"tag ls", `(.*)`}}, + TagSyncCmd: []string{"up tag:{tag}"}, + TagSyncDefault: []string{"up trunk"}, - scheme: []string{"https", "http"}, - remoteRepo: fossilRemoteRepo, + Scheme: []string{"https", "http"}, + RemoteRepo: fossilRemoteRepo, } -func fossilRemoteRepo(vcsFossil *vcsCmd, rootDir string) (remoteRepo string, err error) { +func fossilRemoteRepo(vcsFossil *Cmd, rootDir string) (remoteRepo string, err error) { out, err := vcsFossil.runOutput(rootDir, "remote-url") if err != nil { return "", err @@ -360,8 +364,8 @@ func fossilRemoteRepo(vcsFossil *vcsCmd, rootDir string) (remoteRepo string, err return strings.TrimSpace(string(out)), nil } -func (v *vcsCmd) String() string { - return v.name +func (v *Cmd) String() string { + return v.Name } // run runs the command line cmd in the given directory. @@ -371,24 +375,24 @@ func (v *vcsCmd) String() string { // If an error occurs, run prints the command line and the // command's combined stdout+stderr to standard error. // Otherwise run discards the command's output. -func (v *vcsCmd) run(dir string, cmd string, keyval ...string) error { +func (v *Cmd) run(dir string, cmd string, keyval ...string) error { _, err := v.run1(dir, cmd, keyval, true) return err } // runVerboseOnly is like run but only generates error output to standard error in verbose mode. -func (v *vcsCmd) runVerboseOnly(dir string, cmd string, keyval ...string) error { +func (v *Cmd) runVerboseOnly(dir string, cmd string, keyval ...string) error { _, err := v.run1(dir, cmd, keyval, false) return err } // runOutput is like run but returns the output of the command. -func (v *vcsCmd) runOutput(dir string, cmd string, keyval ...string) ([]byte, error) { +func (v *Cmd) runOutput(dir string, cmd string, keyval ...string) ([]byte, error) { return v.run1(dir, cmd, keyval, true) } // run1 is the generalized implementation of run and runOutput. -func (v *vcsCmd) run1(dir string, cmdline string, keyval []string, verbose bool) ([]byte, error) { +func (v *Cmd) run1(dir string, cmdline string, keyval []string, verbose bool) ([]byte, error) { m := make(map[string]string) for i := 0; i < len(keyval); i += 2 { m[keyval[i]] = keyval[i+1] @@ -420,25 +424,25 @@ func (v *vcsCmd) run1(dir string, cmdline string, keyval []string, verbose bool) args = args[2:] } - _, err := exec.LookPath(v.cmd) + _, err := exec.LookPath(v.Cmd) if err != nil { fmt.Fprintf(os.Stderr, "go: missing %s command. See https://golang.org/s/gogetcmd\n", - v.name) + v.Name) return nil, err } - cmd := exec.Command(v.cmd, args...) + cmd := exec.Command(v.Cmd, args...) cmd.Dir = dir cmd.Env = base.AppendPWD(os.Environ(), cmd.Dir) if cfg.BuildX { fmt.Fprintf(os.Stderr, "cd %s\n", dir) - fmt.Fprintf(os.Stderr, "%s %s\n", v.cmd, strings.Join(args, " ")) + fmt.Fprintf(os.Stderr, "%s %s\n", v.Cmd, strings.Join(args, " ")) } out, err := cmd.Output() if err != nil { if verbose || cfg.BuildV { - fmt.Fprintf(os.Stderr, "# cd %s; %s %s\n", dir, v.cmd, strings.Join(args, " ")) + fmt.Fprintf(os.Stderr, "# cd %s; %s %s\n", dir, v.Cmd, strings.Join(args, " ")) if ee, ok := err.(*exec.ExitError); ok && len(ee.Stderr) > 0 { os.Stderr.Write(ee.Stderr) } else { @@ -449,15 +453,15 @@ func (v *vcsCmd) run1(dir string, cmdline string, keyval []string, verbose bool) return out, err } -// ping pings to determine scheme to use. -func (v *vcsCmd) ping(scheme, repo string) error { - return v.runVerboseOnly(".", v.pingCmd, "scheme", scheme, "repo", repo) +// Ping pings to determine scheme to use. +func (v *Cmd) Ping(scheme, repo string) error { + return v.runVerboseOnly(".", v.PingCmd, "scheme", scheme, "repo", repo) } -// create creates a new copy of repo in dir. +// Create creates a new copy of repo in dir. // The parent of dir must exist; dir must not. -func (v *vcsCmd) create(dir, repo string) error { - for _, cmd := range v.createCmd { +func (v *Cmd) Create(dir, repo string) error { + for _, cmd := range v.CreateCmd { if err := v.run(".", cmd, "dir", dir, "repo", repo); err != nil { return err } @@ -465,9 +469,9 @@ func (v *vcsCmd) create(dir, repo string) error { return nil } -// download downloads any new changes for the repo in dir. -func (v *vcsCmd) download(dir string) error { - for _, cmd := range v.downloadCmd { +// Download downloads any new changes for the repo in dir. +func (v *Cmd) Download(dir string) error { + for _, cmd := range v.DownloadCmd { if err := v.run(dir, cmd); err != nil { return err } @@ -475,10 +479,10 @@ func (v *vcsCmd) download(dir string) error { return nil } -// tags returns the list of available tags for the repo in dir. -func (v *vcsCmd) tags(dir string) ([]string, error) { +// Tags returns the list of available tags for the repo in dir. +func (v *Cmd) Tags(dir string) ([]string, error) { var tags []string - for _, tc := range v.tagCmd { + for _, tc := range v.TagCmd { out, err := v.runOutput(dir, tc.cmd) if err != nil { return nil, err @@ -493,12 +497,12 @@ func (v *vcsCmd) tags(dir string) ([]string, error) { // tagSync syncs the repo in dir to the named tag, // which either is a tag returned by tags or is v.tagDefault. -func (v *vcsCmd) tagSync(dir, tag string) error { - if v.tagSyncCmd == nil { +func (v *Cmd) TagSync(dir, tag string) error { + if v.TagSyncCmd == nil { return nil } if tag != "" { - for _, tc := range v.tagLookupCmd { + for _, tc := range v.TagLookupCmd { out, err := v.runOutput(dir, tc.cmd, "tag", tag) if err != nil { return err @@ -512,8 +516,8 @@ func (v *vcsCmd) tagSync(dir, tag string) error { } } - if tag == "" && v.tagSyncDefault != nil { - for _, cmd := range v.tagSyncDefault { + if tag == "" && v.TagSyncDefault != nil { + for _, cmd := range v.TagSyncDefault { if err := v.run(dir, cmd); err != nil { return err } @@ -521,7 +525,7 @@ func (v *vcsCmd) tagSync(dir, tag string) error { return nil } - for _, cmd := range v.tagSyncCmd { + for _, cmd := range v.TagSyncCmd { if err := v.run(dir, cmd, "tag", tag); err != nil { return err } @@ -540,11 +544,11 @@ type vcsPath struct { schemelessRepo bool // if true, the repo pattern lacks a scheme } -// vcsFromDir inspects dir and its parents to determine the +// FromDir inspects dir and its parents to determine the // version control system and code repository to use. // On return, root is the import path // corresponding to the root of the repository. -func vcsFromDir(dir, srcRoot string) (vcs *vcsCmd, root string, err error) { +func FromDir(dir, srcRoot string) (vcs *Cmd, root string, err error) { // Clean and double-check that dir is in (a subdirectory of) srcRoot. dir = filepath.Clean(dir) srcRoot = filepath.Clean(srcRoot) @@ -552,13 +556,13 @@ func vcsFromDir(dir, srcRoot string) (vcs *vcsCmd, root string, err error) { return nil, "", fmt.Errorf("directory %q is outside source root %q", dir, srcRoot) } - var vcsRet *vcsCmd + var vcsRet *Cmd var rootRet string origDir := dir for len(dir) > len(srcRoot) { for _, vcs := range vcsList { - if _, err := os.Stat(filepath.Join(dir, "."+vcs.cmd)); err == nil { + if _, err := os.Stat(filepath.Join(dir, "."+vcs.Cmd)); err == nil { root := filepath.ToSlash(dir[len(srcRoot)+1:]) // Record first VCS we find, but keep looking, // to detect mistakes like one kind of VCS inside another. @@ -568,12 +572,12 @@ func vcsFromDir(dir, srcRoot string) (vcs *vcsCmd, root string, err error) { continue } // Allow .git inside .git, which can arise due to submodules. - if vcsRet == vcs && vcs.cmd == "git" { + if vcsRet == vcs && vcs.Cmd == "git" { continue } // Otherwise, we have one VCS inside a different VCS. return nil, "", fmt.Errorf("directory %q uses %s, but parent %q uses %s", - filepath.Join(srcRoot, rootRet), vcsRet.cmd, filepath.Join(srcRoot, root), vcs.cmd) + filepath.Join(srcRoot, rootRet), vcsRet.Cmd, filepath.Join(srcRoot, root), vcs.Cmd) } } @@ -593,9 +597,9 @@ func vcsFromDir(dir, srcRoot string) (vcs *vcsCmd, root string, err error) { return nil, "", fmt.Errorf("directory %q is not using a known version control system", origDir) } -// checkNestedVCS checks for an incorrectly-nested VCS-inside-VCS +// CheckNested checks for an incorrectly-nested VCS-inside-VCS // situation for dir, checking parents up until srcRoot. -func checkNestedVCS(vcs *vcsCmd, dir, srcRoot string) error { +func CheckNested(vcs *Cmd, dir, srcRoot string) error { if len(dir) <= len(srcRoot) || dir[len(srcRoot)] != filepath.Separator { return fmt.Errorf("directory %q is outside source root %q", dir, srcRoot) } @@ -603,17 +607,17 @@ func checkNestedVCS(vcs *vcsCmd, dir, srcRoot string) error { otherDir := dir for len(otherDir) > len(srcRoot) { for _, otherVCS := range vcsList { - if _, err := os.Stat(filepath.Join(otherDir, "."+otherVCS.cmd)); err == nil { + if _, err := os.Stat(filepath.Join(otherDir, "."+otherVCS.Cmd)); err == nil { // Allow expected vcs in original dir. if otherDir == dir && otherVCS == vcs { continue } // Allow .git inside .git, which can arise due to submodules. - if otherVCS == vcs && vcs.cmd == "git" { + if otherVCS == vcs && vcs.Cmd == "git" { continue } // Otherwise, we have one VCS inside a different VCS. - return fmt.Errorf("directory %q uses %s, but parent %q uses %s", dir, vcs.cmd, otherDir, otherVCS.cmd) + return fmt.Errorf("directory %q uses %s, but parent %q uses %s", dir, vcs.Cmd, otherDir, otherVCS.Cmd) } } // Move to parent. @@ -633,9 +637,7 @@ type RepoRoot struct { Repo string // repository URL, including scheme Root string // import path corresponding to root of repo IsCustom bool // defined by served <meta> tags (as opposed to hard-coded pattern) - VCS string // vcs type ("mod", "git", ...) - - vcs *vcsCmd // internal: vcs command access + VCS *Cmd } func httpPrefix(s string) string { @@ -735,15 +737,15 @@ func repoRootFromVCSPaths(importPath string, security web.SecurityMode, vcsPaths if !srv.schemelessRepo { repoURL = match["repo"] } else { - scheme := vcs.scheme[0] // default to first scheme + scheme := vcs.Scheme[0] // default to first scheme repo := match["repo"] - if vcs.pingCmd != "" { + if vcs.PingCmd != "" { // If we know how to test schemes, scan to find one. - for _, s := range vcs.scheme { + for _, s := range vcs.Scheme { if security == web.SecureOnly && !vcs.isSecureScheme(s) { continue } - if vcs.ping(s, repo) == nil { + if vcs.Ping(s, repo) == nil { scheme = s break } @@ -754,8 +756,7 @@ func repoRootFromVCSPaths(importPath string, security web.SecurityMode, vcsPaths rr := &RepoRoot{ Repo: repoURL, Root: match["root"], - VCS: vcs.cmd, - vcs: vcs, + VCS: vcs, } return rr, nil } @@ -846,17 +847,21 @@ func repoRootForImportDynamic(importPath string, mod ModuleMode, security web.Se if err := validateRepoRoot(mmi.RepoRoot); err != nil { return nil, fmt.Errorf("%s: invalid repo root %q: %v", resp.URL, mmi.RepoRoot, err) } - vcs := vcsByCmd(mmi.VCS) - if vcs == nil && mmi.VCS != "mod" { - return nil, fmt.Errorf("%s: unknown vcs %q", resp.URL, mmi.VCS) + var vcs *Cmd + if mmi.VCS == "mod" { + vcs = vcsMod + } else { + vcs = vcsByCmd(mmi.VCS) + if vcs == nil { + return nil, fmt.Errorf("%s: unknown vcs %q", resp.URL, mmi.VCS) + } } rr := &RepoRoot{ Repo: mmi.RepoRoot, Root: mmi.Prefix, IsCustom: true, - VCS: mmi.VCS, - vcs: vcs, + VCS: vcs, } return rr, nil } @@ -1027,7 +1032,7 @@ var vcsPaths = []*vcsPath{ // Github { prefix: "github.com/", - regexp: lazyregexp.New(`^(?P<root>github\.com/[A-Za-z0-9_.\-]+/[A-Za-z0-9_.\-]+)(/[\p{L}0-9_.\-]+)*$`), + regexp: lazyregexp.New(`^(?P<root>github\.com/[A-Za-z0-9_.\-]+/[A-Za-z0-9_.\-]+)(/[A-Za-z0-9_.\-]+)*$`), vcs: "git", repo: "https://{root}", check: noVCSSuffix, @@ -1103,7 +1108,7 @@ var vcsPathsAfterDynamic = []*vcsPath{ func noVCSSuffix(match map[string]string) error { repo := match["repo"] for _, vcs := range vcsList { - if strings.HasSuffix(repo, "."+vcs.cmd) { + if strings.HasSuffix(repo, "."+vcs.Cmd) { return fmt.Errorf("invalid version control suffix in %s path", match["prefix"]) } } @@ -1133,7 +1138,7 @@ func bitbucketVCS(match map[string]string) error { // VCS it uses. See issue 5375. root := match["root"] for _, vcs := range []string{"git", "hg"} { - if vcsByCmd(vcs).ping("https", root) == nil { + if vcsByCmd(vcs).Ping("https", root) == nil { resp.SCM = vcs break } diff --git a/src/cmd/go/internal/get/vcs_test.go b/src/cmd/go/internal/vcs/vcs_test.go index 91800baa83..5b874204f1 100644 --- a/src/cmd/go/internal/get/vcs_test.go +++ b/src/cmd/go/internal/vcs/vcs_test.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -package get +package vcs import ( "errors" @@ -28,30 +28,27 @@ func TestRepoRootForImportPath(t *testing.T) { { "github.com/golang/groupcache", &RepoRoot{ - vcs: vcsGit, + VCS: vcsGit, Repo: "https://github.com/golang/groupcache", }, }, - // Unicode letters in directories (issue 18660). + // Unicode letters in directories are not valid. { "github.com/user/unicode/испытание", - &RepoRoot{ - vcs: vcsGit, - Repo: "https://github.com/user/unicode", - }, + nil, }, // IBM DevOps Services tests { "hub.jazz.net/git/user1/pkgname", &RepoRoot{ - vcs: vcsGit, + VCS: vcsGit, Repo: "https://hub.jazz.net/git/user1/pkgname", }, }, { "hub.jazz.net/git/user1/pkgname/submodule/submodule/submodule", &RepoRoot{ - vcs: vcsGit, + VCS: vcsGit, Repo: "https://hub.jazz.net/git/user1/pkgname", }, }, @@ -92,7 +89,7 @@ func TestRepoRootForImportPath(t *testing.T) { { "hub.jazz.net/git/user/pkg.name", &RepoRoot{ - vcs: vcsGit, + VCS: vcsGit, Repo: "https://hub.jazz.net/git/user/pkg.name", }, }, @@ -105,7 +102,7 @@ func TestRepoRootForImportPath(t *testing.T) { { "git.openstack.org/openstack/swift", &RepoRoot{ - vcs: vcsGit, + VCS: vcsGit, Repo: "https://git.openstack.org/openstack/swift", }, }, @@ -115,14 +112,14 @@ func TestRepoRootForImportPath(t *testing.T) { { "git.openstack.org/openstack/swift.git", &RepoRoot{ - vcs: vcsGit, + VCS: vcsGit, Repo: "https://git.openstack.org/openstack/swift.git", }, }, { "git.openstack.org/openstack/swift/go/hummingbird", &RepoRoot{ - vcs: vcsGit, + VCS: vcsGit, Repo: "https://git.openstack.org/openstack/swift", }, }, @@ -151,21 +148,21 @@ func TestRepoRootForImportPath(t *testing.T) { { "git.apache.org/package-name.git", &RepoRoot{ - vcs: vcsGit, + VCS: vcsGit, Repo: "https://git.apache.org/package-name.git", }, }, { "git.apache.org/package-name_2.x.git/path/to/lib", &RepoRoot{ - vcs: vcsGit, + VCS: vcsGit, Repo: "https://git.apache.org/package-name_2.x.git", }, }, { "chiselapp.com/user/kyle/repository/fossilgg", &RepoRoot{ - vcs: vcsFossil, + VCS: vcsFossil, Repo: "https://chiselapp.com/user/kyle/repository/fossilgg", }, }, @@ -194,8 +191,8 @@ func TestRepoRootForImportPath(t *testing.T) { t.Errorf("RepoRootForImportPath(%q): %v", test.path, err) continue } - if got.vcs.name != want.vcs.name || got.Repo != want.Repo { - t.Errorf("RepoRootForImportPath(%q) = VCS(%s) Repo(%s), want VCS(%s) Repo(%s)", test.path, got.vcs, got.Repo, want.vcs, want.Repo) + if got.VCS.Name != want.VCS.Name || got.Repo != want.Repo { + t.Errorf("RepoRootForImportPath(%q) = VCS(%s) Repo(%s), want VCS(%s) Repo(%s)", test.path, got.VCS, got.Repo, want.VCS, want.Repo) } } } @@ -209,7 +206,7 @@ func TestFromDir(t *testing.T) { defer os.RemoveAll(tempDir) for j, vcs := range vcsList { - dir := filepath.Join(tempDir, "example.com", vcs.name, "."+vcs.cmd) + dir := filepath.Join(tempDir, "example.com", vcs.Name, "."+vcs.Cmd) if j&1 == 0 { err := os.MkdirAll(dir, 0755) if err != nil { @@ -228,24 +225,24 @@ func TestFromDir(t *testing.T) { } want := RepoRoot{ - vcs: vcs, - Root: path.Join("example.com", vcs.name), + VCS: vcs, + Root: path.Join("example.com", vcs.Name), } var got RepoRoot - got.vcs, got.Root, err = vcsFromDir(dir, tempDir) + got.VCS, got.Root, err = FromDir(dir, tempDir) if err != nil { t.Errorf("FromDir(%q, %q): %v", dir, tempDir, err) continue } - if got.vcs.name != want.vcs.name || got.Root != want.Root { - t.Errorf("FromDir(%q, %q) = VCS(%s) Root(%s), want VCS(%s) Root(%s)", dir, tempDir, got.vcs, got.Root, want.vcs, want.Root) + if got.VCS.Name != want.VCS.Name || got.Root != want.Root { + t.Errorf("FromDir(%q, %q) = VCS(%s) Root(%s), want VCS(%s) Root(%s)", dir, tempDir, got.VCS, got.Root, want.VCS, want.Root) } } } func TestIsSecure(t *testing.T) { tests := []struct { - vcs *vcsCmd + vcs *Cmd url string secure bool }{ @@ -270,7 +267,7 @@ func TestIsSecure(t *testing.T) { } for _, test := range tests { - secure := test.vcs.isSecure(test.url) + secure := test.vcs.IsSecure(test.url) if secure != test.secure { t.Errorf("%s isSecure(%q) = %t; want %t", test.vcs, test.url, secure, test.secure) } @@ -279,7 +276,7 @@ func TestIsSecure(t *testing.T) { func TestIsSecureGitAllowProtocol(t *testing.T) { tests := []struct { - vcs *vcsCmd + vcs *Cmd url string secure bool }{ @@ -310,7 +307,7 @@ func TestIsSecureGitAllowProtocol(t *testing.T) { defer os.Unsetenv("GIT_ALLOW_PROTOCOL") os.Setenv("GIT_ALLOW_PROTOCOL", "https:foo") for _, test := range tests { - secure := test.vcs.isSecure(test.url) + secure := test.vcs.IsSecure(test.url) if secure != test.secure { t.Errorf("%s isSecure(%q) = %t; want %t", test.vcs, test.url, secure, test.secure) } diff --git a/src/cmd/go/internal/work/build.go b/src/cmd/go/internal/work/build.go index d020aa6e9f..e99982ed36 100644 --- a/src/cmd/go/internal/work/build.go +++ b/src/cmd/go/internal/work/build.go @@ -240,13 +240,12 @@ const ( // AddBuildFlags adds the flags common to the build, clean, get, // install, list, run, and test commands. func AddBuildFlags(cmd *base.Command, mask BuildFlagMask) { + base.AddBuildFlagsNX(&cmd.Flag) cmd.Flag.BoolVar(&cfg.BuildA, "a", false, "") - cmd.Flag.BoolVar(&cfg.BuildN, "n", false, "") cmd.Flag.IntVar(&cfg.BuildP, "p", cfg.BuildP, "") if mask&OmitVFlag == 0 { cmd.Flag.BoolVar(&cfg.BuildV, "v", false, "") } - cmd.Flag.BoolVar(&cfg.BuildX, "x", false, "") cmd.Flag.Var(&load.BuildAsmflags, "asmflags", "") cmd.Flag.Var(buildCompiler{}, "compiler", "") @@ -254,10 +253,10 @@ func AddBuildFlags(cmd *base.Command, mask BuildFlagMask) { cmd.Flag.Var(&load.BuildGcflags, "gcflags", "") cmd.Flag.Var(&load.BuildGccgoflags, "gccgoflags", "") if mask&OmitModFlag == 0 { - cmd.Flag.StringVar(&cfg.BuildMod, "mod", "", "") + base.AddModFlag(&cmd.Flag) } if mask&OmitModCommonFlags == 0 { - AddModCommonFlags(cmd) + base.AddModCommonFlags(&cmd.Flag) } cmd.Flag.StringVar(&cfg.BuildContext.InstallSuffix, "installsuffix", "", "") cmd.Flag.Var(&load.BuildLdflags, "ldflags", "") @@ -275,13 +274,6 @@ func AddBuildFlags(cmd *base.Command, mask BuildFlagMask) { cmd.Flag.StringVar(&cfg.DebugTrace, "debug-trace", "", "") } -// AddModCommonFlags adds the module-related flags common to build commands -// and 'go mod' subcommands. -func AddModCommonFlags(cmd *base.Command) { - cmd.Flag.BoolVar(&cfg.ModCacheRW, "modcacherw", false, "") - cmd.Flag.StringVar(&cfg.ModFile, "modfile", "", "") -} - // tagsFlag is the implementation of the -tags flag. type tagsFlag []string diff --git a/src/cmd/go/internal/work/gc.go b/src/cmd/go/internal/work/gc.go index f1d08e0268..6031897f88 100644 --- a/src/cmd/go/internal/work/gc.go +++ b/src/cmd/go/internal/work/gc.go @@ -259,6 +259,15 @@ func asmArgs(a *Action, p *load.Package) []interface{} { } } } + if p.ImportPath == "runtime" && objabi.Regabi_enabled != 0 { + // In order to make it easier to port runtime assembly + // to the register ABI, we introduce a macro + // indicating the experiment is enabled. + // + // TODO(austin): Remove this once we commit to the + // register ABI (#40724). + args = append(args, "-D=GOEXPERIMENT_REGABI=1") + } if cfg.Goarch == "mips" || cfg.Goarch == "mipsle" { // Define GOMIPS_value from cfg.GOMIPS. diff --git a/src/cmd/go/internal/work/init.go b/src/cmd/go/internal/work/init.go index dad3b10111..f78020032c 100644 --- a/src/cmd/go/internal/work/init.go +++ b/src/cmd/go/internal/work/init.go @@ -252,7 +252,7 @@ func buildModeInit() { switch cfg.BuildMod { case "": - // ok + // Behavior will be determined automatically, as if no flag were passed. case "readonly", "vendor", "mod": if !cfg.ModulesEnabled && !inGOFLAGS("-mod") { base.Fatalf("build flag -mod=%s only valid when using modules", cfg.BuildMod) diff --git a/src/cmd/go/internal/work/security.go b/src/cmd/go/internal/work/security.go index 3ee68ac1b4..d2a2697f0f 100644 --- a/src/cmd/go/internal/work/security.go +++ b/src/cmd/go/internal/work/security.go @@ -177,6 +177,7 @@ var validLinkerFlags = []*lazyregexp.Regexp{ re(`-Wl,-Bdynamic`), re(`-Wl,-berok`), re(`-Wl,-Bstatic`), + re(`-Wl,-Bsymbolic-functions`), re(`-WL,-O([^@,\-][^,]*)?`), re(`-Wl,-d[ny]`), re(`-Wl,--disable-new-dtags`), diff --git a/src/cmd/go/testdata/mod/example.com_retract_missingmod_v1.0.0.txt b/src/cmd/go/testdata/mod/example.com_retract_missingmod_v1.0.0.txt new file mode 100644 index 0000000000..1d8d81071e --- /dev/null +++ b/src/cmd/go/testdata/mod/example.com_retract_missingmod_v1.0.0.txt @@ -0,0 +1,10 @@ +This version should be retracted, but the go.mod file for the version that would +contain the retraction is not available. +-- .mod -- +module example.com/retract/missingmod + +go 1.14 +-- .info -- +{"Version":"v1.0.0"} +-- missingmod.go -- +package missingmod diff --git a/src/cmd/go/testdata/mod/example.com_retract_missingmod_v1.9.0.txt b/src/cmd/go/testdata/mod/example.com_retract_missingmod_v1.9.0.txt new file mode 100644 index 0000000000..bba919ec21 --- /dev/null +++ b/src/cmd/go/testdata/mod/example.com_retract_missingmod_v1.9.0.txt @@ -0,0 +1,4 @@ +The go.mod file at this version will be loaded to check for retractions +of earlier versions. However, the .mod file is not available. +-- .info -- +{"Version":"v1.9.0"} diff --git a/src/cmd/go/testdata/mod/example.com_retract_rationale_v1.0.0-block.txt b/src/cmd/go/testdata/mod/example.com_retract_rationale_v1.0.0-block.txt new file mode 100644 index 0000000000..c4a53e1d80 --- /dev/null +++ b/src/cmd/go/testdata/mod/example.com_retract_rationale_v1.0.0-block.txt @@ -0,0 +1,6 @@ +-- .mod -- +module example.com/retract/rationale + +go 1.14 +-- .info -- +{"Version":"v1.0.0-block"} diff --git a/src/cmd/go/testdata/mod/example.com_retract_rationale_v1.0.0-blockwithcomment.txt b/src/cmd/go/testdata/mod/example.com_retract_rationale_v1.0.0-blockwithcomment.txt new file mode 100644 index 0000000000..92573b62e3 --- /dev/null +++ b/src/cmd/go/testdata/mod/example.com_retract_rationale_v1.0.0-blockwithcomment.txt @@ -0,0 +1,6 @@ +-- .mod -- +module example.com/retract/rationale + +go 1.14 +-- .info -- +{"Version":"v1.0.0-blockwithcomment"} diff --git a/src/cmd/go/testdata/mod/example.com_retract_rationale_v1.0.0-empty.txt b/src/cmd/go/testdata/mod/example.com_retract_rationale_v1.0.0-empty.txt new file mode 100644 index 0000000000..1f0894aa8b --- /dev/null +++ b/src/cmd/go/testdata/mod/example.com_retract_rationale_v1.0.0-empty.txt @@ -0,0 +1,8 @@ +-- .mod -- +module example.com/retract/rationale + +go 1.14 +-- .info -- +{"Version":"v1.0.0-empty"} +-- empty.go -- +package empty diff --git a/src/cmd/go/testdata/mod/example.com_retract_rationale_v1.0.0-long.txt b/src/cmd/go/testdata/mod/example.com_retract_rationale_v1.0.0-long.txt new file mode 100644 index 0000000000..1b5e753428 --- /dev/null +++ b/src/cmd/go/testdata/mod/example.com_retract_rationale_v1.0.0-long.txt @@ -0,0 +1,8 @@ +-- .mod -- +module example.com/retract/rationale + +go 1.14 +-- .info -- +{"Version":"v1.0.0-long"} +-- empty.go -- +package empty diff --git a/src/cmd/go/testdata/mod/example.com_retract_rationale_v1.0.0-multiline1.txt b/src/cmd/go/testdata/mod/example.com_retract_rationale_v1.0.0-multiline1.txt new file mode 100644 index 0000000000..b1ffe27225 --- /dev/null +++ b/src/cmd/go/testdata/mod/example.com_retract_rationale_v1.0.0-multiline1.txt @@ -0,0 +1,8 @@ +-- .mod -- +module example.com/retract/rationale + +go 1.14 +-- .info -- +{"Version":"v1.0.0-multiline1"} +-- empty.go -- +package empty diff --git a/src/cmd/go/testdata/mod/example.com_retract_rationale_v1.0.0-multiline2.txt b/src/cmd/go/testdata/mod/example.com_retract_rationale_v1.0.0-multiline2.txt new file mode 100644 index 0000000000..72f80b3254 --- /dev/null +++ b/src/cmd/go/testdata/mod/example.com_retract_rationale_v1.0.0-multiline2.txt @@ -0,0 +1,8 @@ +-- .mod -- +module example.com/retract/rationale + +go 1.14 +-- .info -- +{"Version":"v1.0.0-multiline2"} +-- empty.go -- +package empty diff --git a/src/cmd/go/testdata/mod/example.com_retract_rationale_v1.0.0-order.txt b/src/cmd/go/testdata/mod/example.com_retract_rationale_v1.0.0-order.txt new file mode 100644 index 0000000000..1b0450462b --- /dev/null +++ b/src/cmd/go/testdata/mod/example.com_retract_rationale_v1.0.0-order.txt @@ -0,0 +1,6 @@ +-- .mod -- +module example.com/retract/rationale + +go 1.14 +-- .info -- +{"Version":"v1.0.0-order"} diff --git a/src/cmd/go/testdata/mod/example.com_retract_rationale_v1.0.0-unprintable.txt b/src/cmd/go/testdata/mod/example.com_retract_rationale_v1.0.0-unprintable.txt new file mode 100644 index 0000000000..949612431e --- /dev/null +++ b/src/cmd/go/testdata/mod/example.com_retract_rationale_v1.0.0-unprintable.txt @@ -0,0 +1,8 @@ +-- .mod -- +module example.com/retract/rationale + +go 1.14 +-- .info -- +{"Version":"v1.0.0-unprintable"} +-- empty.go -- +package empty diff --git a/src/cmd/go/testdata/mod/example.com_retract_rationale_v1.0.1-order.txt b/src/cmd/go/testdata/mod/example.com_retract_rationale_v1.0.1-order.txt new file mode 100644 index 0000000000..3be7d5b56e --- /dev/null +++ b/src/cmd/go/testdata/mod/example.com_retract_rationale_v1.0.1-order.txt @@ -0,0 +1,6 @@ +-- .mod -- +module example.com/retract/rationale + +go 1.14 +-- .info -- +{"Version":"v1.0.1-order"} diff --git a/src/cmd/go/testdata/mod/example.com_retract_rationale_v1.9.0.txt b/src/cmd/go/testdata/mod/example.com_retract_rationale_v1.9.0.txt new file mode 100644 index 0000000000..6975d4ebd4 --- /dev/null +++ b/src/cmd/go/testdata/mod/example.com_retract_rationale_v1.9.0.txt @@ -0,0 +1,48 @@ +Module example.com/retract/description retracts all versions of itself. +The rationale comments have various problems. + +-- .mod -- +module example.com/retract/rationale + +go 1.14 + +retract ( + v1.0.0-empty + + // short description + // more + // + // detail + v1.0.0-multiline1 // suffix + // after not included +) + +// short description +// more +// +// detail +retract v1.0.0-multiline2 // suffix + +// loooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooong +retract v1.0.0-long + +// Ends with a BEL character. Beep! +retract v1.0.0-unprintable + +// block comment +retract ( + v1.0.0-block + + // inner comment + v1.0.0-blockwithcomment +) + +retract ( + [v1.0.0-order, v1.0.0-order] // degenerate range + v1.0.0-order // single version + + v1.0.1-order // single version + [v1.0.1-order, v1.0.1-order] // degenerate range +) +-- .info -- +{"Version":"v1.9.0"} diff --git a/src/cmd/go/testdata/mod/example.com_retract_self_all_v1.9.0.txt b/src/cmd/go/testdata/mod/example.com_retract_self_all_v1.9.0.txt new file mode 100644 index 0000000000..4dc486b599 --- /dev/null +++ b/src/cmd/go/testdata/mod/example.com_retract_self_all_v1.9.0.txt @@ -0,0 +1,14 @@ +Module example.com/retract/self/prev is a module that retracts its own +latest version. + +No unretracted versions are available. + +-- .mod -- +module example.com/retract/self/all + +go 1.15 + +retract v1.9.0 // bad + +-- .info -- +{"Version":"v1.9.0"} diff --git a/src/cmd/go/testdata/mod/example.com_retract_self_prerelease_v1.0.0.txt b/src/cmd/go/testdata/mod/example.com_retract_self_prerelease_v1.0.0.txt new file mode 100644 index 0000000000..04c28455d7 --- /dev/null +++ b/src/cmd/go/testdata/mod/example.com_retract_self_prerelease_v1.0.0.txt @@ -0,0 +1,16 @@ +Module example.com/retract/self/prerelease is a module that retracts its own +latest version and all other release version. + +A pre-release version higher than the highest release version is still +available, and that should be matched by @latest. + +-- .mod -- +module example.com/retract/self/prerelease + +go 1.15 + +-- .info -- +{"Version":"v1.0.0"} + +-- p.go -- +package p diff --git a/src/cmd/go/testdata/mod/example.com_retract_self_prerelease_v1.9.0.txt b/src/cmd/go/testdata/mod/example.com_retract_self_prerelease_v1.9.0.txt new file mode 100644 index 0000000000..7c1c047e69 --- /dev/null +++ b/src/cmd/go/testdata/mod/example.com_retract_self_prerelease_v1.9.0.txt @@ -0,0 +1,19 @@ +Module example.com/retract/self/prerelease is a module that retracts its own +latest version and all other release version. + +A pre-release version higher than the highest release version is still +available, and that should be matched by @latest. + +-- .mod -- +module example.com/retract/self/prerelease + +go 1.15 + +retract v1.0.0 // bad +retract v1.9.0 // self + +-- .info -- +{"Version":"v1.9.0"} + +-- p.go -- +package p diff --git a/src/cmd/go/testdata/mod/example.com_retract_self_prerelease_v1.9.1-pre.txt b/src/cmd/go/testdata/mod/example.com_retract_self_prerelease_v1.9.1-pre.txt new file mode 100644 index 0000000000..abf44fdae1 --- /dev/null +++ b/src/cmd/go/testdata/mod/example.com_retract_self_prerelease_v1.9.1-pre.txt @@ -0,0 +1,16 @@ +Module example.com/retract/self/prerelease is a module that retracts its own +latest version and all other release version. + +A pre-release version higher than the highest release version is still +available, and that should be matched by @latest. + +-- .mod -- +module example.com/retract/self/prerelease + +go 1.15 + +-- .info -- +{"Version":"v1.9.1-pre"} + +-- p.go -- +package p diff --git a/src/cmd/go/testdata/mod/example.com_retract_self_prev_v1.0.0-bad.txt b/src/cmd/go/testdata/mod/example.com_retract_self_prev_v1.0.0-bad.txt new file mode 100644 index 0000000000..095063d69b --- /dev/null +++ b/src/cmd/go/testdata/mod/example.com_retract_self_prev_v1.0.0-bad.txt @@ -0,0 +1,14 @@ +See example.com_retract_self_prev_v1.9.0.txt. + +This version is retracted. + +-- .mod -- +module example.com/retract/self/prev + +go 1.15 + +-- .info -- +{"Version":"v1.0.0-bad"} + +-- p.go -- +package p diff --git a/src/cmd/go/testdata/mod/example.com_retract_self_prev_v1.1.0.txt b/src/cmd/go/testdata/mod/example.com_retract_self_prev_v1.1.0.txt new file mode 100644 index 0000000000..27c3a39065 --- /dev/null +++ b/src/cmd/go/testdata/mod/example.com_retract_self_prev_v1.1.0.txt @@ -0,0 +1,14 @@ +See example.com_retract_self_pref_v1.9.0.txt. + +This version is the latest (only) non-retracted version. + +-- .mod -- +module example.com/retract/self/prev + +go 1.15 + +-- .info -- +{"Version":"v1.1.0"} + +-- p.go -- +package p diff --git a/src/cmd/go/testdata/mod/example.com_retract_self_prev_v1.9.0.txt b/src/cmd/go/testdata/mod/example.com_retract_self_prev_v1.9.0.txt new file mode 100644 index 0000000000..03d6168f0d --- /dev/null +++ b/src/cmd/go/testdata/mod/example.com_retract_self_prev_v1.9.0.txt @@ -0,0 +1,18 @@ +Module example.com/retract/self/prev is a module that retracts its own +latest version, as well as an earlier version. + +A previous unretracted release version, v1.1.0, is still available. + +-- .mod -- +module example.com/retract/self/prev + +go 1.15 + +retract v1.0.0-bad // bad +retract v1.9.0 // self + +-- .info -- +{"Version":"v1.9.0"} + +-- p.go -- +package p diff --git a/src/cmd/go/testdata/mod/example.com_retract_self_pseudo_v0.0.0-20200325131415-0123456789ab b/src/cmd/go/testdata/mod/example.com_retract_self_pseudo_v0.0.0-20200325131415-0123456789ab new file mode 100644 index 0000000000..f9ab41e88f --- /dev/null +++ b/src/cmd/go/testdata/mod/example.com_retract_self_pseudo_v0.0.0-20200325131415-0123456789ab @@ -0,0 +1,20 @@ +See example.com_retract_self_pseudo_v1.9.0.txt. + +This version is not retracted. It should be returned by the proxy's +@latest endpoint. It should match the @latest version query. + +TODO(golang.org/issue/24031): the proxy and proxy.golang.org both return +the highest release version from the @latest endpoint, even if that +version is retracted, so there is no way for the go command to +discover an unretracted pseudo-version. + +-- .mod -- +module example.com/retract/self/pseudo + +go 1.15 + +-- .info -- +{"Version":"v0.0.0-20200325131415-01234567890ab"} + +-- p.go -- +package p diff --git a/src/cmd/go/testdata/mod/example.com_retract_self_pseudo_v1.0.0-bad.txt b/src/cmd/go/testdata/mod/example.com_retract_self_pseudo_v1.0.0-bad.txt new file mode 100644 index 0000000000..d47eda0597 --- /dev/null +++ b/src/cmd/go/testdata/mod/example.com_retract_self_pseudo_v1.0.0-bad.txt @@ -0,0 +1,14 @@ +See example.com_retract_self_pseudo_v1.9.0.txt. + +This version is retracted. + +-- .mod -- +module example.com/retract/self/pseudo + +go 1.15 + +-- .info -- +{"Version":"v1.0.0-bad"} + +-- p.go -- +package p diff --git a/src/cmd/go/testdata/mod/example.com_retract_self_pseudo_v1.9.0.txt b/src/cmd/go/testdata/mod/example.com_retract_self_pseudo_v1.9.0.txt new file mode 100644 index 0000000000..db09cc6a5f --- /dev/null +++ b/src/cmd/go/testdata/mod/example.com_retract_self_pseudo_v1.9.0.txt @@ -0,0 +1,16 @@ +Module example.com/retract/self/pseudo is a module that retracts its own +latest version, as well as an earlier version. + +An unretracted pseudo-version is available. + +-- .mod -- +module example.com/retract/self/pseudo + +go 1.15 + +retract v1.0.0-bad // bad +retract v1.9.0 // self + +-- .info -- +{"Version":"v1.9.0"} + diff --git a/src/cmd/go/testdata/mod/example.com_retract_v1.0.0-bad.txt b/src/cmd/go/testdata/mod/example.com_retract_v1.0.0-bad.txt new file mode 100644 index 0000000000..2f996cfc36 --- /dev/null +++ b/src/cmd/go/testdata/mod/example.com_retract_v1.0.0-bad.txt @@ -0,0 +1,10 @@ +-- .mod -- +module example.com/retract + +go 1.15 + +-- .info -- +{"Version":"v1.0.0-bad"} + +-- retract.go -- +package retract diff --git a/src/cmd/go/testdata/mod/example.com_retract_v1.0.0-good.txt b/src/cmd/go/testdata/mod/example.com_retract_v1.0.0-good.txt new file mode 100644 index 0000000000..78152bba4f --- /dev/null +++ b/src/cmd/go/testdata/mod/example.com_retract_v1.0.0-good.txt @@ -0,0 +1,10 @@ +-- .mod -- +module example.com/retract + +go 1.15 + +-- .info -- +{"Version":"v1.0.0-good"} + +-- retract.go -- +package retract diff --git a/src/cmd/go/testdata/mod/example.com_retract_v1.0.0-unused.txt b/src/cmd/go/testdata/mod/example.com_retract_v1.0.0-unused.txt new file mode 100644 index 0000000000..3bc9e35b7c --- /dev/null +++ b/src/cmd/go/testdata/mod/example.com_retract_v1.0.0-unused.txt @@ -0,0 +1,10 @@ +-- .mod -- +module example.com/retract + +go 1.15 + +-- .info -- +{"Version":"v1.0.0-unused"} + +-- retract.go -- +package retract diff --git a/src/cmd/go/testdata/mod/example.com_retract_v1.1.0.txt b/src/cmd/go/testdata/mod/example.com_retract_v1.1.0.txt new file mode 100644 index 0000000000..18d6d832e2 --- /dev/null +++ b/src/cmd/go/testdata/mod/example.com_retract_v1.1.0.txt @@ -0,0 +1,13 @@ +-- .mod -- +module example.com/retract + +go 1.15 + +retract v1.0.0-bad // bad +retract v1.0.0-unused // bad + +-- .info -- +{"Version":"v1.1.0"} + +-- retract.go -- +package retract diff --git a/src/cmd/go/testdata/mod/example.com_split-incompatible_subpkg_v0.1.0.txt b/src/cmd/go/testdata/mod/example.com_split-incompatible_subpkg_v0.1.0.txt new file mode 100644 index 0000000000..8f9e49176c --- /dev/null +++ b/src/cmd/go/testdata/mod/example.com_split-incompatible_subpkg_v0.1.0.txt @@ -0,0 +1,14 @@ +Written by hand. +Test case for getting a package that has been moved to a nested module, +with a +incompatible verison (and thus no go.mod file) at the root module. + +-- .mod -- +module example.com/split-incompatible/subpkg +-- .info -- +{"Version": "v0.1.0"} +-- go.mod -- +module example.com/split-incompatible/subpkg + +go 1.16 +-- subpkg.go -- +package subpkg diff --git a/src/cmd/go/testdata/mod/example.com_split-incompatible_v2.0.0+incompatible.txt b/src/cmd/go/testdata/mod/example.com_split-incompatible_v2.0.0+incompatible.txt new file mode 100644 index 0000000000..35c3f27710 --- /dev/null +++ b/src/cmd/go/testdata/mod/example.com_split-incompatible_v2.0.0+incompatible.txt @@ -0,0 +1,10 @@ +Written by hand. +Test case for getting a package that has been moved to a nested module, +with a +incompatible verison (and thus no go.mod file) at the root module. + +-- .mod -- +module example.com/split-incompatible +-- .info -- +{"Version": "v2.0.0+incompatible"} +-- subpkg/subpkg.go -- +package subpkg diff --git a/src/cmd/go/testdata/mod/example.com_split-incompatible_v2.1.0-pre+incompatible.txt b/src/cmd/go/testdata/mod/example.com_split-incompatible_v2.1.0-pre+incompatible.txt new file mode 100644 index 0000000000..917fc0f559 --- /dev/null +++ b/src/cmd/go/testdata/mod/example.com_split-incompatible_v2.1.0-pre+incompatible.txt @@ -0,0 +1,10 @@ +Written by hand. +Test case for getting a package that has been moved to a nested module, +with a +incompatible verison (and thus no go.mod file) at the root module. + +-- .mod -- +module example.com/split-incompatible +-- .info -- +{"Version": "v2.1.0-pre+incompatible"} +-- README.txt -- +subpkg has moved to module example.com/split-incompatible/subpkg diff --git a/src/cmd/go/testdata/script/get_insecure_env.txt b/src/cmd/go/testdata/script/get_insecure_env.txt new file mode 100644 index 0000000000..8d88427c31 --- /dev/null +++ b/src/cmd/go/testdata/script/get_insecure_env.txt @@ -0,0 +1,29 @@ +[!net] skip +[!exec:git] skip + +# GOPATH: Set up +env GO111MODULE=off + +# GOPATH: Try go get -d of HTTP-only repo (should fail). +! go get -d insecure.go-get-issue-15410.appspot.com/pkg/p + +# GOPATH: Try again with invalid GOINSECURE (should fail). +env GOINSECURE=insecure.go-get-issue-15410.appspot.com/pkg/q +! go get -d insecure.go-get-issue-15410.appspot.com/pkg/p + +# GOPATH: Try with correct GOINSECURE (should succeed). +env GOINSECURE=insecure.go-get-issue-15410.appspot.com/pkg/p +go get -d insecure.go-get-issue-15410.appspot.com/pkg/p + +# GOPATH: Try updating without GOINSECURE (should fail). +env GOINSECURE= +! go get -d -u -f insecure.go-get-issue-15410.appspot.com/pkg/p + +# GOPATH: Try updating with GOINSECURE glob (should succeed). +env GOINSECURE=*.go-get-*.appspot.com +go get -d -u -f insecure.go-get-issue-15410.appspot.com/pkg/p + +# GOPATH: Try updating with GOINSECURE base URL (should succeed). +env GOINSECURE=insecure.go-get-issue-15410.appspot.com +go get -d -u -f insecure.go-get-issue-15410.appspot.com/pkg/p + diff --git a/src/cmd/go/testdata/script/get_unicode.txt b/src/cmd/go/testdata/script/get_unicode.txt deleted file mode 100644 index d3b82bdf25..0000000000 --- a/src/cmd/go/testdata/script/get_unicode.txt +++ /dev/null @@ -1,40 +0,0 @@ -env GO111MODULE=off - -[!exec:git] skip -[short] skip - -# Construct a repository that imports a non-ASCII path. -cd $WORK/_origin/example.com/unicode -exec git init -exec git config user.name 'Nameless Gopher' -exec git config user.email 'nobody@golang.org' -exec git add unicode.go -exec git commit -m 'add unicode.go' - -# Clone the repo into GOPATH so that 'go get -u' can find it. -mkdir $GOPATH/src/example.com/unicode -cd $GOPATH/src/example.com/unicode -exec git clone $WORK/_origin/example.com/unicode . - -# Construct the imported repository. -cd $WORK/_origin/example.com/испытание -exec git init -exec git config user.name 'Nameless Gopher' -exec git config user.email 'nobody@golang.org' -exec git add испытание.go -exec git commit -m 'add испытание.go' - -# Clone that repo into GOPATH too. -mkdir $GOPATH/src/example.com/испытание -cd $GOPATH/src/example.com/испытание -exec git clone $WORK/_origin/example.com/испытание . - -# Upgrading the importer should pull from the non-ASCII repo. -cd $GOPATH -go get -u example.com/unicode - --- $WORK/_origin/example.com/unicode/unicode.go -- -package unicode -import _ "example.com/испытание" --- $WORK/_origin/example.com/испытание/испытание.go -- -package испытание diff --git a/src/cmd/go/testdata/script/list_bad_import.txt b/src/cmd/go/testdata/script/list_bad_import.txt index b8f9d586f3..dbec35069c 100644 --- a/src/cmd/go/testdata/script/list_bad_import.txt +++ b/src/cmd/go/testdata/script/list_bad_import.txt @@ -15,10 +15,11 @@ stdout 'incomplete' stdout 'bad dep: .*example.com[/\\]notfound' # Listing with -deps should also fail. -# BUG: Today, it does not. -# ! go list -deps example.com/direct -# stderr example.com[/\\]notfound -go list -deps example.com/direct +! go list -deps example.com/direct +stderr example.com[/\\]notfound + +# But -e -deps should succeed. +go list -e -deps example.com/direct stdout example.com/notfound @@ -31,10 +32,11 @@ stdout incomplete stdout 'bad dep: .*example.com[/\\]notfound' # Again, -deps should fail. -# BUG: Again, it does not. -# ! go list -deps example.com/indirect -# stderr example.com[/\\]notfound -go list -deps example.com/indirect +! go list -deps example.com/indirect +stderr example.com[/\\]notfound + +# But -deps -e should succeed. +go list -e -deps example.com/indirect stdout example.com/notfound diff --git a/src/cmd/go/testdata/script/list_test_err.txt b/src/cmd/go/testdata/script/list_test_err.txt index a174b5e9ad..c6f1ecf400 100644 --- a/src/cmd/go/testdata/script/list_test_err.txt +++ b/src/cmd/go/testdata/script/list_test_err.txt @@ -22,6 +22,9 @@ go list -e -test -deps -f '{{.ImportPath}} {{.Error | printf "%q"}}' syntaxerr stdout 'pkgdep <nil>' stdout 'testdep_a <nil>' stdout 'testdep_b <nil>' +stdout 'syntaxerr <nil>' +stdout 'syntaxerr \[syntaxerr.test\] <nil>' +stdout 'syntaxerr_test \[syntaxerr.test\] <nil>' stdout 'syntaxerr\.test "[^"]*expected declaration' ! stderr 'expected declaration' diff --git a/src/cmd/go/testdata/script/mod_all.txt b/src/cmd/go/testdata/script/mod_all.txt new file mode 100644 index 0000000000..aac66292d6 --- /dev/null +++ b/src/cmd/go/testdata/script/mod_all.txt @@ -0,0 +1,444 @@ +# This test illustrates the relationship between the 'all' pattern and +# the dependencies of the main module. + +# The package import graph used in this test looks like: +# +# main --------- a --------- b +# | | +# | a_test ---- c +# | | +# | c_test ---- d +# | +# main_test ---- t --------- u +# | +# t_test ---- w +# | +# w_test ---- x +# +# main/testonly_test ---- q --------- r +# | +# q_test ---- s +# +# And the module dependency graph looks like: +# +# main --- a.1 ---- b.1 +# \ \ \ +# \ \ c.1 -- d.1 +# \ \ +# \ t.1 ---- u.1 +# \ \ +# \ w.1 -- x.1 +# \ +# q.1 ---- r.1 +# \ +# s.1 + +env PKGFMT='{{if .Module}}{{.ImportPath}}{{end}}' +env MODFMT='{{.Path}}' + + +# 'go list -deps' lists packages and tests in the main module, +# along with their transitive dependencies. + +go list -f $PKGFMT -deps ./... +stdout -count=4 '^.' +stdout '^example.com/a$' +stdout '^example.com/b$' +stdout '^example.com/main$' +stdout '^example.com/main/testonly' + + +# 'go list -deps -test' lists transitive imports of tests and non-tests in the +# main module. + +go list -f $PKGFMT -deps -test ./... +stdout -count=13 '^.' +stdout '^example.com/a$' +stdout '^example.com/b$' +stdout '^example.com/main$' +stdout '^example.com/main.test$' +stdout '^example.com/main \[example.com/main.test\]$' +stdout '^example.com/main_test \[example.com/main.test\]$' +stdout '^example.com/main/testonly$' +stdout '^example.com/main/testonly.test$' +stdout '^example.com/main/testonly_test \[example.com/main/testonly.test\]$' +stdout '^example.com/q$' +stdout '^example.com/r$' +stdout '^example.com/t$' +stdout '^example.com/u$' + + +# 'go list all' lists the fixpoint of iterating 'go list -deps -test' starting +# with the packages in the main module, then reducing to only the non-test +# variants of those packages. + +go list -f $PKGFMT all +stdout -count=13 '^.' +stdout '^example.com/a$' +stdout '^example.com/b$' +stdout '^example.com/c$' +stdout '^example.com/d$' +stdout '^example.com/main$' +stdout '^example.com/main/testonly$' +stdout '^example.com/q$' +stdout '^example.com/r$' +stdout '^example.com/s$' +stdout '^example.com/t$' +stdout '^example.com/u$' +stdout '^example.com/w$' +stdout '^example.com/x$' + + +# 'go list -test all' is equivalent to 'go list -test $(go list all)' +# and both should include tests for every package in 'all'. + +go list -test -f $PKGFMT example.com/a example.com/b example.com/c example.com/d example.com/main example.com/main/testonly example.com/q example.com/r example.com/s example.com/t example.com/u example.com/w example.com/x +cp stdout list-test-explicit.txt + +go list -test -f $PKGFMT all +cmp stdout list-test-explicit.txt +stdout -count=36 '^.' +stdout '^example.com/a$' +stdout '^example.com/b$' +stdout '^example.com/c$' +stdout '^example.com/d$' +stdout '^example.com/main$' +stdout '^example.com/main/testonly$' +stdout '^example.com/q$' +stdout '^example.com/r$' +stdout '^example.com/s$' +stdout '^example.com/t$' +stdout '^example.com/u$' +stdout '^example.com/w$' +stdout '^example.com/x$' +stdout '^example.com/a.test$' +stdout '^example.com/a_test \[example.com/a.test\]$' +stdout '^example.com/b.test$' +stdout '^example.com/b_test \[example.com/b.test\]$' +stdout '^example.com/c.test$' +stdout '^example.com/c_test \[example.com/c.test\]$' +stdout '^example.com/main.test$' +stdout '^example.com/main \[example.com/main.test\]$' +stdout '^example.com/main_test \[example.com/main.test\]$' +stdout '^example.com/main/testonly.test$' +stdout '^example.com/main/testonly_test \[example.com/main/testonly.test\]$' +stdout '^example.com/q.test$' +stdout '^example.com/q_test \[example.com/q.test\]$' +stdout '^example.com/r.test$' +stdout '^example.com/r_test \[example.com/r.test\]$' +stdout '^example.com/s.test$' +stdout '^example.com/s_test \[example.com/s.test\]$' +stdout '^example.com/t.test$' +stdout '^example.com/t_test \[example.com/t.test\]$' +stdout '^example.com/u.test$' +stdout '^example.com/u_test \[example.com/u.test\]$' +stdout '^example.com/w.test$' +stdout '^example.com/w_test \[example.com/w.test\]$' + + +# 'go list -m all' covers the packages in 'go list -test -deps all'. + +go list -m -f $MODFMT all +stdout -count=12 '^.' +stdout '^example.com/a$' +stdout '^example.com/b$' +stdout '^example.com/c$' +stdout '^example.com/d$' +stdout '^example.com/main$' +stdout '^example.com/q$' +stdout '^example.com/r$' +stdout '^example.com/s$' +stdout '^example.com/t$' +stdout '^example.com/u$' +stdout '^example.com/w$' +stdout '^example.com/x$' + + +# 'go mod vendor' copies in only the packages transitively imported by the main +# module, and omits their tests. As a result, the 'all' and '...' patterns +# report fewer packages when using '-mod=vendor'. + +go mod vendor + +go list -f $PKGFMT -mod=vendor all +stdout -count=8 '^.' +stdout '^example.com/a$' +stdout '^example.com/b$' +stdout '^example.com/main$' +stdout '^example.com/main/testonly$' +stdout '^example.com/q$' +stdout '^example.com/r$' +stdout '^example.com/t$' +stdout '^example.com/u$' + +go list -test -f $PKGFMT -mod=vendor all +stdout -count=13 '^.' +stdout '^example.com/a$' +stdout '^example.com/b$' +stdout '^example.com/main$' +stdout '^example.com/main/testonly$' +stdout '^example.com/q$' +stdout '^example.com/r$' +stdout '^example.com/t$' +stdout '^example.com/u$' +stdout '^example.com/main.test$' +stdout '^example.com/main \[example.com/main.test\]$' +stdout '^example.com/main_test \[example.com/main.test\]$' +stdout '^example.com/main/testonly.test$' +stdout '^example.com/main/testonly_test \[example.com/main/testonly.test\]$' + +rm vendor + +# Convert all modules to go 1.16 to enable lazy loading. +go mod edit -go=1.16 a/go.mod +go mod edit -go=1.16 b/go.mod +go mod edit -go=1.16 c/go.mod +go mod edit -go=1.16 d/go.mod +go mod edit -go=1.16 q/go.mod +go mod edit -go=1.16 r/go.mod +go mod edit -go=1.16 s/go.mod +go mod edit -go=1.16 t/go.mod +go mod edit -go=1.16 u/go.mod +go mod edit -go=1.16 w/go.mod +go mod edit -go=1.16 x/go.mod +go mod edit -go=1.16 + +# With lazy loading, 'go list all' with neither -mod=vendor nor -test should +# match -mod=vendor without -test in 1.15. + +go list -f $PKGFMT all +stdout -count=8 '^.' +stdout '^example.com/a$' +stdout '^example.com/b$' +stdout '^example.com/main$' +stdout '^example.com/main/testonly$' +stdout '^example.com/q$' +stdout '^example.com/r$' +stdout '^example.com/t$' +stdout '^example.com/u$' + +# 'go list -test all' should expand that to include the test variants of the +# packages in 'all', but not the dependencies of outside tests. + +go list -test -f $PKGFMT all +stdout -count=25 '^.' +stdout '^example.com/a$' +stdout '^example.com/b$' +stdout '^example.com/main$' +stdout '^example.com/main/testonly$' +stdout '^example.com/q$' +stdout '^example.com/r$' +stdout '^example.com/t$' +stdout '^example.com/u$' +stdout '^example.com/a.test$' +stdout '^example.com/a_test \[example.com/a.test\]$' +stdout '^example.com/b.test$' +stdout '^example.com/b_test \[example.com/b.test\]$' +stdout '^example.com/main.test$' +stdout '^example.com/main \[example.com/main.test\]$' +stdout '^example.com/main_test \[example.com/main.test\]$' +stdout '^example.com/main/testonly.test$' +stdout '^example.com/main/testonly_test \[example.com/main/testonly.test\]$' +stdout '^example.com/q.test$' +stdout '^example.com/q_test \[example.com/q.test\]$' +stdout '^example.com/r.test$' +stdout '^example.com/r_test \[example.com/r.test\]$' +stdout '^example.com/t.test$' +stdout '^example.com/t_test \[example.com/t.test\]$' +stdout '^example.com/u.test$' +stdout '^example.com/u_test \[example.com/u.test\]$' + +# 'go list -test -deps all' should include the dependencies of those tests, +# but not the tests of the dependencies of outside tests. + +go list -test -deps -f $PKGFMT all +stdout -count=28 '^.' +stdout '^example.com/a$' +stdout '^example.com/b$' +stdout '^example.com/c$' +stdout '^example.com/main$' +stdout '^example.com/main/testonly$' +stdout '^example.com/q$' +stdout '^example.com/r$' +stdout '^example.com/s$' +stdout '^example.com/t$' +stdout '^example.com/u$' +stdout '^example.com/w$' +stdout '^example.com/a.test$' +stdout '^example.com/a_test \[example.com/a.test\]$' +stdout '^example.com/b.test$' +stdout '^example.com/b_test \[example.com/b.test\]$' +stdout '^example.com/main.test$' +stdout '^example.com/main \[example.com/main.test\]$' +stdout '^example.com/main_test \[example.com/main.test\]$' +stdout '^example.com/main/testonly.test$' +stdout '^example.com/main/testonly_test \[example.com/main/testonly.test\]$' +stdout '^example.com/q.test$' +stdout '^example.com/q_test \[example.com/q.test\]$' +stdout '^example.com/r.test$' +stdout '^example.com/r_test \[example.com/r.test\]$' +stdout '^example.com/t.test$' +stdout '^example.com/t_test \[example.com/t.test\]$' +stdout '^example.com/u.test$' +stdout '^example.com/u_test \[example.com/u.test\]$' + + +# TODO(#36460): +# 'go list -m all' should exactly cover the packages in 'go list -test all'. + +-- go.mod -- +module example.com/main + +go 1.15 + +require ( + example.com/a v0.1.0 + example.com/b v0.1.0 + example.com/q v0.1.0 + example.com/t v0.1.0 +) + +replace ( + example.com/a v0.1.0 => ./a + example.com/b v0.1.0 => ./b + example.com/c v0.1.0 => ./c + example.com/d v0.1.0 => ./d + example.com/q v0.1.0 => ./q + example.com/r v0.1.0 => ./r + example.com/s v0.1.0 => ./s + example.com/t v0.1.0 => ./t + example.com/u v0.1.0 => ./u + example.com/w v0.1.0 => ./w + example.com/x v0.1.0 => ./x +) +-- main.go -- +package main + +import _ "example.com/a" + +func main() {} +-- main_test.go -- +package main_test + +import _ "example.com/t" +-- testonly/testonly_test.go -- +package testonly_test + +import _ "example.com/q" +-- a/go.mod -- +module example.com/a + +go 1.15 + +require ( + example.com/b v0.1.0 + example.com/c v0.1.0 +) +-- a/a.go -- +package a + +import _ "example.com/b" +-- a/a_test.go -- +package a_test + +import _ "example.com/c" +-- b/go.mod -- +module example.com/b + +go 1.15 +-- b/b.go -- +package b +-- b/b_test.go -- +package b_test +-- c/go.mod -- +module example.com/c + +go 1.15 + +require example.com/d v0.1.0 +-- c/c.go -- +package c +-- c/c_test.go -- +package c_test + +import _ "example.com/d" +-- d/go.mod -- +module example.com/d + +go 1.15 +-- d/d.go -- +package d +-- q/go.mod -- +module example.com/q + +go 1.15 + +require ( + example.com/r v0.1.0 + example.com/s v0.1.0 +) +-- q/q.go -- +package q +import _ "example.com/r" +-- q/q_test.go -- +package q_test +import _ "example.com/s" +-- r/go.mod -- +module example.com/r + +go 1.15 +-- r/r.go -- +package r +-- r/r_test.go -- +package r_test +-- s/go.mod -- +module example.com/s + +go 1.15 +-- s/s.go -- +package s +-- s/s_test.go -- +package s_test +-- t/go.mod -- +module example.com/t + +go 1.15 + +require ( + example.com/u v0.1.0 + example.com/w v0.1.0 +) +-- t/t.go -- +package t + +import _ "example.com/u" +-- t/t_test.go -- +package t_test + +import _ "example.com/w" +-- u/go.mod -- +module example.com/u + +go 1.15 +-- u/u.go -- +package u +-- u/u_test.go -- +package u_test +-- w/go.mod -- +module example.com/w + +go 1.15 + +require example.com/x v0.1.0 +-- w/w.go -- +package w +-- w/w_test.go -- +package w_test + +import _ "example.com/x" +-- x/go.mod -- +module example.com/x + +go 1.15 +-- x/x.go -- +package x diff --git a/src/cmd/go/testdata/script/mod_auth.txt b/src/cmd/go/testdata/script/mod_auth.txt index 5bcbcd1a18..544acbc1f8 100644 --- a/src/cmd/go/testdata/script/mod_auth.txt +++ b/src/cmd/go/testdata/script/mod_auth.txt @@ -7,7 +7,7 @@ env GOSUMDB=off # Without credentials, downloading a module from a path that requires HTTPS # basic auth should fail. env NETRC=$WORK/empty -! go list all +! go mod tidy stderr '^\tserver response: ACCESS DENIED, buddy$' stderr '^\tserver response: File\? What file\?$' diff --git a/src/cmd/go/testdata/script/mod_bad_filenames.txt b/src/cmd/go/testdata/script/mod_bad_filenames.txt index 6e0c8bd302..eb556f4c7c 100644 --- a/src/cmd/go/testdata/script/mod_bad_filenames.txt +++ b/src/cmd/go/testdata/script/mod_bad_filenames.txt @@ -3,9 +3,9 @@ env GO111MODULE=on ! go get rsc.io/badfile1 rsc.io/badfile2 rsc.io/badfile3 rsc.io/badfile4 rsc.io/badfile5 ! stderr 'unzip.*badfile1' stderr 'unzip.*badfile2[\\/]@v[\\/]v1.0.0.zip:.*malformed file path "☺.go": invalid char ''☺''' -stderr 'unzip.*badfile3[\\/]@v[\\/]v1.0.0.zip: malformed file path "x\?y.go": invalid char ''\?''' -stderr 'unzip.*badfile4[\\/]@v[\\/]v1.0.0.zip: case-insensitive file name collision: "x/Y.go" and "x/y.go"' -stderr 'unzip.*badfile5[\\/]@v[\\/]v1.0.0.zip: case-insensitive file name collision: "x/y" and "x/Y"' +stderr 'unzip.*badfile3[\\/]@v[\\/]v1.0.0.zip: rsc.io[\\/]badfile3@v1.0.0[\\/]x\?y.go: malformed file path "x\?y.go": invalid char ''\?''' +stderr 'unzip.*badfile4[\\/]@v[\\/]v1.0.0.zip: rsc.io[\\/]badfile4@v1.0.0[\\/]x[\\/]y.go: case-insensitive file name collision: "x/Y.go" and "x/y.go"' +stderr 'unzip.*badfile5[\\/]@v[\\/]v1.0.0.zip: rsc.io[\\/]badfile5@v1.0.0[\\/]x[\\/]Y[\\/]zz[\\/]ww.go: case-insensitive file name collision: "x/y" and "x/Y"' -- go.mod -- module x diff --git a/src/cmd/go/testdata/script/mod_build_info_err.txt b/src/cmd/go/testdata/script/mod_build_info_err.txt index 87a099b219..a6853b5c86 100644 --- a/src/cmd/go/testdata/script/mod_build_info_err.txt +++ b/src/cmd/go/testdata/script/mod_build_info_err.txt @@ -2,7 +2,7 @@ # Verifies golang.org/issue/34393. go list -e -deps -f '{{with .Error}}{{.Pos}}: {{.Err}}{{end}}' ./main -stdout 'bad[/\\]bad.go:3:8: malformed module path "🐧.example.com/string": invalid char ''🐧''' +stdout 'bad[/\\]bad.go:3:8: malformed import path "🐧.example.com/string": invalid char ''🐧''' -- go.mod -- module m diff --git a/src/cmd/go/testdata/script/mod_case.txt b/src/cmd/go/testdata/script/mod_case.txt index ee818c2c07..6f8d869c44 100644 --- a/src/cmd/go/testdata/script/mod_case.txt +++ b/src/cmd/go/testdata/script/mod_case.txt @@ -1,6 +1,6 @@ env GO111MODULE=on -go get rsc.io/QUOTE +go get -d go list -m all stdout '^rsc.io/quote v1.5.2' stdout '^rsc.io/QUOTE v1.5.2' @@ -18,3 +18,8 @@ stdout '!q!u!o!t!e@v1.5.3-!p!r!e' -- go.mod -- module x + +-- use.go -- +package use + +import _ "rsc.io/QUOTE/QUOTE" diff --git a/src/cmd/go/testdata/script/mod_concurrent.txt b/src/cmd/go/testdata/script/mod_concurrent.txt index e03e5e5edb..8c21525158 100644 --- a/src/cmd/go/testdata/script/mod_concurrent.txt +++ b/src/cmd/go/testdata/script/mod_concurrent.txt @@ -1,6 +1,7 @@ env GO111MODULE=on # Concurrent builds should succeed, even if they need to download modules. +go get -d ./x ./y go build ./x & go build ./y wait diff --git a/src/cmd/go/testdata/script/mod_doc.txt b/src/cmd/go/testdata/script/mod_doc.txt index aac3db00be..595ad679fc 100644 --- a/src/cmd/go/testdata/script/mod_doc.txt +++ b/src/cmd/go/testdata/script/mod_doc.txt @@ -1,6 +1,7 @@ # go doc should find module documentation env GO111MODULE=on +env GOFLAGS=-mod=mod [short] skip # Check when module x is inside GOPATH/src. @@ -48,6 +49,7 @@ stderr '^doc: cannot find module providing package example.com/hello: module loo # path used in source code, not to the absolute path relative to GOROOT. cd $GOROOT/src +env GOFLAGS= go doc cryptobyte stdout '// import "golang.org/x/crypto/cryptobyte"' diff --git a/src/cmd/go/testdata/script/mod_domain_root.txt b/src/cmd/go/testdata/script/mod_domain_root.txt index e34cc29fa6..14745b5812 100644 --- a/src/cmd/go/testdata/script/mod_domain_root.txt +++ b/src/cmd/go/testdata/script/mod_domain_root.txt @@ -2,7 +2,7 @@ # (example.com not example.com/something) env GO111MODULE=on -go build +go get -d -- go.mod -- module x diff --git a/src/cmd/go/testdata/script/mod_download.txt b/src/cmd/go/testdata/script/mod_download.txt index bb5c4627db..c53bbe4567 100644 --- a/src/cmd/go/testdata/script/mod_download.txt +++ b/src/cmd/go/testdata/script/mod_download.txt @@ -1,13 +1,15 @@ env GO111MODULE=on -# download with version should print nothing +# download with version should print nothing. +# It should not load retractions from the .mod file from the latest version. go mod download rsc.io/quote@v1.5.0 ! stdout . ! stderr . - exists $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.0.info exists $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.0.mod exists $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.0.zip +! exists $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.2.info +! exists $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.2.mod # download of an invalid path should report the error [short] skip @@ -31,53 +33,59 @@ stdout '^\t"GoModSum": "h1:LzX7hefJvL54yjefDEDHNONDjII0t9xZLPXsUe\+TKr0="' go list -m all ! stdout rsc.io -# add to go.mod so we can test non-query downloads -go mod edit -require rsc.io/quote@v1.5.2 -! exists $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.2.info -! exists $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.2.mod -! exists $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.2.zip - -# module loading will page in the info and mod files -go list -m all +# download query should have downloaded go.mod for the highest release version +# in order to find retractions when resolving the query '@<=v1.5.0'. exists $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.2.info exists $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.2.mod ! exists $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.2.zip +# add to go.mod so we can test non-query downloads +go mod edit -require rsc.io/quote@v1.5.3-pre1 +! exists $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.3-pre1.info +! exists $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.3-pre1.mod +! exists $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.3-pre1.zip + +# module loading will page in the info and mod files +go list -m -mod=mod all +exists $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.3-pre1.info +exists $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.3-pre1.mod +! exists $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.3-pre1.zip + # download will fetch and unpack the zip file go mod download -exists $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.2.info -exists $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.2.mod -exists $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.2.zip -exists $GOPATH/pkg/mod/rsc.io/quote@v1.5.2 +exists $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.3-pre1.info +exists $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.3-pre1.mod +exists $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.3-pre1.zip +exists $GOPATH/pkg/mod/rsc.io/quote@v1.5.3-pre1 # download repopulates deleted files and directories independently. -rm $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.2.info +rm $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.3-pre1.info go mod download -exists $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.2.info -rm $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.2.mod +exists $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.3-pre1.info +rm $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.3-pre1.mod go mod download -exists $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.2.mod -rm $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.2.zip +exists $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.3-pre1.mod +rm $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.3-pre1.zip go mod download -exists $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.2.zip -rm -r $GOPATH/pkg/mod/rsc.io/quote@v1.5.2 +exists $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.3-pre1.zip +rm -r $GOPATH/pkg/mod/rsc.io/quote@v1.5.3-pre1 go mod download -exists $GOPATH/pkg/mod/rsc.io/quote@v1.5.2 +exists $GOPATH/pkg/mod/rsc.io/quote@v1.5.3-pre1 # download reports the locations of downloaded files go mod download -json stdout '^\t"Path": "rsc.io/quote"' -stdout '^\t"Version": "v1.5.2"' -stdout '^\t"Info": ".*(\\\\|/)pkg(\\\\|/)mod(\\\\|/)cache(\\\\|/)download(\\\\|/)rsc.io(\\\\|/)quote(\\\\|/)@v(\\\\|/)v1.5.2.info"' -stdout '^\t"GoMod": ".*(\\\\|/)pkg(\\\\|/)mod(\\\\|/)cache(\\\\|/)download(\\\\|/)rsc.io(\\\\|/)quote(\\\\|/)@v(\\\\|/)v1.5.2.mod"' -stdout '^\t"Zip": ".*(\\\\|/)pkg(\\\\|/)mod(\\\\|/)cache(\\\\|/)download(\\\\|/)rsc.io(\\\\|/)quote(\\\\|/)@v(\\\\|/)v1.5.2.zip"' -stdout '^\t"Dir": ".*(\\\\|/)pkg(\\\\|/)mod(\\\\|/)rsc.io(\\\\|/)quote@v1.5.2"' +stdout '^\t"Version": "v1.5.3-pre1"' +stdout '^\t"Info": ".*(\\\\|/)pkg(\\\\|/)mod(\\\\|/)cache(\\\\|/)download(\\\\|/)rsc.io(\\\\|/)quote(\\\\|/)@v(\\\\|/)v1.5.3-pre1.info"' +stdout '^\t"GoMod": ".*(\\\\|/)pkg(\\\\|/)mod(\\\\|/)cache(\\\\|/)download(\\\\|/)rsc.io(\\\\|/)quote(\\\\|/)@v(\\\\|/)v1.5.3-pre1.mod"' +stdout '^\t"Zip": ".*(\\\\|/)pkg(\\\\|/)mod(\\\\|/)cache(\\\\|/)download(\\\\|/)rsc.io(\\\\|/)quote(\\\\|/)@v(\\\\|/)v1.5.3-pre1.zip"' +stdout '^\t"Dir": ".*(\\\\|/)pkg(\\\\|/)mod(\\\\|/)rsc.io(\\\\|/)quote@v1.5.3-pre1"' # download will follow replacements -go mod edit -require rsc.io/quote@v1.5.1 -replace rsc.io/quote@v1.5.1=rsc.io/quote@v1.5.3-pre1 +go mod edit -require rsc.io/quote@v1.5.1 -replace rsc.io/quote@v1.5.1=rsc.io/quote@v1.5.2 go mod download ! exists $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.1.zip -exists $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.3-pre1.zip +exists $GOPATH/pkg/mod/cache/download/rsc.io/quote/@v/v1.5.2.zip # download will not follow replacements for explicit module queries go mod download -json rsc.io/quote@v1.5.1 @@ -99,6 +107,14 @@ stderr '^go mod download: skipping argument m that resolves to the main module\n go mod download m@latest stderr '^go mod download: skipping argument m@latest that resolves to the main module\n' +# download updates go.mod and populates go.sum +cd update +! exists go.sum +go mod download +grep '^rsc.io/sampler v1.3.0 ' go.sum +go list -m rsc.io/sampler +stdout '^rsc.io/sampler v1.3.0$' + # allow go mod download without go.mod env GO111MODULE=auto rm go.mod @@ -114,3 +130,13 @@ stderr 'get '$GOPROXY -- go.mod -- module m + +-- update/go.mod -- +module m + +go 1.16 + +require ( + rsc.io/quote v1.5.2 + rsc.io/sampler v1.2.1 // older version than in build list +) diff --git a/src/cmd/go/testdata/script/mod_download_json.txt b/src/cmd/go/testdata/script/mod_download_json.txt index 26291681ce..9555adf8c4 100644 --- a/src/cmd/go/testdata/script/mod_download_json.txt +++ b/src/cmd/go/testdata/script/mod_download_json.txt @@ -3,7 +3,7 @@ env GOSUMDB=$sumdb' '$proxy/sumdb-wrong # download -json with version should print JSON on sumdb failure ! go mod download -json 'rsc.io/quote@<=v1.5.0' -stdout '"Error": ".*verifying module' +stdout '"Error": ".*verifying (module|go.mod)' -- go.mod -- module m diff --git a/src/cmd/go/testdata/script/mod_download_partial.txt b/src/cmd/go/testdata/script/mod_download_partial.txt index 4978982dab..8d31970160 100644 --- a/src/cmd/go/testdata/script/mod_download_partial.txt +++ b/src/cmd/go/testdata/script/mod_download_partial.txt @@ -1,5 +1,5 @@ -# Download a module -go mod download -modcacherw rsc.io/quote +# Download modules and populate go.sum. +go get -d -modcacherw exists $GOPATH/pkg/mod/rsc.io/quote@v1.5.2/go.mod # 'go mod verify' should fail if we delete a file. @@ -61,4 +61,9 @@ go 1.14 require rsc.io/quote v1.5.2 +-- use.go -- +package use + +import _ "rsc.io/quote" + -- empty -- diff --git a/src/cmd/go/testdata/script/mod_edit.txt b/src/cmd/go/testdata/script/mod_edit.txt index 898d8524ac..78485eb86a 100644 --- a/src/cmd/go/testdata/script/mod_edit.txt +++ b/src/cmd/go/testdata/script/mod_edit.txt @@ -16,15 +16,19 @@ cmpenv go.mod $WORK/go.mod.init cmpenv go.mod $WORK/go.mod.init # go mod edits -go mod edit -droprequire=x.1 -require=x.1@v1.0.0 -require=x.2@v1.1.0 -droprequire=x.2 -exclude='x.1 @ v1.2.0' -exclude=x.1@v1.2.1 -replace=x.1@v1.3.0=y.1@v1.4.0 -replace='x.1@v1.4.0 = ../z' +go mod edit -droprequire=x.1 -require=x.1@v1.0.0 -require=x.2@v1.1.0 -droprequire=x.2 -exclude='x.1 @ v1.2.0' -exclude=x.1@v1.2.1 -replace=x.1@v1.3.0=y.1@v1.4.0 -replace='x.1@v1.4.0 = ../z' -retract=v1.6.0 -retract=[v1.1.0,v1.2.0] -retract=[v1.3.0,v1.4.0] -retract=v1.0.0 cmpenv go.mod $WORK/go.mod.edit1 -go mod edit -droprequire=x.1 -dropexclude=x.1@v1.2.1 -dropreplace=x.1@v1.3.0 -require=x.3@v1.99.0 +go mod edit -droprequire=x.1 -dropexclude=x.1@v1.2.1 -dropreplace=x.1@v1.3.0 -require=x.3@v1.99.0 -dropretract=v1.0.0 -dropretract=[v1.1.0,v1.2.0] cmpenv go.mod $WORK/go.mod.edit2 # go mod edit -json go mod edit -json cmpenv stdout $WORK/go.mod.json +# go mod edit -json (retractions with rationales) +go mod edit -json $WORK/go.mod.retractrationale +cmp stdout $WORK/go.mod.retractrationale.json + # go mod edit -json (empty mod file) go mod edit -json $WORK/go.mod.empty cmp stdout $WORK/go.mod.empty.json @@ -40,11 +44,11 @@ cmpenv go.mod $WORK/go.mod.edit5 # go mod edit -fmt cp $WORK/go.mod.badfmt go.mod go mod edit -fmt -print # -print should avoid writing file -cmpenv stdout $WORK/go.mod.edit6 +cmpenv stdout $WORK/go.mod.goodfmt cmp go.mod $WORK/go.mod.badfmt go mod edit -fmt # without -print, should write file (and nothing to stdout) ! stdout . -cmpenv go.mod $WORK/go.mod.edit6 +cmpenv go.mod $WORK/go.mod.goodfmt # go mod edit -module cd $WORK/m @@ -84,6 +88,13 @@ replace ( x.1 v1.3.0 => y.1 v1.4.0 x.1 v1.4.0 => ../z ) + +retract ( + v1.6.0 + [v1.3.0, v1.4.0] + [v1.1.0, v1.2.0] + v1.0.0 +) -- $WORK/go.mod.edit2 -- module x.x/y/z @@ -93,6 +104,11 @@ exclude x.1 v1.2.0 replace x.1 v1.4.0 => ../z +retract ( + v1.6.0 + [v1.3.0, v1.4.0] +) + require x.3 v1.99.0 -- $WORK/go.mod.json -- { @@ -122,6 +138,16 @@ require x.3 v1.99.0 "Path": "../z" } } + ], + "Retract": [ + { + "Low": "v1.6.0", + "High": "v1.6.0" + }, + { + "Low": "v1.3.0", + "High": "v1.4.0" + } ] } -- $WORK/go.mod.edit3 -- @@ -136,6 +162,11 @@ replace ( x.1 v1.4.0 => y.1/v2 v2.3.5 ) +retract ( + v1.6.0 + [v1.3.0, v1.4.0] +) + require x.3 v1.99.0 -- $WORK/go.mod.edit4 -- module x.x/y/z @@ -146,6 +177,11 @@ exclude x.1 v1.2.0 replace x.1 => y.1/v2 v2.3.6 +retract ( + v1.6.0 + [v1.3.0, v1.4.0] +) + require x.3 v1.99.0 -- $WORK/go.mod.edit5 -- module x.x/y/z @@ -154,15 +190,10 @@ go $goversion exclude x.1 v1.2.0 -require x.3 v1.99.0 --- $WORK/go.mod.edit6 -- -module x.x/y/z - -go 1.10 - -exclude x.1 v1.2.0 - -replace x.1 => y.1/v2 v2.3.6 +retract ( + v1.6.0 + [v1.3.0, v1.4.0] +) require x.3 v1.99.0 -- $WORK/local/go.mod.edit -- @@ -183,10 +214,64 @@ exclude x.1 v1.2.0 replace x.1 => y.1/v2 v2.3.6 require x.3 v1.99.0 + +retract [ "v1.8.1" , "v1.8.2" ] +-- $WORK/go.mod.goodfmt -- +module x.x/y/z + +go 1.10 + +exclude x.1 v1.2.0 + +replace x.1 => y.1/v2 v2.3.6 + +require x.3 v1.99.0 + +retract [v1.8.1, v1.8.2] -- $WORK/m/go.mod.edit -- module x.x/y/z go $goversion +-- $WORK/go.mod.retractrationale -- +module x.x/y/z + +go 1.15 + +// a +retract v1.0.0 + +// b +retract ( + v1.0.1 + v1.0.2 // c +) +-- $WORK/go.mod.retractrationale.json -- +{ + "Module": { + "Path": "x.x/y/z" + }, + "Go": "1.15", + "Require": null, + "Exclude": null, + "Replace": null, + "Retract": [ + { + "Low": "v1.0.0", + "High": "v1.0.0", + "Rationale": "a" + }, + { + "Low": "v1.0.1", + "High": "v1.0.1", + "Rationale": "b" + }, + { + "Low": "v1.0.2", + "High": "v1.0.2", + "Rationale": "c" + } + ] +} -- $WORK/go.mod.empty -- -- $WORK/go.mod.empty.json -- { @@ -195,5 +280,6 @@ go $goversion }, "Require": null, "Exclude": null, - "Replace": null + "Replace": null, + "Retract": null } diff --git a/src/cmd/go/testdata/script/mod_find.txt b/src/cmd/go/testdata/script/mod_find.txt index 7fbe9fb7fe..9468acfd33 100644 --- a/src/cmd/go/testdata/script/mod_find.txt +++ b/src/cmd/go/testdata/script/mod_find.txt @@ -19,6 +19,11 @@ go mod init stderr 'module example.com/x/y$' rm go.mod +# go mod init rejects a zero-length go.mod file +cp $devnull go.mod # can't use touch to create it because Windows +! go mod init +stderr 'go.mod already exists' + # Module path from Godeps/Godeps.json overrides GOPATH. cd $GOPATH/src/example.com/x/y/z go mod init diff --git a/src/cmd/go/testdata/script/mod_get_incompatible.txt b/src/cmd/go/testdata/script/mod_get_incompatible.txt index b210715a5d..b28718a694 100644 --- a/src/cmd/go/testdata/script/mod_get_incompatible.txt +++ b/src/cmd/go/testdata/script/mod_get_incompatible.txt @@ -1,6 +1,6 @@ env GO111MODULE=on -go list x +go get -d x go list -m all stdout 'rsc.io/breaker v2.0.0\+incompatible' diff --git a/src/cmd/go/testdata/script/mod_get_indirect.txt b/src/cmd/go/testdata/script/mod_get_indirect.txt index f25e170a49..e1cc1ab411 100644 --- a/src/cmd/go/testdata/script/mod_get_indirect.txt +++ b/src/cmd/go/testdata/script/mod_get_indirect.txt @@ -27,7 +27,7 @@ grep 'golang.org/x/text v0.3.0 // indirect$' go.mod # indirect tag should be removed upon seeing direct import. cp $WORK/tmp/uselang.go x.go -go list +go get -d grep 'rsc.io/quote v1.5.2$' go.mod grep 'golang.org/x/text [v0-9a-f\.-]+$' go.mod diff --git a/src/cmd/go/testdata/script/mod_get_latest_pseudo.txt b/src/cmd/go/testdata/script/mod_get_latest_pseudo.txt index 825ee8cf89..241a0c2f0d 100644 --- a/src/cmd/go/testdata/script/mod_get_latest_pseudo.txt +++ b/src/cmd/go/testdata/script/mod_get_latest_pseudo.txt @@ -5,6 +5,6 @@ env GO111MODULE=on go mod init m -go list example.com/notags +go get -d example.com/notags go list -m all stdout '^example.com/notags v0.0.0-20190507143103-cc8cbe209b64$' diff --git a/src/cmd/go/testdata/script/mod_get_retract.txt b/src/cmd/go/testdata/script/mod_get_retract.txt new file mode 100644 index 0000000000..da6c25523f --- /dev/null +++ b/src/cmd/go/testdata/script/mod_get_retract.txt @@ -0,0 +1,49 @@ +# 'go get pkg' should not upgrade to a retracted version. +cp go.mod.orig go.mod +go mod edit -require example.com/retract/self/prev@v1.1.0 +go get -d example.com/retract/self/prev +go list -m example.com/retract/self/prev +stdout '^example.com/retract/self/prev v1.1.0$' + +# 'go get pkg' should not downgrade from a retracted version when no higher +# version is available. +cp go.mod.orig go.mod +go mod edit -require example.com/retract/self/prev@v1.9.0 +go get -d example.com/retract/self/prev +stderr '^go: warning: example.com/retract/self/prev@v1.9.0 is retracted: self$' +go list -m example.com/retract/self/prev +stdout '^example.com/retract/self/prev v1.9.0$' + +# 'go get pkg@latest' should downgrade from a retracted version. +cp go.mod.orig go.mod +go mod edit -require example.com/retract/self/prev@v1.9.0 +go get -d example.com/retract/self/prev@latest +go list -m example.com/retract/self/prev +stdout '^example.com/retract/self/prev v1.1.0$' + +# 'go get pkg@version' should update to a specific version, even if that +# version is retracted. +cp go.mod.orig go.mod +go get -d example.com/retract@v1.0.0-bad +stderr '^go: warning: example.com/retract@v1.0.0-bad is retracted: bad$' +go list -m example.com/retract +stdout '^example.com/retract v1.0.0-bad$' + +# 'go get -u' should not downgrade from a retracted version when no higher +# version is available. +cp go.mod.orig go.mod +go mod edit -require example.com/retract/self/prev@v1.9.0 +go get -d -u . +stderr '^go: warning: example.com/retract/self/prev@v1.9.0 is retracted: self$' +go list -m example.com/retract/self/prev +stdout '^example.com/retract/self/prev v1.9.0$' + +-- go.mod.orig -- +module example.com/use + +go 1.15 + +-- use.go -- +package use + +import _ "example.com/retract/self/prev" diff --git a/src/cmd/go/testdata/script/mod_get_sum_noroot.txt b/src/cmd/go/testdata/script/mod_get_sum_noroot.txt new file mode 100644 index 0000000000..0d9a840e77 --- /dev/null +++ b/src/cmd/go/testdata/script/mod_get_sum_noroot.txt @@ -0,0 +1,11 @@ +# When 'go get' is invoked on a module without a package in the root directory, +# it should add sums for the module's go.mod file and its content to go.sum. +# Verifies golang.org/issue/41103. +go mod init m +go get rsc.io/QUOTE +grep '^rsc.io/QUOTE v1.5.2/go.mod ' go.sum +grep '^rsc.io/QUOTE v1.5.2 ' go.sum + +# Double-check rsc.io/QUOTE does not have a root package. +! go list -mod=readonly rsc.io/QUOTE +stderr '^cannot find module providing package rsc.io/QUOTE: import lookup disabled by -mod=readonly$' diff --git a/src/cmd/go/testdata/script/mod_get_trailing_slash.txt b/src/cmd/go/testdata/script/mod_get_trailing_slash.txt index 7b5d90c50b..3b38d8ba7d 100644 --- a/src/cmd/go/testdata/script/mod_get_trailing_slash.txt +++ b/src/cmd/go/testdata/script/mod_get_trailing_slash.txt @@ -1,3 +1,6 @@ +# Populate go.sum +go mod download + # go list should succeed to load a package ending with ".go" if the path does # not correspond to an existing local file. Listing a pattern ending with # ".go/" should try to list a package regardless of whether a file exists at the diff --git a/src/cmd/go/testdata/script/mod_import.txt b/src/cmd/go/testdata/script/mod_import.txt index 3985b43144..28358b5b0c 100644 --- a/src/cmd/go/testdata/script/mod_import.txt +++ b/src/cmd/go/testdata/script/mod_import.txt @@ -1,7 +1,7 @@ env GO111MODULE=on # latest rsc.io/quote should be v1.5.2 not v1.5.3-pre1 -go list +go get -d go list -m all stdout 'rsc.io/quote v1.5.2' diff --git a/src/cmd/go/testdata/script/mod_import_issue41113.txt b/src/cmd/go/testdata/script/mod_import_issue41113.txt new file mode 100644 index 0000000000..e98ac63d48 --- /dev/null +++ b/src/cmd/go/testdata/script/mod_import_issue41113.txt @@ -0,0 +1,28 @@ +# Regression test for https://golang.org/issue/41113. +# +# When resolving a missing import path, the inability to add the package from +# one module path should not interfere with adding a nested path. + +# Initially, our module depends on split-incompatible v2.1.0-pre+incompatible, +# from which an imported package has been removed (and relocated to the nested +# split-incompatible/subpkg module). modload.QueryPackage will suggest +# split-incompatible v2.0.0+incompatible, which we cannot use (because it would +# be an implicit downgrade), and split-incompatible/subpkg v0.1.0, which we +# *should* use. + +go mod tidy + +go list -m all +stdout '^example.com/split-incompatible/subpkg v0\.1\.0$' +! stdout '^example.com/split-incompatible .*' + +-- go.mod -- +module golang.org/issue/41113 + +go 1.16 + +require example.com/split-incompatible v2.1.0-pre+incompatible +-- x.go -- +package issue41113 + +import _ "example.com/split-incompatible/subpkg" diff --git a/src/cmd/go/testdata/script/mod_in_testdata_dir.txt b/src/cmd/go/testdata/script/mod_in_testdata_dir.txt index f582569798..66f79faa6d 100644 --- a/src/cmd/go/testdata/script/mod_in_testdata_dir.txt +++ b/src/cmd/go/testdata/script/mod_in_testdata_dir.txt @@ -8,8 +8,8 @@ env GO111MODULE=on cd $WORK/testdata go mod init testdata.tld/foo -# Building a package within that module should resolve its dependencies. -go build +# Getting a package within that module should resolve its dependencies. +go get -d grep 'rsc.io/quote' go.mod # Tidying the module should preserve those dependencies. @@ -26,7 +26,7 @@ exists vendor/rsc.io/quote cd $WORK/_ignored go mod init testdata.tld/foo -go build +go get grep 'rsc.io/quote' go.mod go mod tidy diff --git a/src/cmd/go/testdata/script/mod_init_dep.txt b/src/cmd/go/testdata/script/mod_init_dep.txt index 755076eae8..f8cf1d563a 100644 --- a/src/cmd/go/testdata/script/mod_init_dep.txt +++ b/src/cmd/go/testdata/script/mod_init_dep.txt @@ -1,24 +1,14 @@ env GO111MODULE=on +env GOFLAGS=-mod=mod # modconv uses git directly to examine what old 'go get' would [!net] skip [!exec:git] skip -# go build should populate go.mod from Gopkg.lock -cp go.mod1 go.mod -go build +# go mod init should populate go.mod from Gopkg.lock +go mod init x stderr 'copying requirements from Gopkg.lock' go list -m all -! stderr 'copying requirements from Gopkg.lock' -stdout 'rsc.io/sampler v1.0.0' - -# go list should populate go.mod from Gopkg.lock -cp go.mod1 go.mod -go list -stderr 'copying requirements from Gopkg.lock' -go list -! stderr 'copying requirements from Gopkg.lock' -go list -m all stdout 'rsc.io/sampler v1.0.0' # test dep replacement @@ -26,9 +16,6 @@ cd y go mod init cmpenv go.mod go.mod.replace --- go.mod1 -- -module x - -- x.go -- package x @@ -54,4 +41,4 @@ go $goversion replace z v1.0.0 => rsc.io/quote v1.0.0 -require rsc.io/quote v1.0.0
\ No newline at end of file +require rsc.io/quote v1.0.0 diff --git a/src/cmd/go/testdata/script/mod_install_versioned.txt b/src/cmd/go/testdata/script/mod_install_versioned.txt index 03986d06a0..c6bce418b4 100644 --- a/src/cmd/go/testdata/script/mod_install_versioned.txt +++ b/src/cmd/go/testdata/script/mod_install_versioned.txt @@ -1,9 +1,11 @@ env GO111MODULE=on +go get -d rsc.io/fortune go list -f '{{.Target}}' rsc.io/fortune ! stdout fortune@v1 stdout 'fortune(\.exe)?$' +go get -d rsc.io/fortune/v2 go list -f '{{.Target}}' rsc.io/fortune/v2 ! stdout v2 stdout 'fortune(\.exe)?$' diff --git a/src/cmd/go/testdata/script/mod_internal.txt b/src/cmd/go/testdata/script/mod_internal.txt index 1193d528ec..687269d18f 100644 --- a/src/cmd/go/testdata/script/mod_internal.txt +++ b/src/cmd/go/testdata/script/mod_internal.txt @@ -3,30 +3,34 @@ env GO111MODULE=on # golang.org/x/internal should be importable from other golang.org/x modules. go mod edit -module=golang.org/x/anything -go build . +go get -d . # ...and their tests... go test stdout PASS # ...but that should not leak into other modules. +go get -d ./baddep ! go build ./baddep stderr golang.org[/\\]notx[/\\]useinternal stderr 'use of internal package golang.org/x/.* not allowed' # Internal packages in the standard library should not leak into modules. +go get -d ./fromstd ! go build ./fromstd stderr 'use of internal package internal/testenv not allowed' # Dependencies should be able to use their own internal modules... go mod edit -module=golang.org/notx -go build ./throughdep +go get -d ./throughdep # ... but other modules should not, even if they have transitive dependencies. +go get -d . ! go build . stderr 'use of internal package golang.org/x/.* not allowed' # And transitive dependencies still should not leak. +go get -d ./baddep ! go build ./baddep stderr golang.org[/\\]notx[/\\]useinternal stderr 'use of internal package golang.org/x/.* not allowed' @@ -34,15 +38,17 @@ stderr 'use of internal package golang.org/x/.* not allowed' # Replacing an internal module should keep it internal to the same paths. go mod edit -module=golang.org/notx go mod edit -replace golang.org/x/internal=./replace/golang.org/notx/internal -go build ./throughdep +go get -d ./throughdep +go get -d ./baddep ! go build ./baddep stderr golang.org[/\\]notx[/\\]useinternal stderr 'use of internal package golang.org/x/.* not allowed' go mod edit -replace golang.org/x/internal=./vendor/golang.org/x/internal -go build ./throughdep +go get -d ./throughdep +go get -d ./baddep ! go build ./baddep stderr golang.org[/\\]notx[/\\]useinternal stderr 'use of internal package golang.org/x/.* not allowed' diff --git a/src/cmd/go/testdata/script/mod_invalid_path.txt b/src/cmd/go/testdata/script/mod_invalid_path.txt new file mode 100644 index 0000000000..05a5133571 --- /dev/null +++ b/src/cmd/go/testdata/script/mod_invalid_path.txt @@ -0,0 +1,40 @@ +# Test that mod files with invalid or missing paths produce an error. + +# Test that go list fails on a go.mod with no module declaration. +cd $WORK/gopath/src/mod +! go list . +stderr '^go: no module declaration in go.mod.\n\tRun ''go mod edit -module=example.com/mod'' to specify the module path.$' + +# Test that go mod init in GOPATH doesn't add a module declaration +# with a path that can't possibly be a module path, because +# it isn't even a valid import path. +# The single quote and backtick are the only characters we don't allow +# in checkModulePathLax, but is allowed in a Windows file name. +# TODO(matloob): choose a different character once +# module.CheckImportPath is laxened and replaces +# checkModulePathLax. +cd $WORK/'gopath/src/m''d' +! go mod init +stderr 'cannot determine module path' + +# Test that a go.mod file is rejected when its module declaration has a path that can't +# possibly be a module path, because it isn't even a valid import path +cd $WORK/gopath/src/badname +! go list . +stderr 'invalid module path' + +-- mod/go.mod -- + +-- mod/foo.go -- +package foo + +-- m'd/foo.go -- +package mad + +-- badname/go.mod -- + +module .\. + +-- badname/foo.go -- +package badname + diff --git a/src/cmd/go/testdata/script/mod_invalid_version.txt b/src/cmd/go/testdata/script/mod_invalid_version.txt index 7e1bc9ea4f..f9dfdd6346 100644 --- a/src/cmd/go/testdata/script/mod_invalid_version.txt +++ b/src/cmd/go/testdata/script/mod_invalid_version.txt @@ -4,6 +4,7 @@ env GO111MODULE=on env GOPROXY=direct env GOSUMDB=off +env GOFLAGS=-mod=mod # Regression test for golang.org/issue/27173: if the user (or go.mod file) # requests a pseudo-version that does not match both the module path and commit @@ -18,7 +19,7 @@ cp go.mod.orig go.mod go mod edit -require golang.org/x/text@14c0d48ead0c cd outside ! go list -m golang.org/x/text -stderr 'go: example.com@v0.0.0: parsing ../go.mod: '$WORK'/gopath/src/go.mod:5: require golang.org/x/text: version "14c0d48ead0c" invalid: must be of the form v1.2.3' +stderr 'go: example.com@v0.0.0 \(replaced by \./\..\): parsing ../go.mod: '$WORK'/gopath/src/go.mod:5: require golang.org/x/text: version "14c0d48ead0c" invalid: must be of the form v1.2.3' cd .. go list -m golang.org/x/text stdout 'golang.org/x/text v0.1.1-0.20170915032832-14c0d48ead0c' @@ -46,7 +47,7 @@ cp go.mod.orig go.mod go mod edit -require golang.org/x/text@v2.1.1-0.20170915032832-14c0d48ead0c cd outside ! go list -m golang.org/x/text -stderr 'go: example.com@v0.0.0: parsing ../go.mod: '$WORK'/gopath/src/go.mod:5: require golang.org/x/text: version "v2.1.1-0.20170915032832-14c0d48ead0c" invalid: should be v0 or v1, not v2' +stderr 'go: example.com@v0.0.0 \(replaced by \./\.\.\): parsing ../go.mod: '$WORK'/gopath/src/go.mod:5: require golang.org/x/text: version "v2.1.1-0.20170915032832-14c0d48ead0c" invalid: should be v0 or v1, not v2' cd .. ! go list -m golang.org/x/text stderr $WORK'/gopath/src/go.mod:5: require golang.org/x/text: version "v2.1.1-0.20170915032832-14c0d48ead0c" invalid: should be v0 or v1, not v2' diff --git a/src/cmd/go/testdata/script/mod_lazy_import_allmod.txt b/src/cmd/go/testdata/script/mod_lazy_import_allmod.txt new file mode 100644 index 0000000000..4ad8cbf8ee --- /dev/null +++ b/src/cmd/go/testdata/script/mod_lazy_import_allmod.txt @@ -0,0 +1,172 @@ +# This test demonstrates dependency resolution when the main module imports a +# new package from a previously-test-only dependency. +# +# When lazy loading is active, the loader will not load dependencies of any +# module whose packages are *only* imported by tests outside the main module. If +# the main module is changed to import a package from such a module, the +# dependencies of that module will need to be reloaded. + +# The import graph used in this test looks like: +# +# m ---- a +# \ | +# \ a_test ---- b/x +# \ +# --------------b/y (new) ---- c +# +# Where b/x and b/y are disjoint packages, but both contained in module b. +# +# The module dependency graph initially looks like: +# +# m ---- a.1 ---- b.1 ---- c.1 +# +# This configuration is similar to that used in mod_lazy_new_import, +# but the new import is from what is initially a test-only dependency. + +# Control case: in Go 1.14, the original go.mod is tidy, +# and the dependency on c is eagerly loaded. + +cp go.mod go.mod.orig +go mod tidy +cmp go.mod.orig go.mod + +go list -m all +stdout '^a v0.1.0 ' +stdout '^b v0.1.0 ' +stdout '^c v0.1.0 ' + +# After adding a new import of b/y, +# the import of c from b/y should resolve to the version required by b. + +cp m.go m.go.orig +cp m.go.new m.go +go mod tidy +cmp go.mod.new go.mod + +go list -m all +stdout '^a v0.1.0 ' +stdout '^b v0.1.0 ' +stdout '^c v0.1.0 ' + +# With lazy loading, the go.mod requirements are the same, +# but the dependency on c is initially pruned out. + +cp m.go.orig m.go +cp go.mod.orig go.mod +go mod edit -go=1.16 +go mod edit -go=1.16 go.mod.new + +cp go.mod go.mod.orig +go mod tidy +cmp go.mod.orig go.mod + +go list -m all +stdout '^a v0.1.0 ' +stdout '^b v0.1.0 ' +stdout '^c v0.1.0 ' # TODO(#36460): This should be pruned out. + +# After adding a new import of b/y, +# the import of c from b/y should again resolve to the version required by b. + +cp m.go.new m.go +go mod tidy +cmp go.mod.new go.mod + +go list -m all +stdout '^a v0.1.0 ' +stdout '^b v0.1.0 ' +stdout '^c v0.1.0 ' + +-- m.go -- +package main + +import ( + "fmt" + + _ "a" // a_test imports b/x. +) + +func main() { +} +-- m.go.new -- +package main + +import ( + "fmt" + + _ "a" // a_test imports b/x. + "b/y" // This is a new import, not yet reflected in the go.mod file. +) + +func main() { + fmt.Println(b.CVersion()) +} +-- go.mod -- +module m + +go 1.14 + +require a v0.1.0 + +replace ( + a v0.1.0 => ./a1 + b v0.1.0 => ./b1 + c v0.1.0 => ./c1 + c v0.2.0 => ./c2 +) +-- go.mod.new -- +module m + +go 1.14 + +require ( + a v0.1.0 + b v0.1.0 +) + +replace ( + a v0.1.0 => ./a1 + b v0.1.0 => ./b1 + c v0.1.0 => ./c1 + c v0.2.0 => ./c2 +) +-- a1/go.mod -- +module a + +go 1.16 + +require b v0.1.0 +-- a1/a.go -- +package a +-- a1/a_test.go -- +package a_test + +import _ "b/x" +-- b1/go.mod -- +module b + +go 1.16 + +require c v0.1.0 +-- b1/x/x.go -- +package x +-- b1/y/y.go -- +package y + +import "c" + +func CVersion() string { + return c.Version +} +-- c1/go.mod -- +module c + +go 1.16 +-- c1/c.go -- +package c + +const Version = "v0.1.0" +-- c2/go.mod -- +This file should be unused. +-- c2/c.go -- +This file should be unused. diff --git a/src/cmd/go/testdata/script/mod_lazy_new_import.txt b/src/cmd/go/testdata/script/mod_lazy_new_import.txt new file mode 100644 index 0000000000..02935bf236 --- /dev/null +++ b/src/cmd/go/testdata/script/mod_lazy_new_import.txt @@ -0,0 +1,107 @@ +# This test illustrates the use of a deepening scan to resolve transitive +# imports of imports of new packages from within existing dependencies. + +# The package import graph used in this test looks like: +# +# lazy ---- a/x ---- b +# \ +# ---- a/y ---- c +# +# Where a/x and x/y are disjoint packages, but both contained in module a. +# +# The module dependency graph initially looks like: +# +# lazy ---- a.1 ---- b.1 +# \ +# c.1 + + +cp go.mod go.mod.old +cp lazy.go lazy.go.old +go mod tidy +cmp go.mod go.mod.old + +# Before adding a new import, the go.mod file should +# enumerate modules for all packages already imported. +go list all +cmp go.mod go.mod.old + +# When we add a new import of a package in an existing dependency, +# and that dependency is already tidy, its transitive dependencies +# should already be present. +cp lazy.go.new lazy.go +go list all +go list -m all +stdout '^example.com/c v0.1.0' # not v0.2.0 as would be be resolved by 'latest' +cmp go.mod go.mod.old + +# TODO(#36460): +cp lazy.go.old lazy.go +cp go.mod.old go.mod +go mod edit -go=1.16 + +# When a new import is found, we should perform a deepening scan of the existing +# dependencies and add a requirement on the version required by those +# dependencies — not re-resolve 'latest'. + + +-- go.mod -- +module example.com/lazy + +go 1.15 + +require example.com/a v0.1.0 + +replace ( + example.com/a v0.1.0 => ./a + example.com/b v0.1.0 => ./b + example.com/c v0.1.0 => ./c1 + example.com/c v0.2.0 => ./c2 +) +-- lazy.go -- +package lazy + +import ( + _ "example.com/a/x" +) +-- lazy.go.new -- +package lazy + +import ( + _ "example.com/a/x" + _ "example.com/a/y" +) +-- a/go.mod -- +module example.com/a + +go 1.15 + +require ( + example.com/b v0.1.0 + example.com/c v0.1.0 +) +-- a/x/x.go -- +package x +import _ "example.com/b" +-- a/y/y.go -- +package y +import _ "example.com/c" +-- b/go.mod -- +module example.com/b + +go 1.15 +-- b/b.go -- +package b +-- c1/go.mod -- +module example.com/c + +go 1.15 +-- c1/c.go -- +package c +-- c2/go.mod -- +module example.com/c + +go 1.15 +-- c2/c.go -- +package c +This file should not be used, so this syntax error should be ignored. diff --git a/src/cmd/go/testdata/script/mod_lazy_test_horizon.txt b/src/cmd/go/testdata/script/mod_lazy_test_horizon.txt new file mode 100644 index 0000000000..9cdfad79f6 --- /dev/null +++ b/src/cmd/go/testdata/script/mod_lazy_test_horizon.txt @@ -0,0 +1,131 @@ +# This file demonstrates the effect of lazy loading on the selected +# versions of test dependencies. + +# The package import graph used in this test looks like: +# +# m ---- a +# \ | +# \ a_test ---- b +# \ | +# x b_test +# | \ +# x_test -------------- c +# +# And the module dependency graph looks like: +# +# m -- a.1 -- b.1 -- c.2 +# \ +# x.1 ------------ c.1 + +# Control case: in Go 1.15, the version of c imported by 'go test x' is the +# version required by module b, even though b_test is not relevant to the main +# module. (The main module imports a, and a_test imports b, but all of the +# packages and tests in the main module can be built without b.) + +go list -m c +stdout '^c v0.2.0 ' + +[!short] go test -v x +[!short] stdout ' c v0.2.0$' + +# With lazy loading, the go.mod requirements are the same, +# but the irrelevant dependency on c v0.2.0 should be pruned out, +# leaving only the relevant dependency on c v0.1.0. + +go mod edit -go=1.16 +go list -m c +stdout '^c v0.2.0' # TODO(#36460): v0.1.0 + +[!short] go test -v x +[!short] stdout ' c v0.2.0$' # TODO(#36460): v0.1.0 + +-- m.go -- +package m + +import ( + _ "a" + _ "x" +) +-- go.mod -- +module m + +go 1.15 + +require ( + a v0.1.0 + x v0.1.0 +) + +replace ( + a v0.1.0 => ./a1 + b v0.1.0 => ./b1 + c v0.1.0 => ./c1 + c v0.2.0 => ./c2 + x v0.1.0 => ./x1 +) +-- a1/go.mod -- +module a + +go 1.16 + +require b v0.1.0 +-- a1/a.go -- +package a +-- a1/a_test.go -- +package a_test + +import _ "b" +-- b1/go.mod -- +module b + +go 1.16 + +require c v0.2.0 +-- b1/b.go -- +package b +-- b1/b_test.go -- +package b_test + +import ( + "c" + "testing" +) + +func TestCVersion(t *testing.T) { + t.Log(c.Version) +} +-- c1/go.mod -- +module c + +go 1.16 +-- c1/c.go -- +package c + +const Version = "v0.1.0" +-- c2/go.mod -- +module c + +go 1.16 +-- c2/c.go -- +package c + +const Version = "v0.2.0" +-- x1/go.mod -- +module x + +go 1.16 + +require c v0.1.0 +-- x1/x.go -- +package x +-- x1/x_test.go -- +package x_test + +import ( + "c" + "testing" +) + +func TestCVersion(t *testing.T) { + t.Log("c", c.Version) +} diff --git a/src/cmd/go/testdata/script/mod_lazy_test_of_test_dep.txt b/src/cmd/go/testdata/script/mod_lazy_test_of_test_dep.txt new file mode 100644 index 0000000000..ca6c55040e --- /dev/null +++ b/src/cmd/go/testdata/script/mod_lazy_test_of_test_dep.txt @@ -0,0 +1,145 @@ +# This file demonstrates the effect of lazy loading on the reproducibility of +# tests (and tests of test dependencies) outside the main module. +# +# It is similar to the cases in mod_all.txt and mod_lazy_test_horizon.txt, but +# focuses on the effect of "go test" on specific packages instead of the "all" +# pattern. + +# The package import graph used in this test looks like: +# +# lazy ---- a +# | +# a_test ---- b +# | +# b_test ---- c +# +# And the non-lazy module dependency graph looks like: +# +# lazy ---- a.1 ---- b.1 ---- c.1 + +cp go.mod go.mod.old +go mod tidy +cmp go.mod go.mod.old + +# In Go 1.15 mode, 'go list -m all' includes modules needed by the +# transitive closure of tests of dependencies of tests of dependencies of …. + +go list -m all +stdout 'example.com/b v0.1.0' +stdout 'example.com/c v0.1.0' +cmp go.mod go.mod.old + +# 'go test' (or equivalent) of any such dependency, no matter how remote, does +# not update the go.mod file. + +go list -test -deps example.com/a +stdout example.com/b +! stdout example.com/c + +[!short] go test -c example.com/a +[!short] cmp go.mod go.mod.old + +go list -test -deps example.com/b +stdout example.com/c + +[!short] go test -c example.com/b +[!short] cmp go.mod go.mod.old + +# TODO(#36460): + +# After changing to 'go 1.16` uniformly, 'go list -m all' should prune out +# example.com/c, because it is not imported by any package (or test of a package) +# transitively imported by the main module. +# +# example.com/a is imported, +# and example.com/b is needed in order to run 'go test example.com/a', +# but example.com/c is not needed because we don't expect the user to need to run +# 'go test example.com/b'. + +# If we skip directly to adding a new import of c, the dependency is too far +# away for a deepening scan to find, which is fine because the package whose +# test imported it wasn't even it "all". It should resolve from the latest +# version of its module. + +# However, if we reach c by running successive tests starting from the main +# module, we should end up with exactly the version require by c, with an update +# to the go.mod file as soon as we test a test dependency that is not itself in +# "all". + +-- go.mod -- +module example.com/lazy + +go 1.15 + +require example.com/a v0.1.0 + +replace ( + example.com/a v0.1.0 => ./a + example.com/b v0.1.0 => ./b1 + example.com/b v0.2.0 => ./b2 + example.com/c v0.1.0 => ./c1 + example.com/c v0.2.0 => ./c2 +) +-- lazy.go -- +package lazy + +import ( + _ "example.com/a" +) +-- a/go.mod -- +module example.com/a + +go 1.15 + +require example.com/b v0.1.0 +-- a/a.go -- +package a +-- a/a_test.go -- +package a + +import ( + "testing" + + _ "example.com/b" +) + +func TestUsingB(t *testing.T) { + // … +} +-- b1/go.mod -- +module example.com/b + +go 1.15 + +require example.com/c v0.1.0 +-- b1/b.go -- +package b +-- b1/b_test.go -- +package b + +import _ "example.com/c" +-- b2/go.mod -- +module example.com/b + +go 1.15 + +require example.com/c v0.1.0 +-- b2/b.go -- +package b +This file should not be used, so this syntax error should be ignored. +-- b2/b_test.go -- +package b +This file should not be used, so this syntax error should be ignored. +-- c1/go.mod -- +module example.com/c + +go 1.15 +-- c1/c.go -- +package c +-- c2/go.mod -- +module example.com/c + +go 1.15 +-- c2/c.go -- +package c +This file should not be used, so this syntax error should be ignored. diff --git a/src/cmd/go/testdata/script/mod_list.txt b/src/cmd/go/testdata/script/mod_list.txt index 17b33fcc7b..1ba6d7c910 100644 --- a/src/cmd/go/testdata/script/mod_list.txt +++ b/src/cmd/go/testdata/script/mod_list.txt @@ -2,12 +2,12 @@ env GO111MODULE=on [short] skip # list {{.Dir}} shows main module and go.mod but not not-yet-downloaded dependency dir. -go list -m -f '{{.Path}} {{.Main}} {{.GoMod}} {{.Dir}}' all +go list -mod=mod -m -f '{{.Path}} {{.Main}} {{.GoMod}} {{.Dir}}' all stdout '^x true .*[\\/]src[\\/]go.mod .*[\\/]src$' stdout '^rsc.io/quote false .*[\\/]v1.5.2.mod $' # list {{.Dir}} shows dependency after download (and go list without -m downloads it) -go list -f '{{.Dir}}' rsc.io/quote +go list -mod=mod -f '{{.Dir}}' rsc.io/quote stdout '.*mod[\\/]rsc.io[\\/]quote@v1.5.2$' # downloaded dependencies are read-only @@ -20,7 +20,7 @@ go clean -modcache # list {{.Dir}} shows replaced directories cp go.mod2 go.mod -go list -f {{.Dir}} rsc.io/quote +go list -mod=mod -f {{.Dir}} rsc.io/quote go list -m -f '{{.Path}} {{.Version}} {{.Dir}}{{with .Replace}} {{.GoMod}} => {{.Version}} {{.Dir}} {{.GoMod}}{{end}}' all stdout 'mod[\\/]rsc.io[\\/]quote@v1.5.1' stdout 'v1.3.0.*mod[\\/]rsc.io[\\/]sampler@v1.3.1 .*[\\/]v1.3.1.mod => v1.3.1.*sampler@v1.3.1 .*[\\/]v1.3.1.mod' @@ -30,7 +30,7 @@ go list std stdout ^math/big # rsc.io/quote/buggy should be listable as a package -go list rsc.io/quote/buggy +go list -mod=mod rsc.io/quote/buggy # rsc.io/quote/buggy should not be listable as a module go list -m -e -f '{{.Error.Err}}' nonexist rsc.io/quote/buggy diff --git a/src/cmd/go/testdata/script/mod_list_bad_import.txt b/src/cmd/go/testdata/script/mod_list_bad_import.txt index 8a66e0b72a..b3e2fff67d 100644 --- a/src/cmd/go/testdata/script/mod_list_bad_import.txt +++ b/src/cmd/go/testdata/script/mod_list_bad_import.txt @@ -12,10 +12,11 @@ stdout 'incomplete' stdout 'bad dep: .*example.com/notfound' # Listing with -deps should also fail. -# BUG: Today, it does not. -# ! go list -deps example.com/direct -# stderr example.com/notfound -go list -deps example.com/direct +! go list -deps example.com/direct +stderr example.com/notfound + +# But -e -deps should succeed. +go list -e -deps example.com/direct stdout example.com/notfound @@ -28,10 +29,11 @@ stdout incomplete stdout 'bad dep: .*example.com/notfound' # Again, -deps should fail. -# BUG: Again, it does not. -# ! go list -deps example.com/indirect -# stderr example.com/notfound -go list -deps example.com/indirect +! go list -deps example.com/indirect +stderr example.com/notfound + +# But -e -deps should succeed. +go list -e -deps example.com/indirect stdout example.com/notfound diff --git a/src/cmd/go/testdata/script/mod_list_dir.txt b/src/cmd/go/testdata/script/mod_list_dir.txt index 6653435a06..1adab8f027 100644 --- a/src/cmd/go/testdata/script/mod_list_dir.txt +++ b/src/cmd/go/testdata/script/mod_list_dir.txt @@ -2,6 +2,9 @@ # go list with path to directory should work +# populate go.sum +go get -d + env GO111MODULE=off go list -f '{{.ImportPath}}' $GOROOT/src/math stdout ^math$ @@ -29,3 +32,5 @@ require rsc.io/quote v1.5.2 -- x.go -- package x + +import _ "rsc.io/quote" diff --git a/src/cmd/go/testdata/script/mod_list_direct.txt b/src/cmd/go/testdata/script/mod_list_direct.txt index 8f85871189..62a472f475 100644 --- a/src/cmd/go/testdata/script/mod_list_direct.txt +++ b/src/cmd/go/testdata/script/mod_list_direct.txt @@ -10,7 +10,7 @@ env GOSUMDB=off # For a while, (*modfetch.codeRepo).Stat was not checking for a go.mod file, # which would produce a hard error at the subsequent call to GoMod. -go list all +go get -d -- go.mod -- module example.com diff --git a/src/cmd/go/testdata/script/mod_list_pseudo.txt b/src/cmd/go/testdata/script/mod_list_pseudo.txt index 3a10b3a040..056c093128 100644 --- a/src/cmd/go/testdata/script/mod_list_pseudo.txt +++ b/src/cmd/go/testdata/script/mod_list_pseudo.txt @@ -10,30 +10,25 @@ go mod download github.com/dmitshur-test/modtest5@v0.5.0-alpha go mod download github.com/dmitshur-test/modtest5@v0.5.0-alpha.0.20190619023908-3da23a9deb9e cmp $GOPATH/pkg/mod/cache/download/github.com/dmitshur-test/modtest5/@v/list $WORK/modtest5.list +env GOSUMDB=off # don't verify go.mod files when loading retractions env GOPROXY=file:///$GOPATH/pkg/mod/cache/download env GOPATH=$WORK/gopath2 mkdir $GOPATH -go list -m -json github.com/dmitshur-test/modtest5@latest -cmp stdout $WORK/modtest5.json +go list -m -f '{{.Path}} {{.Version}} {{.Time.Format "2006-01-02"}}' github.com/dmitshur-test/modtest5@latest +stdout '^github.com/dmitshur-test/modtest5 v0.5.0-alpha 2019-06-18$' # If the module proxy contains only pseudo-versions, 'latest' should stat # the version with the most recent timestamp — not the highest semantic # version — and return its metadata. env GOPROXY=file:///$WORK/tinyproxy -go list -m -json dmitri.shuralyov.com/test/modtest3@latest -cmp stdout $WORK/modtest3.json +go list -m -f '{{.Path}} {{.Version}} {{.Time.Format "2006-01-02"}}' dmitri.shuralyov.com/test/modtest3@latest +stdout '^dmitri.shuralyov.com/test/modtest3 v0.0.0-20181023043359-a85b471d5412 2018-10-22$' -- $WORK/modtest5.list -- v0.0.0-20190619020302-197a620e0c9a v0.5.0-alpha v0.5.0-alpha.0.20190619023908-3da23a9deb9e --- $WORK/modtest5.json -- -{ - "Path": "github.com/dmitshur-test/modtest5", - "Version": "v0.5.0-alpha", - "Time": "2019-06-18T19:04:46-07:00" -} -- $WORK/tinyproxy/dmitri.shuralyov.com/test/modtest3/@v/list -- v0.1.0-0.20161023043300-000000000000 v0.0.0-20181023043359-a85b471d5412 @@ -42,9 +37,3 @@ v0.0.0-20181023043359-a85b471d5412 "Version": "v0.0.0-20181023043359-a85b471d5412", "Time": "2018-10-22T21:33:59-07:00" } --- $WORK/modtest3.json -- -{ - "Path": "dmitri.shuralyov.com/test/modtest3", - "Version": "v0.0.0-20181023043359-a85b471d5412", - "Time": "2018-10-22T21:33:59-07:00" -} diff --git a/src/cmd/go/testdata/script/mod_list_replace_dir.txt b/src/cmd/go/testdata/script/mod_list_replace_dir.txt index cad7fe2528..f2f2d2b2bb 100644 --- a/src/cmd/go/testdata/script/mod_list_replace_dir.txt +++ b/src/cmd/go/testdata/script/mod_list_replace_dir.txt @@ -2,8 +2,11 @@ # module within the module cache. # Verifies golang.org/issue/29548 -env GO111MODULE=on -go mod download rsc.io/quote@v1.5.1 rsc.io/quote@v1.5.2 +# Populate go.sum and download dependencies. +go get -d + +# Ensure v1.5.2 is also in the cache so we can list it. +go mod download rsc.io/quote@v1.5.2 ! go list $GOPATH/pkg/mod/rsc.io/quote@v1.5.2 stderr '^directory ..[/\\]pkg[/\\]mod[/\\]rsc.io[/\\]quote@v1.5.2 outside available modules$' @@ -17,3 +20,8 @@ module example.com/quoter require rsc.io/quote v1.5.2 replace rsc.io/quote => rsc.io/quote v1.5.1 + +-- use.go -- +package use + +import _ "rsc.io/quote" diff --git a/src/cmd/go/testdata/script/mod_list_retract.txt b/src/cmd/go/testdata/script/mod_list_retract.txt new file mode 100644 index 0000000000..4e177b3f54 --- /dev/null +++ b/src/cmd/go/testdata/script/mod_list_retract.txt @@ -0,0 +1,108 @@ +# 'go list -mod=vendor -retracted' reports an error. +go mod vendor +! go list -m -retracted -mod=vendor +stderr '^go list -retracted cannot be used when vendoring is enabled$' +rm vendor + +# 'go list -retracted' reports an error in GOPATH mode. +env GO111MODULE=off +! go list -retracted +stderr '^go list -retracted can only be used in module-aware mode$' +env GO111MODULE= + +# 'go list pkg' does not show retraction. +go list -f '{{with .Module}}{{with .Retracted}}retracted{{end}}{{end}}' example.com/retract +! stdout . + +# 'go list -retracted pkg' shows retraction. +go list -retracted -f '{{with .Module}}{{with .Retracted}}retracted{{end}}{{end}}' example.com/retract +stdout retracted + +# 'go list -m' does not show retraction. +go list -m -f '{{with .Retracted}}retracted{{end}}' example.com/retract +! stdout . + +# 'go list -m -retracted' shows retraction. +go list -m -retracted -f '{{with .Retracted}}retracted{{end}}' example.com/retract + +# 'go list -m mod@version' does not show retraction. +go list -m -f '{{with .Retracted}}retracted{{end}}' example.com/retract@v1.0.0-unused +! stdout . + +# 'go list -m -retracted mod@version' shows an error if the go.mod that should +# contain the retractions is not available. +! go list -m -retracted example.com/retract/missingmod@v1.0.0 +stderr '^go list -m: loading module retractions: example.com/retract/missingmod@v1.9.0:.*404 Not Found$' +go list -e -m -retracted -f '{{.Error.Err}}' example.com/retract/missingmod@v1.0.0 +stdout '^loading module retractions: example.com/retract/missingmod@v1.9.0:.*404 Not Found$' + +# 'go list -m -retracted mod@version' shows retractions. +go list -m -retracted example.com/retract@v1.0.0-unused +stdout '^example.com/retract v1.0.0-unused \(retracted\)$' +go list -m -retracted -f '{{with .Retracted}}retracted{{end}}' example.com/retract@v1.0.0-unused +stdout retracted + +# 'go list -m mod@latest' selects a previous release version, not self-retracted latest. +go list -m -f '{{.Version}}{{with .Retracted}} retracted{{end}}' example.com/retract/self/prev@latest +stdout '^v1.1.0$' + +# 'go list -m -retracted mod@latest' selects the self-retracted latest version. +go list -m -retracted -f '{{.Version}}{{with .Retracted}} retracted{{end}}' example.com/retract/self/prev@latest +stdout '^v1.9.0 retracted$' + +# 'go list -m mod@latest' selects a pre-release version if all release versions are retracted. +go list -m -f '{{.Version}}{{with .Retracted}} retracted{{end}}' example.com/retract/self/prerelease@latest +stdout '^v1.9.1-pre$' + +# 'go list -m -retracted mod@latest' selects the self-retracted latest version. +go list -m -retracted -f '{{.Version}}{{with .Retracted}} retracted{{end}}' example.com/retract/self/prerelease@latest +stdout '^v1.9.0 retracted$' + +# 'go list -m mod@latest' selects a pseudo-version if all versions are retracted. +# TODO(golang.org/issue/24031): the proxy does not expose the pseudo-version, +# even if all release versions are retracted. +go list -m -e -f '{{.Error.Err}}' example.com/retract/self/pseudo@latest +stdout '^module example.com/retract/self/pseudo: no matching versions for query "latest"$' + +# 'go list -m mod@latest' reports an error if all versions are retracted. +go list -m -e -f '{{.Error.Err}}' example.com/retract/self/all@latest +stdout '^module example.com/retract/self/all: no matching versions for query "latest"$' + +# 'go list -m mod@<v1.10' selects a previous release version, not self-retracted latest. +# The @latest query is not special with respect to retractions. +go list -m -f '{{.Version}}{{with .Retracted}} retracted{{end}}' example.com/retract/self/prev@<v1.10 +stdout '^v1.1.0$' + +# 'go list -m -versions' hides retracted versions. +go list -m -versions example.com/retract +stdout '^example.com/retract v1.0.0-good v1.1.0$' + +# 'go list -m -retracted -versions' shows retracted versions. +go list -m -retracted -versions example.com/retract +stdout '^example.com/retract v1.0.0-bad v1.0.0-good v1.0.0-unused v1.1.0$' + +# 'go list -m -u -versions' loads retractions and does not show retracted versions. +go list -m -u -versions example.com/retract +stdout '^example.com/retract v1.0.0-good v1.1.0$' +go list -m -u -versions -f '{{with .Retracted}}retracted{{end}}' example.com/retract +stdout retracted + +# 'go list -m -u' shows retraction. +go list -m -u -f '{{with .Retracted}}retracted{{end}}' example.com/retract +stdout retracted + +# 'go list -m -u' does not suggest an update to a self-retracted latest version. +go list -m -u -f '{{with .Update}}{{.Version}}{{with .Retracted}} retracted{{end}}{{end}}' example.com/retract/self/prev@v1.0.0-bad +stdout '^v1.1.0$' + +-- go.mod -- +module example.com/use + +go 1.15 + +require example.com/retract v1.0.0-bad + +-- use.go -- +package use + +import _ "example.com/retract" diff --git a/src/cmd/go/testdata/script/mod_list_std.txt b/src/cmd/go/testdata/script/mod_list_std.txt index 76a3b00d1c..baf7908ab9 100644 --- a/src/cmd/go/testdata/script/mod_list_std.txt +++ b/src/cmd/go/testdata/script/mod_list_std.txt @@ -6,8 +6,13 @@ env GOPROXY=off # Outside of GOROOT, our vendored packages should be reported as part of the standard library. go list -f '{{if .Standard}}{{.ImportPath}}{{end}}' std cmd -stdout ^vendor/golang.org/x/net/http2/hpack +stdout ^vendor/golang\.org/x/net/http2/hpack stdout ^cmd/vendor/golang\.org/x/arch/x86/x86asm +! stdout ^golang\.org/x/ + +# The dependencies of those packages should also be vendored. +go list -deps vendor/golang.org/x/crypto/chacha20 +stdout ^vendor/golang\.org/x/crypto/internal/subtle # cmd/... should match the same packages it used to match in GOPATH mode. go list cmd/... @@ -23,40 +28,57 @@ stdout ^bytes$ ! stdout ^builtin$ ! stdout ^cmd/ ! stdout ^vendor/ +! stdout ^golang\.org/x/ + +# Vendored dependencies should appear with their 'vendor/' paths in std (they're +# in GOROOT/src, but not in the 'std' module following the usual module-boundary +# rules). -# Within the std module, listing ./... should omit the 'std' prefix: -# the package paths should be the same via ./... or the 'std' meta-pattern. -# TODO(golang.org/issue/30241): Make that work. -# Today, they are listed in 'std' but not './...'. cd $GOROOT/src -go list ./... -! stdout ^vendor/golang.org/x # TODO: should be included, or should be omitted from 'std'. -cp stdout $WORK/listdot.txt go list std -stdout ^vendor/golang.org/x # TODO: remove vendor/ prefix -# TODO: cmp stdout $WORK/listdot.txt +stdout ^vendor/golang.org/x/net/http2/hpack +! stdout ^golang\.org/x + +# The dependencies of packages with an explicit 'vendor/' prefix should +# still themselves resolve to vendored packages. +go list -deps vendor/golang.org/x/crypto/chacha20 +stdout ^vendor/golang.org/x/crypto/internal/subtle +! stdout ^golang\.org/x + +# Within the std module, the dependencies of the non-vendored packages within +# std should appear to come from modules, but they should be loaded from the +# vendor directory (just like ordinary vendored module dependencies). go list all -stdout ^vendor/golang.org/x # TODO: remove vendor/ prefix. +stdout ^golang.org/x/ ! stdout ^std/ +! stdout ^cmd/ +! stdout ^vendor/ +go list -deps -f '{{if not .Standard}}{{.ImportPath}}{{end}}' std +! stdout ^vendor/golang.org/x/net/http2/hpack +stdout ^golang.org/x/net/http2/hpack -# Within the std module, the vendored dependencies of std should appear -# to come from the actual modules. -# TODO(golang.org/issue/30241): Make that work. -# Today, they still have the vendor/ prefix. -go list std -stdout ^vendor/golang.org/x/net/http2/hpack # TODO -! stdout ^golang.org/x/net/http2/hpack # TODO +go list -f '{{.Dir}}' golang.org/x/net/http2/hpack +stdout $GOROOT[/\\]src[/\\]vendor -go list -deps -f '{{if not .Standard}}{{.ImportPath}}{{end}}' std -# ! stdout ^vendor/golang.org/x/net/http2/hpack # TODO -! stdout ^golang.org/x/net/http2/hpack # TODO +# Within the std module, the packages within the module should omit the 'std/' +# prefix (they retain their own identities), but should respect normal module +# boundaries (vendored packages are not included in the module, even though they +# are included in the 'std' pattern). + +go list ./... +stdout ^bytes$ +! stdout ^builtin$ +! stdout ^cmd/ +! stdout ^vendor/ +! stdout ^golang\.org/x/ # Within std, the vendored dependencies of cmd should still appear to be part of cmd. + go list -f '{{if .Standard}}{{.ImportPath}}{{end}}' cmd stdout ^cmd/vendor/golang\.org/x/arch/x86/x86asm diff --git a/src/cmd/go/testdata/script/mod_list_test.txt b/src/cmd/go/testdata/script/mod_list_test.txt index a99e4f36cd..f697af6c92 100644 --- a/src/cmd/go/testdata/script/mod_list_test.txt +++ b/src/cmd/go/testdata/script/mod_list_test.txt @@ -3,9 +3,19 @@ env GO111MODULE=on # go list -compiled -test must handle test-only packages # golang.org/issue/27097. go list -compiled -test +stdout -count=4 '^.' # 4 lines stdout '^m$' stdout '^m\.test$' stdout '^m \[m\.test\]$' +stdout '^m_test \[m\.test\]$' + +# https://golang.org/issue/39974: test packages should have the Module field populated. +go list -test -f '{{.ImportPath}}{{with .Module}}: {{.Path}}{{end}}' +stdout -count=4 '^.' # 4 lines +stdout '^m: m$' +stdout '^m\.test: m$' +stdout '^m \[m\.test\]: m$' +stdout '^m_test \[m\.test\]: m$' -- go.mod -- module m @@ -14,3 +24,7 @@ module m package x import "testing" func Test(t *testing.T) {} +-- x_x_test.go -- +package x_test +import "testing" +func Test(t *testing.T) {} diff --git a/src/cmd/go/testdata/script/mod_list_upgrade.txt b/src/cmd/go/testdata/script/mod_list_upgrade.txt index 474df0dc26..0cef04b89a 100644 --- a/src/cmd/go/testdata/script/mod_list_upgrade.txt +++ b/src/cmd/go/testdata/script/mod_list_upgrade.txt @@ -1,5 +1,9 @@ env GO111MODULE=on +# Populate go.sum +go list -m -mod=mod all + +# Check for upgrades. go list -m -u all stdout 'rsc.io/quote v1.2.0 \[v1\.5\.2\]' diff --git a/src/cmd/go/testdata/script/mod_load_badchain.txt b/src/cmd/go/testdata/script/mod_load_badchain.txt index 67d9a1584f..e943179c54 100644 --- a/src/cmd/go/testdata/script/mod_load_badchain.txt +++ b/src/cmd/go/testdata/script/mod_load_badchain.txt @@ -28,10 +28,10 @@ cmp stderr list-expected # Try listing a package that imports a package # in a module without a requirement. go mod edit -droprequire example.com/badchain/a -! go list m/use +! go list -mod=mod m/use cmp stderr list-missing-expected -! go list -test m/testuse +! go list -mod=mod -test m/testuse cmp stderr list-missing-test-expected -- go.mod.orig -- diff --git a/src/cmd/go/testdata/script/mod_load_badmod.txt b/src/cmd/go/testdata/script/mod_load_badmod.txt index 68c8b3792b..fa22e1808b 100644 --- a/src/cmd/go/testdata/script/mod_load_badmod.txt +++ b/src/cmd/go/testdata/script/mod_load_badmod.txt @@ -1,14 +1,13 @@ # Unknown lines should be ignored in dependency go.mod files. -env GO111MODULE=on -go list -m all +go list -m -mod=mod all # ... and in replaced dependency go.mod files. cp go.mod go.mod.usesub -go list -m all +go list -m -mod=mod all # ... but not in the main module. cp go.mod.bad go.mod -! go list -m all +! go list -m -mod=mod all stderr 'unknown directive: hello' -- go.mod -- diff --git a/src/cmd/go/testdata/script/mod_load_badzip.txt b/src/cmd/go/testdata/script/mod_load_badzip.txt index c5ba18e9f0..65374d2a6d 100644 --- a/src/cmd/go/testdata/script/mod_load_badzip.txt +++ b/src/cmd/go/testdata/script/mod_load_badzip.txt @@ -5,10 +5,8 @@ env GO111MODULE=on stderr 'zip for rsc.io/badzip@v1.0.0 has unexpected file rsc.io/badzip@v1.0.0.txt' ! grep rsc.io/badzip go.mod -# TODO(golang.org/issue/31730): 'go build' should print the error below if the -# requirement is not present. go mod edit -require rsc.io/badzip@v1.0.0 -! go build rsc.io/badzip +! go build -mod=mod rsc.io/badzip stderr 'zip for rsc.io/badzip@v1.0.0 has unexpected file rsc.io/badzip@v1.0.0.txt' -- go.mod -- diff --git a/src/cmd/go/testdata/script/mod_load_replace_mismatch.txt b/src/cmd/go/testdata/script/mod_load_replace_mismatch.txt index 74dbb34b8a..067e209b01 100644 --- a/src/cmd/go/testdata/script/mod_load_replace_mismatch.txt +++ b/src/cmd/go/testdata/script/mod_load_replace_mismatch.txt @@ -18,6 +18,6 @@ package use import _ "rsc.io/quote" -- want -- -go: example.com/quote@v1.5.2: parsing go.mod: +go: rsc.io/quote@v1.5.2 (replaced by example.com/quote@v1.5.2): parsing go.mod: module declares its path as: rsc.io/Quote but was required as: rsc.io/quote diff --git a/src/cmd/go/testdata/script/mod_missingpkg_prerelease.txt b/src/cmd/go/testdata/script/mod_missingpkg_prerelease.txt index 319ff85587..9c250e7d1c 100644 --- a/src/cmd/go/testdata/script/mod_missingpkg_prerelease.txt +++ b/src/cmd/go/testdata/script/mod_missingpkg_prerelease.txt @@ -1,7 +1,7 @@ env GO111MODULE=on -! go list use.go -stderr 'example.com/missingpkg/deprecated: package provided by example.com/missingpkg at latest version v1.0.0 but not at required version v1.0.1-beta' +! go list -mod=mod -deps use.go +stderr '^use.go:4:2: package example.com/missingpkg/deprecated provided by example.com/missingpkg at latest version v1.0.0 but not at required version v1.0.1-beta$' -- go.mod -- module m diff --git a/src/cmd/go/testdata/script/mod_modinfo.txt b/src/cmd/go/testdata/script/mod_modinfo.txt index fb31f9e43b..d9e9fdec21 100644 --- a/src/cmd/go/testdata/script/mod_modinfo.txt +++ b/src/cmd/go/testdata/script/mod_modinfo.txt @@ -6,6 +6,7 @@ env GO111MODULE=on cd x go mod edit -require=rsc.io/quote@v1.5.2 go mod edit -replace=rsc.io/quote@v1.5.2=rsc.io/quote@v1.0.0 +go mod tidy # populate go.sum # Build a binary and ensure that it can output its own debug info. # The debug info should be accessible before main starts (golang.org/issue/29628). diff --git a/src/cmd/go/testdata/script/mod_multirepo.txt b/src/cmd/go/testdata/script/mod_multirepo.txt index 7f977e80f6..0f335a11f0 100644 --- a/src/cmd/go/testdata/script/mod_multirepo.txt +++ b/src/cmd/go/testdata/script/mod_multirepo.txt @@ -7,6 +7,7 @@ go list -deps -f {{.Dir}} # v2 import should use a downloaded module # both without an explicit go.mod entry ... cp tmp/use_v2.go x.go +go get -d . go list -deps -f {{.Dir}} stdout 'pkg[\\/]mod[\\/]rsc.io[\\/]quote[\\/]v2@v2.0.1$' diff --git a/src/cmd/go/testdata/script/mod_notall.txt b/src/cmd/go/testdata/script/mod_notall.txt new file mode 100644 index 0000000000..1657c8d2d0 --- /dev/null +++ b/src/cmd/go/testdata/script/mod_notall.txt @@ -0,0 +1,99 @@ +# This test demonstrates go commands that combine the 'all' pattern +# with packages outside of 'all'. + +# With -deps, 'all' should include test dependencies of packages in the main +# module, but not should not include test dependencies of packages imported only +# by other root patterns. + +env GOFLAGS=-mod=mod +cp go.mod go.mod.orig + +go list -deps all x/otherroot + +stdout '^x/inall$' +stdout '^x/inall/fromtest$' +stdout '^x/inall/fromtestinall$' +stdout '^x/otherroot$' +stdout '^x/otherdep$' + +! stdout '^x/fromotherroottest$' +! stdout '^y/fromotherdeptest$' + +cmp go.mod go.mod.orig + +# With -deps -test, test dependencies of other roots should be included, +# but test dependencies of non-roots should not. + +go list -deps -test all x/otherroot +stdout '^x/inall$' +stdout '^x/inall/fromtest$' +stdout '^x/inall/fromtestinall$' +stdout '^x/otherroot$' +stdout '^x/otherdep$' + +stdout '^x/fromotherroottest$' +! stdout '^y/fromotherdeptest$' + +cmp go.mod go.mod.orig + +-- m.go -- +package m + +import _ "x/inall" +-- m_test.go -- +package m_test + +import _ "x/inall/fromtest" +-- go.mod -- +module m + +go 1.15 + +require x v0.1.0 + +replace ( + x v0.1.0 => ./x + y v0.1.0 => ./y +) +-- x/go.mod -- +module x + +go 1.15 +-- x/inall/inall.go -- +package inall +-- x/inall/inall_test.go -- +package inall_test + +import _ "x/inall/fromtestinall" +-- x/inall/fromtest/fromtest.go -- +package fromtest +-- x/inall/fromtestinall/fromtestinall.go -- +package fromtestinall +-- x/otherroot/otherroot.go -- +package otherroot + +import _ "x/otherdep" +-- x/otherroot/otherroot_test.go -- +package otherroot_test + +import _ "x/fromotherroottest" +-- x/fromotherroottest/fromotherroottest.go -- +package fromotherroottest +-- x/otherdep/otherdep.go -- +package otherdep +-- x/otherdep/otherdep_test.go -- +package otherdep_test + +import _ "y/fromotherdeptest" +-- x/otherroot/testonly/testonly.go -- +package testonly +-- y/go.mod -- +module y + +go 1.15 +-- y/fromotherdeptest/fromotherdeptest.go -- +// Package fromotherdeptest is a test dependency of x/otherdep that is +// not declared in x/go.mod. If the loader resolves this package, +// it will add this module to the main module's go.mod file, +// and we can detect the mistake. +package fromotherdeptest diff --git a/src/cmd/go/testdata/script/mod_permissions.txt b/src/cmd/go/testdata/script/mod_permissions.txt index 11fb4754f8..2d32dcd10f 100644 --- a/src/cmd/go/testdata/script/mod_permissions.txt +++ b/src/cmd/go/testdata/script/mod_permissions.txt @@ -12,7 +12,7 @@ chmod 0640 go.mod chmod 0604 go.sum go mod edit -module=golang.org/issue/34634 -go build . +go get -d cmp go.mod go.mod.want cmp go.sum go.sum.want diff --git a/src/cmd/go/testdata/script/mod_query.txt b/src/cmd/go/testdata/script/mod_query.txt index e87ca302f0..e10185709d 100644 --- a/src/cmd/go/testdata/script/mod_query.txt +++ b/src/cmd/go/testdata/script/mod_query.txt @@ -1,5 +1,10 @@ env GO111MODULE=on +# Populate go.sum. +# TODO(golang.org/issue/41297): we shouldn't need go.sum. None of the commands +# below depend on the build list. +go mod download + go list -m -versions rsc.io/quote stdout '^rsc.io/quote v1.0.0 v1.1.0 v1.2.0 v1.2.1 v1.3.0 v1.4.0 v1.5.0 v1.5.1 v1.5.2 v1.5.3-pre1$' @@ -30,3 +35,8 @@ stdout 'no matching versions for query ">v1.5.3"' -- go.mod -- module x require rsc.io/quote v1.0.0 + +-- use.go -- +package use + +import _ "rsc.io/quote" diff --git a/src/cmd/go/testdata/script/mod_query_exclude.txt b/src/cmd/go/testdata/script/mod_query_exclude.txt index a64a8e1086..742c6f17e3 100644 --- a/src/cmd/go/testdata/script/mod_query_exclude.txt +++ b/src/cmd/go/testdata/script/mod_query_exclude.txt @@ -1,23 +1,43 @@ env GO111MODULE=on +# list excluded version +go list -modfile=go.exclude.mod -m rsc.io/quote@v1.5.0 +stdout '^rsc.io/quote v1.5.0$' + +# list versions should not print excluded versions +go list -m -versions rsc.io/quote +stdout '\bv1.5.0\b' +go list -modfile=go.exclude.mod -m -versions rsc.io/quote +! stdout '\bv1.5.0\b' + +# list query with excluded version +go list -m rsc.io/quote@>=v1.5 +stdout '^rsc.io/quote v1.5.0$' +go list -modfile=go.exclude.mod -m rsc.io/quote@>=v1.5 +stdout '^rsc.io/quote v1.5.1$' + # get excluded version -cp go.mod1 go.mod -! go get rsc.io/quote@v1.5.0 -stderr 'rsc.io/quote@v1.5.0 excluded' +cp go.exclude.mod go.exclude.mod.orig +! go get -modfile=go.exclude.mod -d rsc.io/quote@v1.5.0 +stderr '^go get rsc.io/quote@v1.5.0: rsc.io/quote@v1.5.0: excluded by go.mod$' # get non-excluded version -cp go.mod1 go.mod -go get rsc.io/quote@v1.5.1 +cp go.exclude.mod.orig go.exclude.mod +go get -modfile=go.exclude.mod -d rsc.io/quote@v1.5.1 stderr 'rsc.io/quote v1.5.1' -# get range with excluded version -cp go.mod1 go.mod -go get rsc.io/quote@>=v1.5 -go list -m ...quote +# get query with excluded version +cp go.exclude.mod.orig go.exclude.mod +go get -modfile=go.exclude.mod -d rsc.io/quote@>=v1.5 +go list -modfile=go.exclude.mod -m ...quote stdout 'rsc.io/quote v1.5.[1-9]' --- go.mod1 -- +-- go.mod -- module x + +-- go.exclude.mod -- +module x + exclude rsc.io/quote v1.5.0 -- x.go -- diff --git a/src/cmd/go/testdata/script/mod_replace.txt b/src/cmd/go/testdata/script/mod_replace.txt index c21f172002..dc9667f1d0 100644 --- a/src/cmd/go/testdata/script/mod_replace.txt +++ b/src/cmd/go/testdata/script/mod_replace.txt @@ -4,7 +4,7 @@ env GO111MODULE=on cp go.mod go.mod.orig # Make sure the test builds without replacement. -go build -o a1.exe . +go build -mod=mod -o a1.exe . exec ./a1.exe stdout 'Don''t communicate by sharing memory' @@ -32,7 +32,7 @@ stderr 'rsc.io/quote/v3@v3.0.0 used for two different module paths \(not-rsc.io/ # Modules that do not (yet) exist upstream can be replaced too. cp go.mod.orig go.mod go mod edit -replace=not-rsc.io/quote/v3@v3.1.0=./local/rsc.io/quote/v3 -go build -o a5.exe ./usenewmodule +go build -mod=mod -o a5.exe ./usenewmodule ! stderr 'finding not-rsc.io/quote/v3' grep 'not-rsc.io/quote/v3 v3.1.0' go.mod exec ./a5.exe diff --git a/src/cmd/go/testdata/script/mod_replace_gopkgin.txt b/src/cmd/go/testdata/script/mod_replace_gopkgin.txt index 28c1196284..df752d9716 100644 --- a/src/cmd/go/testdata/script/mod_replace_gopkgin.txt +++ b/src/cmd/go/testdata/script/mod_replace_gopkgin.txt @@ -11,6 +11,7 @@ env GO111MODULE=on env GOPROXY=direct env GOSUMDB=off +env GOFLAGS=-mod=mod # Replacing gopkg.in/[…].vN with a repository with a root go.mod file # specifying […].vN and a compatible version should succeed, even if @@ -34,7 +35,7 @@ go list -m gopkg.in/src-d/go-git.v4 # A mismatched gopkg.in path should not be able to replace a different major version. cd ../3-to-gomod-4 ! go list -m gopkg.in/src-d/go-git.v3 -stderr '^go: gopkg\.in/src-d/go-git\.v3@v3.0.0-20190801152248-0d1a009cbb60: invalid version: go\.mod has non-\.\.\.\.v3 module path "gopkg\.in/src-d/go-git\.v4" at revision 0d1a009cbb60$' +stderr '^go: gopkg\.in/src-d/go-git\.v3@v3\.2\.0 \(replaced by gopkg\.in/src-d/go-git\.v3@v3\.0\.0-20190801152248-0d1a009cbb60\): version "v3\.0\.0-20190801152248-0d1a009cbb60" invalid: go\.mod has non-\.\.\.\.v3 module path "gopkg\.in/src-d/go-git\.v4" at revision 0d1a009cbb60$' -- 4-to-4/go.mod -- module golang.org/issue/34254 diff --git a/src/cmd/go/testdata/script/mod_replace_import.txt b/src/cmd/go/testdata/script/mod_replace_import.txt index 54b1a12448..b4de5c50f7 100644 --- a/src/cmd/go/testdata/script/mod_replace_import.txt +++ b/src/cmd/go/testdata/script/mod_replace_import.txt @@ -7,6 +7,7 @@ cp go.mod go.mod.orig cmp go.mod go.mod.orig # 'go list' should resolve imports using replacements. +go get -d go list all stdout 'example.com/a/b$' stdout 'example.com/x/v3$' diff --git a/src/cmd/go/testdata/script/mod_require_exclude.txt b/src/cmd/go/testdata/script/mod_require_exclude.txt index 60f7e3fa91..9156d4ce5d 100644 --- a/src/cmd/go/testdata/script/mod_require_exclude.txt +++ b/src/cmd/go/testdata/script/mod_require_exclude.txt @@ -1,16 +1,51 @@ # build with no newer version to satisfy exclude env GO111MODULE=on -! go list -m all -stderr 'no newer version available' +cp go.mod go.mod.orig + +# With the selected version excluded, commands that query that version without +# updating go.mod should fail. + +! go list -mod=readonly -m all +stderr '^go: ignoring requirement on excluded version rsc.io/sampler v1\.99\.99$' +stderr '^go: updates to go.mod needed, disabled by -mod=readonly$' +! stdout '^rsc.io/sampler v1.99.99' +cmp go.mod go.mod.orig + +! go list -mod=vendor -m rsc.io/sampler +stderr '^go: ignoring requirement on excluded version rsc.io/sampler v1\.99\.99$' +stderr '^go list -m: module rsc.io/sampler: can''t resolve module using the vendor directory\n\t\(Use -mod=mod or -mod=readonly to bypass\.\)$' +! stdout '^rsc.io/sampler v1.99.99' +cmp go.mod go.mod.orig + +# With the selected version excluded, commands that load only modules should +# drop the excluded module. + +go list -m -mod=mod all +stderr '^go: dropping requirement on excluded version rsc.io/sampler v1\.99\.99$' +stdout '^x$' +! stdout '^rsc.io/sampler' +cmp go.mod go.moddrop + +# With the latest version excluded, 'go list' should resolve needed packages +# from the next-highest version. + +cp go.mod.orig go.mod +go list -mod=mod -f '{{with .Module}}{{.Path}} {{.Version}}{{end}}' all +stderr '^go: dropping requirement on excluded version rsc.io/sampler v1\.99\.99$' +stdout '^x $' +! stdout '^rsc.io/sampler v1.99.99' +stdout '^rsc.io/sampler v1.3.0' # build with newer version available cp go.mod2 go.mod -go list -m all +go list -mod=mod -f '{{with .Module}}{{.Path}} {{.Version}}{{end}}' all +stderr '^go: dropping requirement on excluded version rsc.io/quote v1\.5\.1$' stdout 'rsc.io/quote v1.5.2' # build with excluded newer version cp go.mod3 go.mod -go list -m all +go list -mod=mod -f '{{with .Module}}{{.Path}} {{.Version}}{{end}}' all +! stderr '^go: dropping requirement' stdout 'rsc.io/quote v1.5.1' -- x.go -- @@ -19,15 +54,28 @@ import _ "rsc.io/quote" -- go.mod -- module x -exclude rsc.io/sampler latest -require rsc.io/sampler latest +go 1.13 + +exclude rsc.io/sampler v1.99.99 +require rsc.io/sampler v1.99.99 +-- go.moddrop -- +module x + +go 1.13 + +exclude rsc.io/sampler v1.99.99 -- go.mod2 -- module x + +go 1.13 + exclude rsc.io/quote v1.5.1 require rsc.io/quote v1.5.1 - -- go.mod3 -- module x + +go 1.13 + exclude rsc.io/quote v1.5.2 require rsc.io/quote v1.5.1 diff --git a/src/cmd/go/testdata/script/mod_retention.txt b/src/cmd/go/testdata/script/mod_retention.txt index 1d83e6c07e..a4441c4b3c 100644 --- a/src/cmd/go/testdata/script/mod_retention.txt +++ b/src/cmd/go/testdata/script/mod_retention.txt @@ -7,7 +7,7 @@ env GO111MODULE=on # Control case: verify that go.mod.tidy is actually tidy. cp go.mod.tidy go.mod -go list all +go list -mod=mod all cmp go.mod go.mod.tidy @@ -35,7 +35,7 @@ cmp go.mod go.mod.tidy # "// indirect" comments should be removed if direct dependencies are seen. # changes. cp go.mod.indirect go.mod -go list all +go list -mod=mod all cmp go.mod go.mod.tidy # "// indirect" comments should be added if appropriate. @@ -63,7 +63,7 @@ cmp go.mod go.mod.tidy # A missing "go" version directive should be added. # However, that should not remove other redundant requirements. cp go.mod.nogo go.mod -go list all +go list -mod=mod all cmpenv go.mod go.mod.currentgo diff --git a/src/cmd/go/testdata/script/mod_retract.txt b/src/cmd/go/testdata/script/mod_retract.txt new file mode 100644 index 0000000000..a52e05bc72 --- /dev/null +++ b/src/cmd/go/testdata/script/mod_retract.txt @@ -0,0 +1,43 @@ +cp go.mod go.mod.orig + +# Populate go.sum. +go mod download + +# 'go list pkg' does not report an error when a retracted version is used. +go list -e -f '{{if .Error}}{{.Error}}{{end}}' ./use +! stdout . +cmp go.mod go.mod.orig + +# Nor does 'go build'. +[!short] go build ./use +[!short] ! stderr . +[!short] cmp go.mod go.mod.orig + +# Neither 'go list' nor 'go build' should download go.mod from the version +# that would list retractions. +exists $GOPATH/pkg/mod/cache/download/example.com/retract/@v/v1.0.0-bad.mod +! exists $GOPATH/pkg/mod/cache/download/example.com/retract/@v/v1.1.0.mod + +# Importing a package from a module with a retracted latest version will +# select the latest non-retracted version. +go get -d ./use_self_prev +go list -m example.com/retract/self/prev +stdout '^example.com/retract/self/prev v1.1.0$' +exists $GOPATH/pkg/mod/cache/download/example.com/retract/self/prev/@v/v1.9.0.mod + +-- go.mod -- +module example.com/use + +go 1.15 + +require example.com/retract v1.0.0-bad + +-- use/use.go -- +package use + +import _ "example.com/retract" + +-- use_self_prev/use.go -- +package use_self_prev + +import _ "example.com/retract/self/prev" diff --git a/src/cmd/go/testdata/script/mod_retract_rationale.txt b/src/cmd/go/testdata/script/mod_retract_rationale.txt new file mode 100644 index 0000000000..584c3a3849 --- /dev/null +++ b/src/cmd/go/testdata/script/mod_retract_rationale.txt @@ -0,0 +1,79 @@ +# When there is no rationale, 'go get' should print a hard-coded message. +go get -d example.com/retract/rationale@v1.0.0-empty +stderr '^go: warning: example.com/retract/rationale@v1.0.0-empty is retracted: retracted by module author$' + +# 'go list' should print the same hard-coded message. +go list -m -retracted -f '{{.Retracted}}' example.com/retract/rationale +stdout '^\[retracted by module author\]$' + + +# When there is a multi-line message, 'go get' should print the first line. +go get -d example.com/retract/rationale@v1.0.0-multiline1 +stderr '^go: warning: example.com/retract/rationale@v1.0.0-multiline1 is retracted: short description$' +! stderr 'detail' + +# 'go list' should show the full message. +go list -m -retracted -f '{{.Retracted}}' example.com/retract/rationale +cmp stdout multiline + +# 'go get' output should be the same whether the retraction appears at top-level +# or in a block. +go get -d example.com/retract/rationale@v1.0.0-multiline2 +stderr '^go: warning: example.com/retract/rationale@v1.0.0-multiline2 is retracted: short description$' +! stderr 'detail' + +# Same for 'go list'. +go list -m -retracted -f '{{.Retracted}}' example.com/retract/rationale +cmp stdout multiline + + +# 'go get' should omit long messages. +go get -d example.com/retract/rationale@v1.0.0-long +stderr '^go: warning: example.com/retract/rationale@v1.0.0-long is retracted: \(rationale omitted: too long\)' + +# 'go list' should show the full message. +go list -m -retracted -f '{{.Retracted}}' example.com/retract/rationale +stdout '^\[lo{500}ng\]$' + + +# 'go get' should omit messages with unprintable characters. +go get -d example.com/retract/rationale@v1.0.0-unprintable +stderr '^go: warning: example.com/retract/rationale@v1.0.0-unprintable is retracted: \(rationale omitted: contains non-printable characters\)' + +# 'go list' should show the full message. +go list -m -retracted -f '{{.Retracted}}' example.com/retract/rationale +stdout '^\[Ends with a BEL character. Beep!\x07\]$' + + +# When there is a comment on a block, but not on individual retractions within +# the block, the rationale should come from the block comment. +go list -m -retracted -f '{{.Retracted}}' example.com/retract/rationale@v1.0.0-block +stdout '^\[block comment\]$' +go list -m -retracted -f '{{.Retracted}}' example.com/retract/rationale@v1.0.0-blockwithcomment +stdout '^\[inner comment\]$' + + +# When a version is covered by multiple retractions, all retractions should +# be reported in the order they appear in the file. +go list -m -retracted -f '{{range .Retracted}}{{.}},{{end}}' example.com/retract/rationale@v1.0.0-order +stdout '^degenerate range,single version,$' +go list -m -retracted -f '{{range .Retracted}}{{.}},{{end}}' example.com/retract/rationale@v1.0.1-order +stdout '^single version,degenerate range,$' + +# 'go get' will only report the first retraction to avoid being too verbose. +go get -d example.com/retract/rationale@v1.0.0-order +stderr '^go: warning: example.com/retract/rationale@v1.0.0-order is retracted: degenerate range$' +go get -d example.com/retract/rationale@v1.0.1-order +stderr '^go: warning: example.com/retract/rationale@v1.0.1-order is retracted: single version$' + +-- go.mod -- +module m + +go 1.14 + +-- multiline -- +[short description +more + +detail +suffix] diff --git a/src/cmd/go/testdata/script/mod_retract_replace.txt b/src/cmd/go/testdata/script/mod_retract_replace.txt new file mode 100644 index 0000000000..7aec438dda --- /dev/null +++ b/src/cmd/go/testdata/script/mod_retract_replace.txt @@ -0,0 +1,61 @@ +# If the latest unretracted version of a module is replaced, 'go list' should +# obtain retractions from the replacement. + +# Populate go.sum. +go get -d + +# The latest version, v1.9.0, is not available on the proxy. +! go list -m -retracted example.com/retract/missingmod +stderr '^go list -m: loading module retractions: example.com/retract/missingmod@v1.9.0:.*404 Not Found$' + +# If we replace that version, we should see retractions. +go mod edit -replace=example.com/retract/missingmod@v1.9.0=./missingmod-v1.9.0 +go list -m -retracted -f '{{range .Retracted}}{{.}}{{end}}' example.com/retract/missingmod +stdout '^bad version$' + +# If we replace the retracted version, we should not see a retraction. +go mod edit -replace=example.com/retract/missingmod=./missingmod-v1.9.0 +go list -m -retracted -f '{{if not .Retracted}}good version{{end}}' example.com/retract/missingmod +stdout '^good version$' + + +# If a replacement version is retracted, we should see a retraction. +# It should appear in both the replaced module and the replacement, as other +# fields like GoMod do. +go list -m -retracted -f '{{range .Retracted}}{{.}}{{end}}' example.com/retract +! stdout . +go list -m -retracted -f '{{if .Replace}}replaced{{end}}' example.com/retract +! stdout . +go mod edit -replace example.com/retract@v1.0.0-good=example.com/retract@v1.0.0-bad +go list -m -mod=mod -retracted -f '{{range .Retracted}}{{.}}{{end}}' example.com/retract +stdout '^bad$' +go list -m -mod=mod -retracted -f '{{with .Replace}}{{range .Retracted}}{{.}}{{end}}{{end}}' example.com/retract +stdout '^bad$' + +-- go.mod -- +module m + +go 1.14 + +require ( + example.com/retract v1.0.0-good + example.com/retract/missingmod v1.0.0 +) +-- use.go -- +package use + +import ( + _ "example.com/retract" + _ "example.com/retract/missingmod" +) +-- missingmod-v1.0.0/go.mod -- +module example.com/retract/missingmod + +go 1.14 +-- missingmod-v1.9.0/go.mod -- +module example.com/retract/missingmod + +go 1.14 + +// bad version +retract v1.0.0 diff --git a/src/cmd/go/testdata/script/mod_std_vendor.txt b/src/cmd/go/testdata/script/mod_std_vendor.txt index 5986cff594..fb954d74ed 100644 --- a/src/cmd/go/testdata/script/mod_std_vendor.txt +++ b/src/cmd/go/testdata/script/mod_std_vendor.txt @@ -37,12 +37,10 @@ stderr 'use of vendored package' # When run within the 'std' module, 'go list -test' should report vendored # transitive dependencies at their original module paths. -# TODO(golang.org/issue/30241): Make that work. -# Today, they're standard packages as long as they exist. cd $GOROOT/src go list -test -f '{{range .Deps}}{{.}}{{"\n"}}{{end}}' net/http -stdout ^vendor/golang.org/x/net/http2/hpack # TODO: remove vendor/ prefix -! stdout ^golang.org/x/net/http2/hpack +stdout ^golang.org/x/net/http2/hpack +! stdout ^vendor/golang.org/x/net/http2/hpack -- go.mod -- module m diff --git a/src/cmd/go/testdata/script/mod_sum_lookup.txt b/src/cmd/go/testdata/script/mod_sum_lookup.txt index ed80a44984..e021921380 100644 --- a/src/cmd/go/testdata/script/mod_sum_lookup.txt +++ b/src/cmd/go/testdata/script/mod_sum_lookup.txt @@ -1,13 +1,14 @@ # When we attempt to resolve an import that doesn't exist, we should not save # hashes for downloaded modules. # Verifies golang.org/issue/36260. -go list -e -tags=ignore ./noexist +# TODO(golang.org/issue/26603): use 'go mod tidy -e' when implemented. +go list -e -mod=mod -tags=ignore ./noexist ! exists go.sum # When an import is resolved successfully, we should only save hashes for # the module that provides the package, not for other modules looked up. # Verifies golang.org/issue/31580. -go list ./exist +go get -d ./exist grep '^example.com/join v1.1.0 h1:' go.sum ! grep '^example.com/join/subpkg' go.sum cp go.sum go.list.sum diff --git a/src/cmd/go/testdata/script/mod_sumdb.txt b/src/cmd/go/testdata/script/mod_sumdb.txt index caf97e9699..68bbd9c274 100644 --- a/src/cmd/go/testdata/script/mod_sumdb.txt +++ b/src/cmd/go/testdata/script/mod_sumdb.txt @@ -15,6 +15,12 @@ stderr 'localhost.localdev/sumdb: h1:wrong' stderr 'SECURITY ERROR\nThis download does NOT match the one reported by the checksum server.' ! go get -d rsc.io/sampler ! go get -d golang.org/x/text + +go mod edit -require rsc.io/quote@v1.5.2 +! go list all +stderr 'go: rsc.io/quote@v1.5.2: verifying go.mod: checksum mismatch' +stderr 'SECURITY ERROR\n' + rm go.sum # switching to truthful sumdb detects timeline inconsistency diff --git a/src/cmd/go/testdata/script/mod_sumdb_golang.txt b/src/cmd/go/testdata/script/mod_sumdb_golang.txt index 40a07fc7e9..cc0b0da474 100644 --- a/src/cmd/go/testdata/script/mod_sumdb_golang.txt +++ b/src/cmd/go/testdata/script/mod_sumdb_golang.txt @@ -9,7 +9,7 @@ env GOPROXY=https://proxy.golang.org go env GOSUMDB stdout '^sum.golang.org$' -# download direct from github +# Download direct from github. [!net] skip [!exec:git] skip env GOSUMDB=sum.golang.org @@ -17,11 +17,13 @@ env GOPROXY=direct go get -d rsc.io/quote@v1.5.2 cp go.sum saved.sum -# download from proxy.golang.org with go.sum entry already +# Download from proxy.golang.org with go.sum entry already. +# Use 'go list' instead of 'go get' since the latter may download extra go.mod +# files not listed in go.sum. go clean -modcache env GOSUMDB= env GOPROXY= -go get -x -d rsc.io/quote@v1.5.2 +go list -x -deps rsc.io/quote ! stderr github stderr proxy.golang.org/rsc.io/quote ! stderr sum.golang.org/tile @@ -32,7 +34,7 @@ cmp go.sum saved.sum # Should use the checksum database to validate new go.sum lines, # but not need to fetch any new data from the proxy. rm go.sum -go get -x -d rsc.io/quote@v1.5.2 +go list -mod=mod -x rsc.io/quote ! stderr github ! stderr proxy.golang.org/rsc.io/quote stderr sum.golang.org/tile @@ -43,7 +45,7 @@ cmp go.sum saved.sum env TESTGOPROXY404=1 go clean -modcache rm go.sum -go get -x -d rsc.io/quote@v1.5.2 +go list -mod=mod -x rsc.io/quote stderr 'proxy.golang.org.*404 testing' stderr github.com/rsc cmp go.sum saved.sum diff --git a/src/cmd/go/testdata/script/mod_symlink.txt b/src/cmd/go/testdata/script/mod_symlink.txt index 49bece2b84..dbc23fb8f0 100644 --- a/src/cmd/go/testdata/script/mod_symlink.txt +++ b/src/cmd/go/testdata/script/mod_symlink.txt @@ -1,16 +1,19 @@ env GO111MODULE=on [!symlink] skip -# 'go list' should resolve modules of imported packages. +# 'go get -d' should resolve modules of imported packages. +go get -d go list -deps -f '{{.Module}}' . stdout golang.org/x/text +go get -d ./subpkg go list -deps -f '{{.Module}}' ./subpkg stdout golang.org/x/text # Create a copy of the module using symlinks in src/links. mkdir links symlink links/go.mod -> $GOPATH/src/go.mod +symlink links/go.sum -> $GOPATH/src/go.sum symlink links/issue.go -> $GOPATH/src/issue.go mkdir links/subpkg symlink links/subpkg/issue.go -> $GOPATH/src/subpkg/issue.go diff --git a/src/cmd/go/testdata/script/mod_symlink_dotgo.txt b/src/cmd/go/testdata/script/mod_symlink_dotgo.txt new file mode 100644 index 0000000000..d4cc143a36 --- /dev/null +++ b/src/cmd/go/testdata/script/mod_symlink_dotgo.txt @@ -0,0 +1,17 @@ +env GO111MODULE=on +[!symlink] skip + +symlink dir.go -> dir + +# Issue #39841: symlinks to directories should be ignored, not treated as source files. +go list -f '{{range .GoFiles}}{{.}}{{"\n"}}{{end}}' . +stdout 'p\.go$' +! stdout 'dir\.go$' + +-- go.mod -- +module example.com +go 1.15 +-- p.go -- +package p +-- dir/README.txt -- +This file exists to ensure that dir is a directory. diff --git a/src/cmd/go/testdata/script/mod_test.txt b/src/cmd/go/testdata/script/mod_test.txt index 8f2da2f2a5..50f00355c1 100644 --- a/src/cmd/go/testdata/script/mod_test.txt +++ b/src/cmd/go/testdata/script/mod_test.txt @@ -1,4 +1,5 @@ env GO111MODULE=on +env GOFLAGS=-mod=mod [short] skip # TODO(bcmills): Convert the 'go test' calls below to 'go list -test' once 'go diff --git a/src/cmd/go/testdata/script/mod_tidy_replace.txt b/src/cmd/go/testdata/script/mod_tidy_replace.txt index c3158f8610..7b00bf1384 100644 --- a/src/cmd/go/testdata/script/mod_tidy_replace.txt +++ b/src/cmd/go/testdata/script/mod_tidy_replace.txt @@ -1,4 +1,5 @@ env GO111MODULE=on +env GOFLAGS=-mod=mod [short] skip # golang.org/issue/30166: 'go mod tidy' should not crash if a replaced module is diff --git a/src/cmd/go/testdata/script/mod_upgrade_patch.txt b/src/cmd/go/testdata/script/mod_upgrade_patch.txt index 3939e54c1b..1ef25b9aef 100644 --- a/src/cmd/go/testdata/script/mod_upgrade_patch.txt +++ b/src/cmd/go/testdata/script/mod_upgrade_patch.txt @@ -2,6 +2,7 @@ env GO111MODULE=on [short] skip # Initially, we are at v1.0.0 for all dependencies. +go get -d cp go.mod go.mod.orig go list -m all stdout '^patch.example.com/direct v1.0.0' diff --git a/src/cmd/go/testdata/script/mod_vcs_missing.txt b/src/cmd/go/testdata/script/mod_vcs_missing.txt index a755935b53..f8be43cf4c 100644 --- a/src/cmd/go/testdata/script/mod_vcs_missing.txt +++ b/src/cmd/go/testdata/script/mod_vcs_missing.txt @@ -5,14 +5,14 @@ env GO111MODULE=on env GOPROXY=direct cd empty -! go list launchpad.net/gocheck +! go get -d launchpad.net/gocheck stderr '"bzr": executable file not found' cd .. # 1.11 used to give the cryptic error "cannot find module for path" here, but # only for a main package. cd main -! go build +! go build -mod=mod stderr '"bzr": executable file not found' cd .. diff --git a/src/cmd/go/testdata/script/mod_vendor_build.txt b/src/cmd/go/testdata/script/mod_vendor_build.txt index 0c359cea6e..4efda55e08 100644 --- a/src/cmd/go/testdata/script/mod_vendor_build.txt +++ b/src/cmd/go/testdata/script/mod_vendor_build.txt @@ -1,6 +1,9 @@ env GO111MODULE=on [short] skip +# Populate go.mod and go.sum. +go mod tidy + # initial conditions: using sampler v1.3.0, not listed in go.mod. go list -deps stdout rsc.io/sampler diff --git a/src/cmd/go/testdata/script/mod_verify.txt b/src/cmd/go/testdata/script/mod_verify.txt index 3918400435..43812d069f 100644 --- a/src/cmd/go/testdata/script/mod_verify.txt +++ b/src/cmd/go/testdata/script/mod_verify.txt @@ -56,7 +56,7 @@ go mod tidy # Packages below module root should not be mentioned in go.sum. rm go.sum go mod edit -droprequire rsc.io/quote -go list rsc.io/quote/buggy # re-resolves import path and updates go.mod +go get -d rsc.io/quote/buggy grep '^rsc.io/quote v1.5.2/go.mod ' go.sum ! grep buggy go.sum diff --git a/src/cmd/go/testdata/script/mod_why.txt b/src/cmd/go/testdata/script/mod_why.txt index 10a4f9fbea..c0ff4647a7 100644 --- a/src/cmd/go/testdata/script/mod_why.txt +++ b/src/cmd/go/testdata/script/mod_why.txt @@ -1,6 +1,9 @@ env GO111MODULE=on [short] skip +# Populate go.sum. +go mod tidy + go list -test all stdout rsc.io/quote stdout golang.org/x/text/language diff --git a/src/cmd/go/testdata/script/modfile_flag.txt b/src/cmd/go/testdata/script/modfile_flag.txt index f05bf03fbf..0ad0880817 100644 --- a/src/cmd/go/testdata/script/modfile_flag.txt +++ b/src/cmd/go/testdata/script/modfile_flag.txt @@ -37,10 +37,10 @@ go mod why rsc.io/quote # 'go list' and other commands with build flags should work. # They should update the alternate go.mod when a dependency is missing. go mod edit -droprequire rsc.io/quote -go list . +go list -mod=mod . grep rsc.io/quote go.alt.mod -go build -n . -go test -n . +go build -n -mod=mod . +go test -n -mod=mod . go get -d rsc.io/quote diff --git a/src/cmd/go/testdata/script/test_example_goexit.txt b/src/cmd/go/testdata/script/test_example_goexit.txt new file mode 100644 index 0000000000..59219e3366 --- /dev/null +++ b/src/cmd/go/testdata/script/test_example_goexit.txt @@ -0,0 +1,25 @@ +# For issue golang.org/issue/41084 +[short] skip + +! go test -v examplegoexit +stdout '(?s)--- PASS.*--- FAIL.*' +stdout 'panic: test executed panic\(nil\) or runtime\.Goexit' + +-- examplegoexit/example_test.go -- +package main + +import ( + "fmt" + "runtime" +) + +func ExamplePass() { + fmt.Println("pass") + // Output: + // pass +} + +func ExampleGoexit() { + runtime.Goexit() + // Output: +} diff --git a/src/cmd/go/testdata/script/test_exit.txt b/src/cmd/go/testdata/script/test_exit.txt new file mode 100644 index 0000000000..23a2429d1e --- /dev/null +++ b/src/cmd/go/testdata/script/test_exit.txt @@ -0,0 +1,114 @@ +# Builds and runs test binaries, so skip in short mode. +[short] skip + +env GO111MODULE=on + +# If a test invoked by 'go test' exits with a zero status code, +# it will panic. +! go test ./zero +! stdout ^ok +! stdout 'exit status' +stdout 'panic' +stdout ^FAIL + +# If a test exits with a non-zero status code, 'go test' fails normally. +! go test ./one +! stdout ^ok +stdout 'exit status' +! stdout 'panic' +stdout ^FAIL + +# Ensure that other flags still do the right thing. +go test -list=. ./zero +stdout ExitZero + +! go test -bench=. ./zero +stdout 'panic' + +# 'go test' with no args streams output without buffering. Ensure that it still +# catches a zero exit with missing output. +cd zero +! go test +stdout 'panic' +cd ../normal +go test +stdout ^ok +cd .. + +# If a TestMain exits with a zero status code, 'go test' shouldn't +# complain about that. It's a common way to skip testing a package +# entirely. +go test ./main_zero +! stdout 'skipping all tests' +stdout ^ok + +# With -v, we'll see the warning from TestMain. +go test -v ./main_zero +stdout 'skipping all tests' +stdout ^ok + +# Listing all tests won't actually give a result if TestMain exits. That's okay, +# because this is how TestMain works. If we decide to support -list even when +# TestMain is used to skip entire packages, we can change this test case. +go test -list=. ./main_zero +stdout 'skipping all tests' +! stdout TestNotListed + +-- go.mod -- +module m + +-- ./normal/normal.go -- +package normal +-- ./normal/normal_test.go -- +package normal + +import "testing" + +func TestExitZero(t *testing.T) { +} + +-- ./zero/zero.go -- +package zero +-- ./zero/zero_test.go -- +package zero + +import ( + "os" + "testing" +) + +func TestExitZero(t *testing.T) { + os.Exit(0) +} + +-- ./one/one.go -- +package one +-- ./one/one_test.go -- +package one + +import ( + "os" + "testing" +) + +func TestExitOne(t *testing.T) { + os.Exit(1) +} + +-- ./main_zero/zero.go -- +package zero +-- ./main_zero/zero_test.go -- +package zero + +import ( + "fmt" + "os" + "testing" +) + +func TestMain(m *testing.M) { + fmt.Println("skipping all tests") + os.Exit(0) +} + +func TestNotListed(t *testing.T) {} diff --git a/src/cmd/go/testdata/script/testing_issue40908.txt b/src/cmd/go/testdata/script/testing_issue40908.txt new file mode 100644 index 0000000000..4939de080c --- /dev/null +++ b/src/cmd/go/testdata/script/testing_issue40908.txt @@ -0,0 +1,21 @@ +[short] skip +[!race] skip + +go test -race testrace + +-- testrace/race_test.go -- +package testrace + +import "testing" + +func TestRace(t *testing.T) { + helperDone := make(chan struct{}) + go func() { + t.Logf("Something happened before cleanup.") + close(helperDone) + }() + + t.Cleanup(func() { + <-helperDone + }) +} diff --git a/src/cmd/go/testdata/script/version.txt b/src/cmd/go/testdata/script/version.txt index 0123ac6d53..81ca698620 100644 --- a/src/cmd/go/testdata/script/version.txt +++ b/src/cmd/go/testdata/script/version.txt @@ -14,6 +14,7 @@ env GO111MODULE=on [short] skip # Check that 'go version' and 'go version -m' work on a binary built in module mode. +go get -d rsc.io/fortune go build -o fortune.exe rsc.io/fortune go version fortune.exe stdout '^fortune.exe: .+' diff --git a/src/cmd/go/testdata/script/version_replace.txt b/src/cmd/go/testdata/script/version_replace.txt index b657086f09..ec98f4e3f3 100644 --- a/src/cmd/go/testdata/script/version_replace.txt +++ b/src/cmd/go/testdata/script/version_replace.txt @@ -1,7 +1,7 @@ [short] skip go mod download example.com/printversion@v0.1.0 example.com/printversion@v1.0.0 - +go get -d example.com/printversion@v0.1.0 go install example.com/printversion go run example.com/printversion diff --git a/src/cmd/internal/goobj/objfile.go b/src/cmd/internal/goobj/objfile.go index 5d4a253024..8ec7c481d6 100644 --- a/src/cmd/internal/goobj/objfile.go +++ b/src/cmd/internal/goobj/objfile.go @@ -2,7 +2,19 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -// Go new object file format, reading and writing. +// This package defines the Go object file format, and provide "low-level" functions +// for reading and writing object files. + +// The object file is understood by the compiler, assembler, linker, and tools. They +// have "high level" code that operates on object files, handling application-specific +// logics, and use this package for the actual reading and writing. Specifically, the +// code below: +// +// - cmd/internal/obj/objfile.go (used by cmd/asm and cmd/compile) +// - cmd/internal/objfile/goobj.go (used cmd/nm, cmd/objdump) +// - cmd/link/internal/loader package (used by cmd/link) +// +// If the object file format changes, they may (or may not) need to change. package goobj diff --git a/src/cmd/internal/obj/arm/asm5.go b/src/cmd/internal/obj/arm/asm5.go index 7b7e42ee2e..269a4223d5 100644 --- a/src/cmd/internal/obj/arm/asm5.go +++ b/src/cmd/internal/obj/arm/asm5.go @@ -644,7 +644,7 @@ func (c *ctxt5) flushpool(p *obj.Prog, skip int, force int) bool { q := c.newprog() q.As = AB q.To.Type = obj.TYPE_BRANCH - q.Pcond = p.Link + q.To.SetTarget(p.Link) q.Link = c.blitrl q.Pos = p.Pos c.blitrl = q @@ -705,7 +705,7 @@ func (c *ctxt5) addpool(p *obj.Prog, a *obj.Addr) { if t.Rel == nil { for q := c.blitrl; q != nil; q = q.Link { /* could hash on t.t0.offset */ if q.Rel == nil && q.To == t.To { - p.Pcond = q + p.Pool = q return } } @@ -724,8 +724,8 @@ func (c *ctxt5) addpool(p *obj.Prog, a *obj.Addr) { c.elitrl = q c.pool.size += 4 - // Store the link to the pool entry in Pcond. - p.Pcond = q + // Store the link to the pool entry in Pool. + p.Pool = q } func (c *ctxt5) regoff(a *obj.Addr) int32 { @@ -1584,8 +1584,8 @@ func (c *ctxt5) asmout(p *obj.Prog, o *Optab, out []uint32) { break } - if p.Pcond != nil { - v = int32((p.Pcond.Pc - c.pc) - 8) + if p.To.Target() != nil { + v = int32((p.To.Target().Pc - c.pc) - 8) } o1 |= (uint32(v) >> 2) & 0xffffff @@ -3023,7 +3023,7 @@ func (c *ctxt5) omvr(p *obj.Prog, a *obj.Addr, dr int) uint32 { func (c *ctxt5) omvl(p *obj.Prog, a *obj.Addr, dr int) uint32 { var o1 uint32 - if p.Pcond == nil { + if p.Pool == nil { c.aclass(a) v := immrot(^uint32(c.instoffset)) if v == 0 { @@ -3035,7 +3035,7 @@ func (c *ctxt5) omvl(p *obj.Prog, a *obj.Addr, dr int) uint32 { o1 |= uint32(v) o1 |= (uint32(dr) & 15) << 12 } else { - v := int32(p.Pcond.Pc - p.Pc - 8) + v := int32(p.Pool.Pc - p.Pc - 8) o1 = c.olr(v, REGPC, dr, int(p.Scond)&C_SCOND) } diff --git a/src/cmd/internal/obj/arm/obj5.go b/src/cmd/internal/obj/arm/obj5.go index 86831f2b44..4d9187b530 100644 --- a/src/cmd/internal/obj/arm/obj5.go +++ b/src/cmd/internal/obj/arm/obj5.go @@ -406,7 +406,7 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { mov.To.Reg = REG_R2 // B.NE branch target is MOVW above - bne.Pcond = mov + bne.To.SetTarget(mov) // ADD $(autosize+4), R13, R3 p = obj.Appendp(mov, newprog) @@ -428,7 +428,7 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { p = obj.Appendp(p, newprog) p.As = ABNE p.To.Type = obj.TYPE_BRANCH - p.Pcond = end + p.To.SetTarget(end) // ADD $4, R13, R4 p = obj.Appendp(p, newprog) @@ -452,7 +452,7 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { p = obj.Appendp(p, newprog) p.As = AB p.To.Type = obj.TYPE_BRANCH - p.Pcond = end + p.To.SetTarget(end) // reset for subsequent passes p = end @@ -741,7 +741,7 @@ func (c *ctxt5) stacksplit(p *obj.Prog, framesize int32) *obj.Prog { movw.To.Type = obj.TYPE_REG movw.To.Reg = REG_R3 - bls.Pcond = movw + bls.To.SetTarget(movw) // BL runtime.morestack call := obj.Appendp(movw, c.newprog) @@ -762,7 +762,7 @@ func (c *ctxt5) stacksplit(p *obj.Prog, framesize int32) *obj.Prog { b := obj.Appendp(pcdata, c.newprog) b.As = obj.AJMP b.To.Type = obj.TYPE_BRANCH - b.Pcond = c.cursym.Func.Text.Link + b.To.SetTarget(c.cursym.Func.Text.Link) b.Spadj = +framesize return end diff --git a/src/cmd/internal/obj/arm64/a.out.go b/src/cmd/internal/obj/arm64/a.out.go index 03e0278a33..2839da1437 100644 --- a/src/cmd/internal/obj/arm64/a.out.go +++ b/src/cmd/internal/obj/arm64/a.out.go @@ -874,6 +874,7 @@ const ( AFLDPS AFMOVD AFMOVS + AFMOVQ AFMULD AFMULS AFNEGD @@ -953,6 +954,7 @@ const ( AVADD AVADDP AVAND + AVBIF AVCMEQ AVCNT AVEOR @@ -985,11 +987,20 @@ const ( AVEXT AVRBIT AVUSHR + AVUSHLL + AVUSHLL2 + AVUXTL + AVUXTL2 + AVUZP1 + AVUZP2 AVSHL AVSRI + AVBSL + AVBIT AVTBL AVZIP1 AVZIP2 + AVCMTST ALAST AB = obj.AJMP ABL = obj.ACALL diff --git a/src/cmd/internal/obj/arm64/anames.go b/src/cmd/internal/obj/arm64/anames.go index 65ecd007ea..48c066abfd 100644 --- a/src/cmd/internal/obj/arm64/anames.go +++ b/src/cmd/internal/obj/arm64/anames.go @@ -381,6 +381,7 @@ var Anames = []string{ "FLDPS", "FMOVD", "FMOVS", + "FMOVQ", "FMULD", "FMULS", "FNEGD", @@ -460,6 +461,7 @@ var Anames = []string{ "VADD", "VADDP", "VAND", + "VBIF", "VCMEQ", "VCNT", "VEOR", @@ -492,10 +494,19 @@ var Anames = []string{ "VEXT", "VRBIT", "VUSHR", + "VUSHLL", + "VUSHLL2", + "VUXTL", + "VUXTL2", + "VUZP1", + "VUZP2", "VSHL", "VSRI", + "VBSL", + "VBIT", "VTBL", "VZIP1", "VZIP2", + "VCMTST", "LAST", } diff --git a/src/cmd/internal/obj/arm64/asm7.go b/src/cmd/internal/obj/arm64/asm7.go index 7a5a8ff38c..df4bbbbd35 100644 --- a/src/cmd/internal/obj/arm64/asm7.go +++ b/src/cmd/internal/obj/arm64/asm7.go @@ -393,6 +393,11 @@ var optab = []Optab{ {AMOVK, C_VCON, C_NONE, C_NONE, C_REG, 33, 4, 0, 0, 0}, {AMOVD, C_AACON, C_NONE, C_NONE, C_REG, 4, 4, REGFROM, 0, 0}, + // Move a large constant to a Vn. + {AFMOVQ, C_VCON, C_NONE, C_NONE, C_VREG, 101, 4, 0, LFROM, 0}, + {AFMOVD, C_VCON, C_NONE, C_NONE, C_VREG, 101, 4, 0, LFROM, 0}, + {AFMOVS, C_LCON, C_NONE, C_NONE, C_VREG, 101, 4, 0, LFROM, 0}, + /* jump operations */ {AB, C_NONE, C_NONE, C_NONE, C_SBRA, 5, 4, 0, 0, 0}, {ABL, C_NONE, C_NONE, C_NONE, C_SBRA, 5, 4, 0, 0, 0}, @@ -403,12 +408,14 @@ var optab = []Optab{ {obj.ARET, C_NONE, C_NONE, C_NONE, C_REG, 6, 4, 0, 0, 0}, {obj.ARET, C_NONE, C_NONE, C_NONE, C_ZOREG, 6, 4, 0, 0, 0}, {ABEQ, C_NONE, C_NONE, C_NONE, C_SBRA, 7, 4, 0, 0, 0}, - {AADRP, C_SBRA, C_NONE, C_NONE, C_REG, 60, 4, 0, 0, 0}, - {AADR, C_SBRA, C_NONE, C_NONE, C_REG, 61, 4, 0, 0, 0}, {ACBZ, C_REG, C_NONE, C_NONE, C_SBRA, 39, 4, 0, 0, 0}, {ATBZ, C_VCON, C_REG, C_NONE, C_SBRA, 40, 4, 0, 0, 0}, {AERET, C_NONE, C_NONE, C_NONE, C_NONE, 41, 4, 0, 0, 0}, + // get a PC-relative address + {AADRP, C_SBRA, C_NONE, C_NONE, C_REG, 60, 4, 0, 0, 0}, + {AADR, C_SBRA, C_NONE, C_NONE, C_REG, 61, 4, 0, 0, 0}, + {ACLREX, C_NONE, C_NONE, C_NONE, C_VCON, 38, 4, 0, 0, 0}, {ACLREX, C_NONE, C_NONE, C_NONE, C_NONE, 38, 4, 0, 0, 0}, {ABFM, C_VCON, C_REG, C_VCON, C_REG, 42, 4, 0, 0, 0}, @@ -473,6 +480,8 @@ var optab = []Optab{ {AVTBL, C_ARNG, C_NONE, C_LIST, C_ARNG, 100, 4, 0, 0, 0}, {AVUSHR, C_VCON, C_ARNG, C_NONE, C_ARNG, 95, 4, 0, 0, 0}, {AVZIP1, C_ARNG, C_ARNG, C_NONE, C_ARNG, 72, 4, 0, 0, 0}, + {AVUSHLL, C_VCON, C_ARNG, C_NONE, C_ARNG, 102, 4, 0, 0, 0}, + {AVUXTL, C_ARNG, C_NONE, C_NONE, C_ARNG, 102, 4, 0, 0, 0}, /* conditional operations */ {ACSEL, C_COND, C_REG, C_REG, C_REG, 18, 4, 0, 0, 0}, @@ -977,8 +986,8 @@ func span7(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { o = c.oplook(p) /* very large branches */ - if (o.type_ == 7 || o.type_ == 39 || o.type_ == 40) && p.Pcond != nil { // 7: BEQ and like, 39: CBZ and like, 40: TBZ and like - otxt := p.Pcond.Pc - pc + if (o.type_ == 7 || o.type_ == 39 || o.type_ == 40) && p.To.Target() != nil { // 7: BEQ and like, 39: CBZ and like, 40: TBZ and like + otxt := p.To.Target().Pc - pc var toofar bool switch o.type_ { case 7, 39: // branch instruction encodes 19 bits @@ -992,14 +1001,14 @@ func span7(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { p.Link = q q.As = AB q.To.Type = obj.TYPE_BRANCH - q.Pcond = p.Pcond - p.Pcond = q + q.To.SetTarget(p.To.Target()) + p.To.SetTarget(q) q = c.newprog() q.Link = p.Link p.Link = q q.As = AB q.To.Type = obj.TYPE_BRANCH - q.Pcond = q.Link.Link + q.To.SetTarget(q.Link.Link) bflag = 1 } } @@ -1123,7 +1132,7 @@ func (c *ctxt7) flushpool(p *obj.Prog, skip int) { q := c.newprog() q.As = AB q.To.Type = obj.TYPE_BRANCH - q.Pcond = p.Link + q.To.SetTarget(p.Link) q.Link = c.blitrl q.Pos = p.Pos c.blitrl = q @@ -1249,7 +1258,7 @@ func (c *ctxt7) addpool(p *obj.Prog, a *obj.Addr) { for q := c.blitrl; q != nil; q = q.Link { /* could hash on t.t0.offset */ if q.To == t.To { - p.Pcond = q + p.Pool = q return } } @@ -1266,7 +1275,7 @@ func (c *ctxt7) addpool(p *obj.Prog, a *obj.Addr) { c.elitrl = q c.pool.size = -c.pool.size & (funcAlign - 1) c.pool.size += uint32(sz) - p.Pcond = q + p.Pool = q } func (c *ctxt7) regoff(a *obj.Addr) uint32 { @@ -2657,7 +2666,7 @@ func buildop(ctxt *obj.Link) { case AFCSELD: oprangeset(AFCSELS, t) - case AFMOVS, AFMOVD: + case AFMOVS, AFMOVD, AFMOVQ: break case AFCVTZSD: @@ -2740,6 +2749,12 @@ func buildop(ctxt *obj.Link) { oprangeset(AVCMEQ, t) oprangeset(AVORR, t) oprangeset(AVEOR, t) + oprangeset(AVBSL, t) + oprangeset(AVBIT, t) + oprangeset(AVCMTST, t) + oprangeset(AVUZP1, t) + oprangeset(AVUZP2, t) + oprangeset(AVBIF, t) case AVADD: oprangeset(AVSUB, t) @@ -2787,6 +2802,12 @@ func buildop(ctxt *obj.Link) { case AVZIP1: oprangeset(AVZIP2, t) + case AVUXTL: + oprangeset(AVUXTL2, t) + + case AVUSHLL: + oprangeset(AVUSHLL2, t) + case AVLD1R: oprangeset(AVLD2, t) oprangeset(AVLD2R, t) @@ -2898,6 +2919,7 @@ func (c *ctxt7) checkoffset(p *obj.Prog, as obj.As) { } opcode := (list >> 12) & 15 q := (list >> 30) & 1 + size := (list >> 10) & 3 if offset == 0 { return } @@ -2913,8 +2935,16 @@ func (c *ctxt7) checkoffset(p *obj.Prog, as obj.As) { default: c.ctxt.Diag("invalid register numbers in ARM64 register list: %v", p) } - if !(q == 0 && offset == n*8) && !(q == 1 && offset == n*16) { - c.ctxt.Diag("invalid post-increment offset: %v", p) + + switch as { + case AVLD1R, AVLD2R, AVLD3R, AVLD4R: + if offset != n*(1<<uint(size)) { + c.ctxt.Diag("invalid post-increment offset: %v", p) + } + default: + if !(q == 0 && offset == n*8) && !(q == 1 && offset == n*16) { + c.ctxt.Diag("invalid post-increment offset: %v", p) + } } switch as { @@ -4154,7 +4184,7 @@ func (c *ctxt7) asmout(p *obj.Prog, o *Optab, out []uint32) { rel.Add = 0 rel.Type = objabi.R_ARM64_GOTPCREL - case 72: /* vaddp/vand/vcmeq/vorr/vadd/veor/vfmla/vfmls Vm.<T>, Vn.<T>, Vd.<T> */ + case 72: /* vaddp/vand/vcmeq/vorr/vadd/veor/vfmla/vfmls/vbit/vbsl/vcmtst/vsub/vbif/vuzip1/vuzip2 Vm.<T>, Vn.<T>, Vd.<T> */ af := int((p.From.Reg >> 5) & 15) af3 := int((p.Reg >> 5) & 15) at := int((p.To.Reg >> 5) & 15) @@ -4195,17 +4225,24 @@ func (c *ctxt7) asmout(p *obj.Prog, o *Optab, out []uint32) { c.ctxt.Diag("invalid arrangement: %v", p) } - if (p.As == AVORR || p.As == AVAND || p.As == AVEOR) && - (af != ARNG_16B && af != ARNG_8B) { - c.ctxt.Diag("invalid arrangement: %v", p) - } else if (p.As == AVFMLA || p.As == AVFMLS) && - (af != ARNG_2D && af != ARNG_2S && af != ARNG_4S) { - c.ctxt.Diag("invalid arrangement: %v", p) - } else if p.As == AVORR { - size = 2 - } else if p.As == AVAND || p.As == AVEOR { + switch p.As { + case AVORR, AVAND, AVEOR, AVBIT, AVBSL, AVBIF: + if af != ARNG_16B && af != ARNG_8B { + c.ctxt.Diag("invalid arrangement: %v", p) + } + case AVFMLA, AVFMLS: + if af != ARNG_2D && af != ARNG_2S && af != ARNG_4S { + c.ctxt.Diag("invalid arrangement: %v", p) + } + } + switch p.As { + case AVAND, AVEOR: size = 0 - } else if p.As == AVFMLA || p.As == AVFMLS { + case AVBSL: + size = 1 + case AVORR, AVBIT, AVBIF: + size = 2 + case AVFMLA, AVFMLS: if af == ARNG_2D { size = 1 } else { @@ -4801,7 +4838,7 @@ func (c *ctxt7) asmout(p *obj.Prog, o *Optab, out []uint32) { Q = 1 b = 15 } else { - c.ctxt.Diag("invalid arrangement, should be 8B or 16B: %v", p) + c.ctxt.Diag("invalid arrangement, should be B8 or B16: %v", p) break } @@ -5087,6 +5124,47 @@ func (c *ctxt7) asmout(p *obj.Prog, o *Optab, out []uint32) { o1 = q<<30 | 0xe<<24 | len<<13 o1 |= (uint32(rf&31) << 16) | uint32(offset&31)<<5 | uint32(rt&31) + case 101: // FOMVQ/FMOVD $vcon, Vd -> load from constant pool. + o1 = c.omovlit(p.As, p, &p.From, int(p.To.Reg)) + + case 102: /* vushll, vushll2, vuxtl, vuxtl2 */ + o1 = c.opirr(p, p.As) + rf := p.Reg + af := uint8((p.Reg >> 5) & 15) + at := uint8((p.To.Reg >> 5) & 15) + shift := int(p.From.Offset) + if p.As == AVUXTL || p.As == AVUXTL2 { + rf = p.From.Reg + af = uint8((p.From.Reg >> 5) & 15) + shift = 0 + } + + pack := func(q, x, y uint8) uint32 { + return uint32(q)<<16 | uint32(x)<<8 | uint32(y) + } + + var Q uint8 = uint8(o1>>30) & 1 + var immh, width uint8 + switch pack(Q, af, at) { + case pack(0, ARNG_8B, ARNG_8H): + immh, width = 1, 8 + case pack(1, ARNG_16B, ARNG_8H): + immh, width = 1, 8 + case pack(0, ARNG_4H, ARNG_4S): + immh, width = 2, 16 + case pack(1, ARNG_8H, ARNG_4S): + immh, width = 2, 16 + case pack(0, ARNG_2S, ARNG_2D): + immh, width = 4, 32 + case pack(1, ARNG_4S, ARNG_2D): + immh, width = 4, 32 + default: + c.ctxt.Diag("operand mismatch: %v\n", p) + } + if !(0 <= shift && shift <= int(width-1)) { + c.ctxt.Diag("shift amount out of range: %v\n", p) + } + o1 |= uint32(immh)<<19 | uint32(shift)<<16 | uint32(rf&31)<<5 | uint32(p.To.Reg&31) } out[0] = o1 out[1] = o2 @@ -5653,6 +5731,9 @@ func (c *ctxt7) oprrr(p *obj.Prog, a obj.As) uint32 { case AVADD: return 7<<25 | 1<<21 | 1<<15 | 1<<10 + case AVSUB: + return 0x17<<25 | 1<<21 | 1<<15 | 1<<10 + case AVADDP: return 7<<25 | 1<<21 | 1<<15 | 15<<10 @@ -5715,6 +5796,24 @@ func (c *ctxt7) oprrr(p *obj.Prog, a obj.As) uint32 { case AVLD2R, AVLD4R: return 0xD<<24 | 3<<21 + + case AVBIF: + return 1<<29 | 7<<25 | 7<<21 | 7<<10 + + case AVBIT: + return 1<<29 | 0x75<<21 | 7<<10 + + case AVBSL: + return 1<<29 | 0x73<<21 | 7<<10 + + case AVCMTST: + return 0xE<<24 | 1<<21 | 0x23<<10 + + case AVUZP1: + return 7<<25 | 3<<11 + + case AVUZP2: + return 7<<25 | 1<<14 | 3<<11 } c.ctxt.Diag("%v: bad rrr %d %v", p, a, a) @@ -5913,6 +6012,12 @@ func (c *ctxt7) opirr(p *obj.Prog, a obj.As) uint32 { case AVSRI: return 0x5E<<23 | 17<<10 + + case AVUSHLL, AVUXTL: + return 1<<29 | 15<<24 | 0x29<<10 + + case AVUSHLL2, AVUXTL2: + return 3<<29 | 15<<24 | 0x29<<10 } c.ctxt.Diag("%v: bad irr %v", p, a) @@ -6042,15 +6147,21 @@ func (c *ctxt7) opimm(p *obj.Prog, a obj.As) uint32 { func (c *ctxt7) brdist(p *obj.Prog, preshift int, flen int, shift int) int64 { v := int64(0) t := int64(0) - if p.Pcond != nil { - v = (p.Pcond.Pc >> uint(preshift)) - (c.pc >> uint(preshift)) + q := p.To.Target() + if q == nil { + // TODO: don't use brdist for this case, as it isn't a branch. + // (Calls from omovlit, and maybe adr/adrp opcodes as well.) + q = p.Pool + } + if q != nil { + v = (q.Pc >> uint(preshift)) - (c.pc >> uint(preshift)) if (v & ((1 << uint(shift)) - 1)) != 0 { c.ctxt.Diag("misaligned label\n%v", p) } v >>= uint(shift) t = int64(1) << uint(flen-1) if v < -t || v >= t { - c.ctxt.Diag("branch too far %#x vs %#x [%p]\n%v\n%v", v, t, c.blitrl, p, p.Pcond) + c.ctxt.Diag("branch too far %#x vs %#x [%p]\n%v\n%v", v, t, c.blitrl, p, q) panic("branch too far") } } @@ -6526,7 +6637,7 @@ func (c *ctxt7) oaddi(p *obj.Prog, o1 int32, v int32, r int, rt int) uint32 { */ func (c *ctxt7) omovlit(as obj.As, p *obj.Prog, a *obj.Addr, dr int) uint32 { var o1 int32 - if p.Pcond == nil { /* not in literal pool */ + if p.Pool == nil { /* not in literal pool */ c.aclass(a) c.ctxt.Logf("omovlit add %d (%#x)\n", c.instoffset, uint64(c.instoffset)) @@ -6551,12 +6662,16 @@ func (c *ctxt7) omovlit(as obj.As, p *obj.Prog, a *obj.Addr, dr int) uint32 { fp = 1 w = 1 /* 64-bit SIMD/FP */ + case AFMOVQ: + fp = 1 + w = 2 /* 128-bit SIMD/FP */ + case AMOVD: - if p.Pcond.As == ADWORD { + if p.Pool.As == ADWORD { w = 1 /* 64-bit */ - } else if p.Pcond.To.Offset < 0 { + } else if p.Pool.To.Offset < 0 { w = 2 /* 32-bit, sign-extended to 64-bit */ - } else if p.Pcond.To.Offset >= 0 { + } else if p.Pool.To.Offset >= 0 { w = 0 /* 32-bit, zero-extended to 64-bit */ } else { c.ctxt.Diag("invalid operand %v in %v", a, p) diff --git a/src/cmd/internal/obj/arm64/obj7.go b/src/cmd/internal/obj/arm64/obj7.go index 0d74430053..56da854f16 100644 --- a/src/cmd/internal/obj/arm64/obj7.go +++ b/src/cmd/internal/obj/arm64/obj7.go @@ -187,9 +187,9 @@ func (c *ctxt7) stacksplit(p *obj.Prog, framesize int32) *obj.Prog { movlr.To.Type = obj.TYPE_REG movlr.To.Reg = REG_R3 if q != nil { - q.Pcond = movlr + q.To.SetTarget(movlr) } - bls.Pcond = movlr + bls.To.SetTarget(movlr) debug := movlr if false { @@ -220,7 +220,7 @@ func (c *ctxt7) stacksplit(p *obj.Prog, framesize int32) *obj.Prog { jmp := obj.Appendp(pcdata, c.newprog) jmp.As = AB jmp.To.Type = obj.TYPE_BRANCH - jmp.Pcond = c.cursym.Func.Text.Link + jmp.To.SetTarget(c.cursym.Func.Text.Link) jmp.Spadj = +framesize return end @@ -621,7 +621,7 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { prologueEnd.Pos = prologueEnd.Pos.WithXlogue(src.PosPrologueEnd) - if objabi.Framepointer_enabled(objabi.GOOS, objabi.GOARCH) { + if objabi.Framepointer_enabled { q1 = obj.Appendp(q1, c.newprog) q1.Pos = p.Pos q1.As = AMOVD @@ -697,7 +697,7 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { mov.To.Reg = REG_R2 // CBNZ branches to the MOV above - cbnz.Pcond = mov + cbnz.To.SetTarget(mov) // ADD $(autosize+8), SP, R3 q = obj.Appendp(mov, c.newprog) @@ -719,7 +719,7 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { q = obj.Appendp(q, c.newprog) q.As = ABNE q.To.Type = obj.TYPE_BRANCH - q.Pcond = end + q.To.SetTarget(end) // ADD $8, SP, R4 q = obj.Appendp(q, c.newprog) @@ -743,7 +743,7 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { q = obj.Appendp(q, c.newprog) q.As = AB q.To.Type = obj.TYPE_BRANCH - q.Pcond = end + q.To.SetTarget(end) } case obj.ARET: @@ -764,7 +764,7 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { p.To.Reg = REGSP p.Spadj = -c.autosize - if objabi.Framepointer_enabled(objabi.GOOS, objabi.GOARCH) { + if objabi.Framepointer_enabled { p = obj.Appendp(p, c.newprog) p.As = ASUB p.From.Type = obj.TYPE_CONST @@ -777,7 +777,7 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { } else { /* want write-back pre-indexed SP+autosize -> SP, loading REGLINK*/ - if objabi.Framepointer_enabled(objabi.GOOS, objabi.GOARCH) { + if objabi.Framepointer_enabled { p.As = AMOVD p.From.Type = obj.TYPE_MEM p.From.Reg = REGSP @@ -865,7 +865,7 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { } case obj.ADUFFCOPY: - if objabi.Framepointer_enabled(objabi.GOOS, objabi.GOARCH) { + if objabi.Framepointer_enabled { // ADR ret_addr, R27 // STP (FP, R27), -24(SP) // SUB 24, SP, FP @@ -913,12 +913,12 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { q5.Reg = REGSP q5.To.Type = obj.TYPE_REG q5.To.Reg = REGFP - q1.Pcond = q5 + q1.From.SetTarget(q5) p = q5 } case obj.ADUFFZERO: - if objabi.Framepointer_enabled(objabi.GOOS, objabi.GOARCH) { + if objabi.Framepointer_enabled { // ADR ret_addr, R27 // STP (FP, R27), -24(SP) // SUB 24, SP, FP @@ -966,7 +966,7 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { q5.Reg = REGSP q5.To.Type = obj.TYPE_REG q5.To.Reg = REGFP - q1.Pcond = q5 + q1.From.SetTarget(q5) p = q5 } } diff --git a/src/cmd/internal/obj/link.go b/src/cmd/internal/obj/link.go index 311e5ae2e8..1d4217b5f5 100644 --- a/src/cmd/internal/obj/link.go +++ b/src/cmd/internal/obj/link.go @@ -237,6 +237,19 @@ const ( TYPE_REGLIST ) +func (a *Addr) Target() *Prog { + if a.Type == TYPE_BRANCH && a.Val != nil { + return a.Val.(*Prog) + } + return nil +} +func (a *Addr) SetTarget(t *Prog) { + if a.Type != TYPE_BRANCH { + panic("setting branch target when type is not TYPE_BRANCH") + } + a.Val = t +} + // Prog describes a single machine instruction. // // The general instruction form is: @@ -255,7 +268,7 @@ const ( // to avoid too much changes in a single swing. // (1) scheme is enough to express any kind of operand combination. // -// Jump instructions use the Pcond field to point to the target instruction, +// Jump instructions use the To.Val field to point to the target *Prog, // which must be in the same linked list as the jump instruction. // // The Progs for a given function are arranged in a list linked through the Link field. @@ -274,7 +287,7 @@ type Prog struct { From Addr // first source operand RestArgs []Addr // can pack any operands that not fit into {Prog.From, Prog.To} To Addr // destination operand (second is RegTo2 below) - Pcond *Prog // target of conditional jump + Pool *Prog // constant pool entry, for arm,arm64 back ends Forwd *Prog // for x86 back end Rel *Prog // for x86, arm back ends Pc int64 // for back ends or assembler: virtual or actual program counter, depending on phase @@ -682,10 +695,9 @@ type Link struct { GenAbstractFunc func(fn *LSym) Errors int - InParallel bool // parallel backend phase in effect - Framepointer_enabled bool - UseBASEntries bool // use Base Address Selection Entries in location lists and PC ranges - IsAsm bool // is the source assembly language, which may contain surprising idioms (e.g., call tables) + InParallel bool // parallel backend phase in effect + UseBASEntries bool // use Base Address Selection Entries in location lists and PC ranges + IsAsm bool // is the source assembly language, which may contain surprising idioms (e.g., call tables) // state for writing objects Text []*LSym diff --git a/src/cmd/internal/obj/mips/asm0.go b/src/cmd/internal/obj/mips/asm0.go index faa827da9f..6107974745 100644 --- a/src/cmd/internal/obj/mips/asm0.go +++ b/src/cmd/internal/obj/mips/asm0.go @@ -460,8 +460,8 @@ func span0(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { o = c.oplook(p) // very large conditional branches - if o.type_ == 6 && p.Pcond != nil { - otxt = p.Pcond.Pc - pc + if o.type_ == 6 && p.To.Target() != nil { + otxt = p.To.Target().Pc - pc if otxt < -(1<<17)+10 || otxt >= (1<<17)-10 { q = c.newprog() q.Link = p.Link @@ -469,15 +469,15 @@ func span0(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { q.As = AJMP q.Pos = p.Pos q.To.Type = obj.TYPE_BRANCH - q.Pcond = p.Pcond - p.Pcond = q + q.To.SetTarget(p.To.Target()) + p.To.SetTarget(q) q = c.newprog() q.Link = p.Link p.Link = q q.As = AJMP q.Pos = p.Pos q.To.Type = obj.TYPE_BRANCH - q.Pcond = q.Link.Link + q.To.SetTarget(q.Link.Link) c.addnop(p.Link) c.addnop(p) @@ -1230,10 +1230,10 @@ func (c *ctxt0) asmout(p *obj.Prog, o *Optab, out []uint32) { case 6: /* beq r1,[r2],sbra */ v := int32(0) - if p.Pcond == nil { + if p.To.Target() == nil { v = int32(-4) >> 2 } else { - v = int32(p.Pcond.Pc-p.Pc-4) >> 2 + v = int32(p.To.Target().Pc-p.Pc-4) >> 2 } if (v<<16)>>16 != v { c.ctxt.Diag("short branch too far\n%v", p) @@ -1285,25 +1285,25 @@ func (c *ctxt0) asmout(p *obj.Prog, o *Optab, out []uint32) { if c.aclass(&p.To) == C_SBRA && p.To.Sym == nil && p.As == AJMP { // use PC-relative branch for short branches // BEQ R0, R0, sbra - if p.Pcond == nil { + if p.To.Target() == nil { v = int32(-4) >> 2 } else { - v = int32(p.Pcond.Pc-p.Pc-4) >> 2 + v = int32(p.To.Target().Pc-p.Pc-4) >> 2 } if (v<<16)>>16 == v { o1 = OP_IRR(c.opirr(ABEQ), uint32(v), uint32(REGZERO), uint32(REGZERO)) break } } - if p.Pcond == nil { + if p.To.Target() == nil { v = int32(p.Pc) >> 2 } else { - v = int32(p.Pcond.Pc) >> 2 + v = int32(p.To.Target().Pc) >> 2 } o1 = OP_JMP(c.opirr(p.As), uint32(v)) if p.To.Sym == nil { p.To.Sym = c.cursym.Func.Text.From.Sym - p.To.Offset = p.Pcond.Pc + p.To.Offset = p.To.Target().Pc } rel := obj.Addrel(c.cursym) rel.Off = int32(c.pc) diff --git a/src/cmd/internal/obj/mips/obj0.go b/src/cmd/internal/obj/mips/obj0.go index 77cad979a6..f19facc00c 100644 --- a/src/cmd/internal/obj/mips/obj0.go +++ b/src/cmd/internal/obj/mips/obj0.go @@ -227,11 +227,11 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { } else { p.Mark |= BRANCH } - q1 := p.Pcond + q1 := p.To.Target() if q1 != nil { for q1.As == obj.ANOP { q1 = q1.Link - p.Pcond = q1 + p.To.SetTarget(q1) } if q1.Mark&LEAF == 0 { @@ -424,8 +424,8 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { q = obj.Appendp(q, newprog) q.As = obj.ANOP - p1.Pcond = q - p2.Pcond = q + p1.To.SetTarget(q) + p2.To.SetTarget(q) } case ARET: @@ -778,7 +778,7 @@ func (c *ctxt0) stacksplit(p *obj.Prog, framesize int32) *obj.Prog { p.To.Type = obj.TYPE_REG p.To.Reg = REG_R3 if q != nil { - q.Pcond = p + q.To.SetTarget(p) p.Mark |= LABEL } @@ -805,14 +805,14 @@ func (c *ctxt0) stacksplit(p *obj.Prog, framesize int32) *obj.Prog { p.As = AJMP p.To.Type = obj.TYPE_BRANCH - p.Pcond = c.cursym.Func.Text.Link + p.To.SetTarget(c.cursym.Func.Text.Link) p.Mark |= BRANCH // placeholder for q1's jump target p = obj.Appendp(p, c.newprog) p.As = obj.ANOP // zero-width place holder - q1.Pcond = p + q1.To.SetTarget(p) return p } diff --git a/src/cmd/internal/obj/pass.go b/src/cmd/internal/obj/pass.go index 4f156d969b..09d520b4e9 100644 --- a/src/cmd/internal/obj/pass.go +++ b/src/cmd/internal/obj/pass.go @@ -36,8 +36,8 @@ package obj // In the case of an infinite loop, brloop returns nil. func brloop(p *Prog) *Prog { c := 0 - for q := p; q != nil; q = q.Pcond { - if q.As != AJMP || q.Pcond == nil { + for q := p; q != nil; q = q.To.Target() { + if q.As != AJMP || q.To.Target() == nil { return q } c++ @@ -132,8 +132,6 @@ func linkpatch(ctxt *Link, sym *LSym, newprog ProgAlloc) { continue } if p.To.Val != nil { - // TODO: Remove To.Val.(*Prog) in favor of p->pcond. - p.Pcond = p.To.Val.(*Prog) continue } @@ -158,8 +156,7 @@ func linkpatch(ctxt *Link, sym *LSym, newprog ProgAlloc) { p.To.Type = TYPE_NONE } - p.To.Val = q - p.Pcond = q + p.To.SetTarget(q) } if !ctxt.Flag_optimize { @@ -168,12 +165,12 @@ func linkpatch(ctxt *Link, sym *LSym, newprog ProgAlloc) { // Collapse series of jumps to jumps. for p := sym.Func.Text; p != nil; p = p.Link { - if p.Pcond == nil { + if p.To.Target() == nil { continue } - p.Pcond = brloop(p.Pcond) - if p.Pcond != nil && p.To.Type == TYPE_BRANCH { - p.To.Offset = p.Pcond.Pc + p.To.SetTarget(brloop(p.To.Target())) + if p.To.Target() != nil && p.To.Type == TYPE_BRANCH { + p.To.Offset = p.To.Target().Pc } } } diff --git a/src/cmd/internal/obj/ppc64/asm9.go b/src/cmd/internal/obj/ppc64/asm9.go index 3c82477fc4..98b453de6c 100644 --- a/src/cmd/internal/obj/ppc64/asm9.go +++ b/src/cmd/internal/obj/ppc64/asm9.go @@ -725,22 +725,22 @@ func span9(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { o = c.oplook(p) // very large conditional branches - if (o.type_ == 16 || o.type_ == 17) && p.Pcond != nil { - otxt = p.Pcond.Pc - pc + if (o.type_ == 16 || o.type_ == 17) && p.To.Target() != nil { + otxt = p.To.Target().Pc - pc if otxt < -(1<<15)+10 || otxt >= (1<<15)-10 { q = c.newprog() q.Link = p.Link p.Link = q q.As = ABR q.To.Type = obj.TYPE_BRANCH - q.Pcond = p.Pcond - p.Pcond = q + q.To.SetTarget(p.To.Target()) + p.To.SetTarget(q) q = c.newprog() q.Link = p.Link p.Link = q q.As = ABR q.To.Type = obj.TYPE_BRANCH - q.Pcond = q.Link.Link + q.To.SetTarget(q.Link.Link) //addnop(p->link); //addnop(p); @@ -2630,8 +2630,8 @@ func (c *ctxt9) asmout(p *obj.Prog, o *Optab, out []uint32) { case 11: /* br/bl lbra */ v := int32(0) - if p.Pcond != nil { - v = int32(p.Pcond.Pc - p.Pc) + if p.To.Target() != nil { + v = int32(p.To.Target().Pc - p.Pc) if v&03 != 0 { c.ctxt.Diag("odd branch target address\n%v", p) v &^= 03 @@ -2781,8 +2781,8 @@ func (c *ctxt9) asmout(p *obj.Prog, o *Optab, out []uint32) { } } v := int32(0) - if p.Pcond != nil { - v = int32(p.Pcond.Pc - p.Pc) + if p.To.Target() != nil { + v = int32(p.To.Target().Pc - p.Pc) } if v&03 != 0 { c.ctxt.Diag("odd branch target address\n%v", p) diff --git a/src/cmd/internal/obj/ppc64/obj9.go b/src/cmd/internal/obj/ppc64/obj9.go index 749f7066de..c012762a18 100644 --- a/src/cmd/internal/obj/ppc64/obj9.go +++ b/src/cmd/internal/obj/ppc64/obj9.go @@ -556,7 +556,7 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { ABVS: p.Mark |= BRANCH q = p - q1 = p.Pcond + q1 = p.To.Target() if q1 != nil { // NOPs are not removed due to #40689. @@ -841,8 +841,8 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { q = obj.Appendp(q, c.newprog) q.As = obj.ANOP - p1.Pcond = q - p2.Pcond = q + p1.To.SetTarget(q) + p2.To.SetTarget(q) } case obj.ARET: @@ -1153,7 +1153,7 @@ func (c *ctxt9) stacksplit(p *obj.Prog, framesize int32) *obj.Prog { p.To.Type = obj.TYPE_REG p.To.Reg = REG_R5 if q != nil { - q.Pcond = p + q.To.SetTarget(p) } p = c.ctxt.EmitEntryStackMap(c.cursym, p, c.newprog) @@ -1248,13 +1248,13 @@ func (c *ctxt9) stacksplit(p *obj.Prog, framesize int32) *obj.Prog { p = obj.Appendp(p, c.newprog) p.As = ABR p.To.Type = obj.TYPE_BRANCH - p.Pcond = p0.Link + p.To.SetTarget(p0.Link) // placeholder for q1's jump target p = obj.Appendp(p, c.newprog) p.As = obj.ANOP // zero-width place holder - q1.Pcond = p + q1.To.SetTarget(p) return p } diff --git a/src/cmd/internal/obj/riscv/obj.go b/src/cmd/internal/obj/riscv/obj.go index 2eb2935b31..77d383b290 100644 --- a/src/cmd/internal/obj/riscv/obj.go +++ b/src/cmd/internal/obj/riscv/obj.go @@ -634,7 +634,7 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { getargp.Reg = 0 getargp.To = obj.Addr{Type: obj.TYPE_REG, Reg: REG_X12} - bneadj.Pcond = getargp + bneadj.To.SetTarget(getargp) calcargp := obj.Appendp(getargp, newprog) calcargp.As = AADDI @@ -647,7 +647,7 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { testargp.From = obj.Addr{Type: obj.TYPE_REG, Reg: REG_X12} testargp.Reg = REG_X13 testargp.To.Type = obj.TYPE_BRANCH - testargp.Pcond = endadj + testargp.To.SetTarget(endadj) adjargp := obj.Appendp(testargp, newprog) adjargp.As = AADDI @@ -665,7 +665,7 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { godone.As = AJAL godone.From = obj.Addr{Type: obj.TYPE_REG, Reg: REG_ZERO} godone.To.Type = obj.TYPE_BRANCH - godone.Pcond = endadj + godone.To.SetTarget(endadj) } // Update stack-based offsets. @@ -890,27 +890,27 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { if p.To.Type != obj.TYPE_BRANCH { panic("assemble: instruction with branch-like opcode lacks destination") } - offset := p.Pcond.Pc - p.Pc + offset := p.To.Target().Pc - p.Pc if offset < -4096 || 4096 <= offset { // Branch is long. Replace it with a jump. jmp := obj.Appendp(p, newprog) jmp.As = AJAL jmp.From = obj.Addr{Type: obj.TYPE_REG, Reg: REG_ZERO} jmp.To = obj.Addr{Type: obj.TYPE_BRANCH} - jmp.Pcond = p.Pcond + jmp.To.SetTarget(p.To.Target()) p.As = InvertBranch(p.As) - p.Pcond = jmp.Link + p.To.SetTarget(jmp.Link) // We may have made previous branches too long, // so recheck them. rescan = true } case AJAL: - if p.Pcond == nil { + if p.To.Target() == nil { panic("intersymbol jumps should be expressed as AUIPC+JALR") } - offset := p.Pcond.Pc - p.Pc + offset := p.To.Target().Pc - p.Pc if offset < -(1<<20) || (1<<20) <= offset { // Replace with 2-instruction sequence. This assumes // that TMP is not live across J instructions, since @@ -925,6 +925,7 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { // fixed up in the next loop. p.As = AAUIPC p.From = obj.Addr{Type: obj.TYPE_BRANCH, Sym: p.From.Sym} + p.From.SetTarget(p.To.Target()) p.Reg = 0 p.To = obj.Addr{Type: obj.TYPE_REG, Reg: REG_TMP} @@ -946,16 +947,16 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { case ABEQ, ABEQZ, ABGE, ABGEU, ABGEZ, ABGT, ABGTU, ABGTZ, ABLE, ABLEU, ABLEZ, ABLT, ABLTU, ABLTZ, ABNE, ABNEZ, AJAL: switch p.To.Type { case obj.TYPE_BRANCH: - p.To.Type, p.To.Offset = obj.TYPE_CONST, p.Pcond.Pc-p.Pc + p.To.Type, p.To.Offset = obj.TYPE_CONST, p.To.Target().Pc-p.Pc case obj.TYPE_MEM: panic("unhandled type") } case AAUIPC: if p.From.Type == obj.TYPE_BRANCH { - low, high, err := Split32BitImmediate(p.Pcond.Pc - p.Pc) + low, high, err := Split32BitImmediate(p.From.Target().Pc - p.Pc) if err != nil { - ctxt.Diag("%v: jump displacement %d too large", p, p.Pcond.Pc-p.Pc) + ctxt.Diag("%v: jump displacement %d too large", p, p.To.Target().Pc-p.Pc) } p.From = obj.Addr{Type: obj.TYPE_CONST, Offset: high, Sym: cursym} p.Link.From.Offset = low @@ -1098,7 +1099,7 @@ func stacksplit(ctxt *obj.Link, p *obj.Prog, cursym *obj.LSym, newprog obj.ProgA p.To.Sym = ctxt.Lookup("runtime.morestack") } if to_more != nil { - to_more.Pcond = p + to_more.To.SetTarget(p) } p = jalrToSym(ctxt, p, newprog, REG_X5) @@ -1107,12 +1108,12 @@ func stacksplit(ctxt *obj.Link, p *obj.Prog, cursym *obj.LSym, newprog obj.ProgA p.As = AJAL p.To = obj.Addr{Type: obj.TYPE_BRANCH} p.From = obj.Addr{Type: obj.TYPE_REG, Reg: REG_ZERO} - p.Pcond = cursym.Func.Text.Link + p.To.SetTarget(cursym.Func.Text.Link) // placeholder for to_done's jump target p = obj.Appendp(p, newprog) p.As = obj.ANOP // zero-width place holder - to_done.Pcond = p + to_done.To.SetTarget(p) return p } diff --git a/src/cmd/internal/obj/s390x/asmz.go b/src/cmd/internal/obj/s390x/asmz.go index 29182ea805..68f01f1c5d 100644 --- a/src/cmd/internal/obj/s390x/asmz.go +++ b/src/cmd/internal/obj/s390x/asmz.go @@ -3001,8 +3001,8 @@ func (c *ctxtz) asmout(p *obj.Prog, asm *[]byte) { case 11: // br/bl v := int32(0) - if p.Pcond != nil { - v = int32((p.Pcond.Pc - p.Pc) >> 1) + if p.To.Target() != nil { + v = int32((p.To.Target().Pc - p.Pc) >> 1) } if p.As == ABR && p.To.Sym == nil && int32(int16(v)) == v { @@ -3122,8 +3122,8 @@ func (c *ctxtz) asmout(p *obj.Prog, asm *[]byte) { case 16: // conditional branch v := int32(0) - if p.Pcond != nil { - v = int32((p.Pcond.Pc - p.Pc) >> 1) + if p.To.Target() != nil { + v = int32((p.To.Target().Pc - p.Pc) >> 1) } mask := uint32(c.branchMask(p)) if p.To.Sym == nil && int32(int16(v)) == v { @@ -3440,7 +3440,7 @@ func (c *ctxtz) asmout(p *obj.Prog, asm *[]byte) { case 41: // branch on count r1 := p.From.Reg - ri2 := (p.Pcond.Pc - p.Pc) >> 1 + ri2 := (p.To.Target().Pc - p.Pc) >> 1 if int64(int16(ri2)) != ri2 { c.ctxt.Diag("branch target too far away") } @@ -3885,8 +3885,8 @@ func (c *ctxtz) asmout(p *obj.Prog, asm *[]byte) { case 89: // compare and branch reg reg var v int32 - if p.Pcond != nil { - v = int32((p.Pcond.Pc - p.Pc) >> 1) + if p.To.Target() != nil { + v = int32((p.To.Target().Pc - p.Pc) >> 1) } // Some instructions take a mask as the first argument. @@ -3930,8 +3930,8 @@ func (c *ctxtz) asmout(p *obj.Prog, asm *[]byte) { case 90: // compare and branch reg $constant var v int32 - if p.Pcond != nil { - v = int32((p.Pcond.Pc - p.Pc) >> 1) + if p.To.Target() != nil { + v = int32((p.To.Target().Pc - p.Pc) >> 1) } // Some instructions take a mask as the first argument. diff --git a/src/cmd/internal/obj/s390x/objz.go b/src/cmd/internal/obj/s390x/objz.go index ef6335d849..625bb0f7b4 100644 --- a/src/cmd/internal/obj/s390x/objz.go +++ b/src/cmd/internal/obj/s390x/objz.go @@ -454,8 +454,8 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { q = obj.Appendp(q, c.newprog) q.As = obj.ANOP - p1.Pcond = q - p2.Pcond = q + p1.To.SetTarget(q) + p2.To.SetTarget(q) } case obj.ARET: @@ -679,14 +679,14 @@ func (c *ctxtz) stacksplitPost(p *obj.Prog, pPre *obj.Prog, pPreempt *obj.Prog, // MOVD LR, R5 p = obj.Appendp(pcdata, c.newprog) - pPre.Pcond = p + pPre.To.SetTarget(p) p.As = AMOVD p.From.Type = obj.TYPE_REG p.From.Reg = REG_LR p.To.Type = obj.TYPE_REG p.To.Reg = REG_R5 if pPreempt != nil { - pPreempt.Pcond = p + pPreempt.To.SetTarget(p) } // BL runtime.morestack(SB) @@ -709,7 +709,7 @@ func (c *ctxtz) stacksplitPost(p *obj.Prog, pPre *obj.Prog, pPreempt *obj.Prog, p.As = ABR p.To.Type = obj.TYPE_BRANCH - p.Pcond = c.cursym.Func.Text.Link + p.To.SetTarget(c.cursym.Func.Text.Link) return p } diff --git a/src/cmd/internal/obj/sym.go b/src/cmd/internal/obj/sym.go index 34f61b7f62..d58877ee15 100644 --- a/src/cmd/internal/obj/sym.go +++ b/src/cmd/internal/obj/sym.go @@ -53,7 +53,6 @@ func Linknew(arch *LinkArch) *Link { } ctxt.Flag_optimize = true - ctxt.Framepointer_enabled = objabi.Framepointer_enabled(objabi.GOOS, arch.Name) return ctxt } diff --git a/src/cmd/internal/obj/util.go b/src/cmd/internal/obj/util.go index d020026445..a30ccf0564 100644 --- a/src/cmd/internal/obj/util.go +++ b/src/cmd/internal/obj/util.go @@ -251,10 +251,8 @@ func WriteDconv(w io.Writer, p *Prog, a *Addr) { case TYPE_BRANCH: if a.Sym != nil { fmt.Fprintf(w, "%s(SB)", a.Sym.Name) - } else if p != nil && p.Pcond != nil { - fmt.Fprint(w, p.Pcond.Pc) - } else if a.Val != nil { - fmt.Fprint(w, a.Val.(*Prog).Pc) + } else if a.Target() != nil { + fmt.Fprint(w, a.Target().Pc) } else { fmt.Fprintf(w, "%d(PC)", a.Offset) } diff --git a/src/cmd/internal/obj/x86/asm6.go b/src/cmd/internal/obj/x86/asm6.go index 82a2e6adc4..fb99c620ad 100644 --- a/src/cmd/internal/obj/x86/asm6.go +++ b/src/cmd/internal/obj/x86/asm6.go @@ -1855,7 +1855,7 @@ func spadjop(ctxt *obj.Link, l, q obj.As) obj.As { // no standalone or macro-fused jump will straddle or end on a 32 byte boundary // by inserting NOPs before the jumps func isJump(p *obj.Prog) bool { - return p.Pcond != nil || p.As == obj.AJMP || p.As == obj.ACALL || + return p.To.Target() != nil || p.As == obj.AJMP || p.As == obj.ACALL || p.As == obj.ARET || p.As == obj.ADUFFCOPY || p.As == obj.ADUFFZERO } @@ -1867,7 +1867,7 @@ func lookForJCC(p *obj.Prog) *obj.Prog { for q = p.Link; q != nil && (q.As == obj.APCDATA || q.As == obj.AFUNCDATA || q.As == obj.ANOP); q = q.Link { } - if q == nil || q.Pcond == nil || p.As == obj.AJMP || p.As == obj.ACALL { + if q == nil || q.To.Target() == nil || p.As == obj.AJMP || p.As == obj.ACALL { return nil } @@ -2051,8 +2051,8 @@ func span6(ctxt *obj.Link, s *obj.LSym, newprog obj.ProgAlloc) { } for p := s.Func.Text; p != nil; p = p.Link { - if p.To.Type == obj.TYPE_BRANCH && p.Pcond == nil { - p.Pcond = p + if p.To.Type == obj.TYPE_BRANCH && p.To.Target() == nil { + p.To.SetTarget(p) } if p.As == AADJSP { p.To.Type = obj.TYPE_REG @@ -2088,7 +2088,7 @@ func span6(ctxt *obj.Link, s *obj.LSym, newprog obj.ProgAlloc) { for p := s.Func.Text; p != nil; p = p.Link { count++ p.Back = branchShort // use short branches first time through - if q := p.Pcond; q != nil && (q.Back&branchShort != 0) { + if q := p.To.Target(); q != nil && (q.Back&branchShort != 0) { p.Back |= branchBackwards q.Back |= branchLoopHead } @@ -4833,12 +4833,12 @@ func (ab *AsmBuf) doasm(ctxt *obj.Link, cursym *obj.LSym, p *obj.Prog) { ctxt.Diag("directly calling duff when dynamically linking Go") } - if ctxt.Framepointer_enabled && yt.zcase == Zcallduff && ctxt.Arch.Family == sys.AMD64 { + if yt.zcase == Zcallduff && ctxt.Arch.Family == sys.AMD64 { // Maintain BP around call, since duffcopy/duffzero can't do it // (the call jumps into the middle of the function). // This makes it possible to see call sites for duffcopy/duffzero in // BP-based profiling tools like Linux perf (which is the - // whole point of obj.Framepointer_enabled). + // whole point of maintaining frame pointers in Go). // MOVQ BP, -16(SP) // LEAQ -16(SP), BP ab.Put(bpduff1) @@ -4852,7 +4852,7 @@ func (ab *AsmBuf) doasm(ctxt *obj.Link, cursym *obj.LSym, p *obj.Prog) { r.Siz = 4 ab.PutInt32(0) - if ctxt.Framepointer_enabled && yt.zcase == Zcallduff && ctxt.Arch.Family == sys.AMD64 { + if yt.zcase == Zcallduff && ctxt.Arch.Family == sys.AMD64 { // Pop BP pushed above. // MOVQ 0(BP), BP ab.Put(bpduff2) @@ -4886,7 +4886,7 @@ func (ab *AsmBuf) doasm(ctxt *obj.Link, cursym *obj.LSym, p *obj.Prog) { // TODO: Check in input, preserve in brchain. // Fill in backward jump now. - q = p.Pcond + q = p.To.Target() if q == nil { ctxt.Diag("jmp/branch/loop without target") diff --git a/src/cmd/internal/obj/x86/obj6.go b/src/cmd/internal/obj/x86/obj6.go index c1e5bea055..18a6afcd77 100644 --- a/src/cmd/internal/obj/x86/obj6.go +++ b/src/cmd/internal/obj/x86/obj6.go @@ -582,7 +582,7 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { } var bpsize int - if ctxt.Arch.Family == sys.AMD64 && ctxt.Framepointer_enabled && + if ctxt.Arch.Family == sys.AMD64 && !p.From.Sym.NoFrame() && // (1) below !(autoffset == 0 && p.From.Sym.NoSplit()) && // (2) below !(autoffset == 0 && !hasCall) { // (3) below @@ -765,7 +765,7 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { } // Set jne branch target. - jne.Pcond = p + jne.To.SetTarget(p) // CMPQ panic_argp(BX), DI p = obj.Appendp(p, newprog) @@ -783,7 +783,7 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { p = obj.Appendp(p, newprog) p.As = AJNE p.To.Type = obj.TYPE_BRANCH - p.Pcond = end + p.To.SetTarget(end) // MOVQ SP, panic_argp(BX) p = obj.Appendp(p, newprog) @@ -801,7 +801,7 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { p = obj.Appendp(p, newprog) p.As = obj.AJMP p.To.Type = obj.TYPE_BRANCH - p.Pcond = end + p.To.SetTarget(end) // Reset p for following code. p = end @@ -1144,12 +1144,12 @@ func stacksplit(ctxt *obj.Link, cursym *obj.LSym, p *obj.Prog, newprog obj.ProgA jmp := obj.Appendp(pcdata, newprog) jmp.As = obj.AJMP jmp.To.Type = obj.TYPE_BRANCH - jmp.Pcond = cursym.Func.Text.Link + jmp.To.SetTarget(cursym.Func.Text.Link) jmp.Spadj = +framesize - jls.Pcond = call + jls.To.SetTarget(call) if q1 != nil { - q1.Pcond = call + q1.To.SetTarget(call) } return end diff --git a/src/cmd/internal/objabi/doc.go b/src/cmd/internal/objabi/doc.go deleted file mode 100644 index 08e922b11f..0000000000 --- a/src/cmd/internal/objabi/doc.go +++ /dev/null @@ -1,122 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// NOTE: There are *three* independent implementations of this object -// file format in the Go source tree: -// -// - cmd/internal/goobj/read.go (used by cmd/addr2line, cmd/nm, cmd/objdump, cmd/pprof) -// - cmd/internal/obj/objfile.go (used by cmd/asm and cmd/compile) -// - cmd/link/internal/objfile.go (used by cmd/link) -// -// When changing the object file format, remember to change all three. - -// Originally, Go object files were Plan 9 object files, but no longer. -// Now they are more like standard object files, in that each symbol is defined -// by an associated memory image (bytes) and a list of relocations to apply -// during linking. We do not (yet?) use a standard file format, however. -// For now, the format is chosen to be as simple as possible to read and write. -// It may change for reasons of efficiency, or we may even switch to a -// standard file format if there are compelling benefits to doing so. -// See golang.org/s/go13linker for more background. -// -// The file format is: -// -// - magic header: "\x00go114ld" -// - byte 1 - version number -// - sequence of strings giving dependencies (imported packages) -// - empty string (marks end of sequence) -// - number of entries in the following sequence -// - sequence of filename strings to generate debug information -// - sequence of symbol references used by the defined symbols -// - byte 0xff (marks end of sequence) -// - sequence of integer lengths: -// - total data length -// - total number of relocations -// - total number of pcdata -// - total number of automatics -// - total number of funcdata -// - total number of files -// - data, the content of the defined symbols -// - sequence of defined symbols -// - byte 0xff (marks end of sequence) -// - magic footer: "\xffgo114ld" -// -// All integers are stored in a zigzag varint format. -// See golang.org/s/go12symtab for a definition. -// -// Data blocks and strings are both stored as an integer -// followed by that many bytes. -// -// A symbol reference is a string name followed by an ABI or -1 for static. -// -// A symbol points to other symbols using an index into the symbol -// reference sequence. Index 0 corresponds to a nil symbol pointer. -// In the symbol layout described below "symref index" stands for this -// index. -// -// Each symbol is laid out as the following fields: -// -// - byte 0xfe (sanity check for synchronization) -// - type [byte] -// - name & ABI [symref index] -// - flags [int] -// 1<<0 dupok -// 1<<1 local -// 1<<2 add to typelink table -// - size [int] -// - gotype [symref index] -// - p [data block] -// - nr [int] -// - r [nr relocations, sorted by off] -// -// If type == STEXT, there are a few more fields: -// -// - args [int] -// - locals [int] -// - nosplit [int] -// - flags [int] -// 1<<0 leaf -// 1<<1 C function -// 1<<2 function may call reflect.Type.Method -// 1<<3 function compiled with -shared -// - nlocal [int] -// - local [nlocal automatics] -// - pcln [pcln table] -// -// Each relocation has the encoding: -// -// - off [int] -// - siz [int] -// - type [int] -// - add [int] -// - sym [symref index] -// -// Each local has the encoding: -// -// - asym [symref index] -// - offset [int] -// - type [int] -// - gotype [symref index] -// -// The pcln table has the encoding: -// -// - pcsp [data block] -// - pcfile [data block] -// - pcline [data block] -// - pcinline [data block] -// - npcdata [int] -// - pcdata [npcdata data blocks] -// - nfuncdata [int] -// - funcdata [nfuncdata symref index] -// - funcdatasym [nfuncdata ints] -// - nfile [int] -// - file [nfile symref index] -// - ninlinedcall [int] -// - inlinedcall [ninlinedcall int symref int symref] -// -// The file layout and meaning of type integers are architecture-independent. -// -// TODO(rsc): The file format is good for a first pass but needs work. -// - There are SymID in the object file that should really just be strings. -package objabi diff --git a/src/cmd/internal/objabi/funcdata.go b/src/cmd/internal/objabi/funcdata.go index d5bacb5900..c9480bf2f0 100644 --- a/src/cmd/internal/objabi/funcdata.go +++ b/src/cmd/internal/objabi/funcdata.go @@ -35,7 +35,7 @@ const ( // PCDATA_RegMapIndex values. // // Only if !go115ReduceLiveness. - PCDATA_RegMapUnsafe = -2 // Unsafe for async preemption + PCDATA_RegMapUnsafe = PCDATA_UnsafePointUnsafe // Unsafe for async preemption // PCDATA_UnsafePoint values. PCDATA_UnsafePointSafe = -1 // Safe for async preemption diff --git a/src/cmd/internal/objabi/util.go b/src/cmd/internal/objabi/util.go index f7873a42b9..d2d6fdbda8 100644 --- a/src/cmd/internal/objabi/util.go +++ b/src/cmd/internal/objabi/util.go @@ -131,12 +131,16 @@ func init() { addexp(f) } } -} -func Framepointer_enabled(goos, goarch string) bool { - return framepointer_enabled != 0 && (goarch == "amd64" || goarch == "arm64" && (goos == "linux" || goos == "darwin")) + // regabi is only supported on amd64. + if GOARCH != "amd64" { + Regabi_enabled = 0 + } } +// Note: must agree with runtime.framepointer_enabled. +var Framepointer_enabled = GOARCH == "amd64" || GOARCH == "arm64" && (GOOS == "linux" || GOOS == "darwin") + func addexp(s string) { // Could do general integer parsing here, but the runtime copy doesn't yet. v := 1 @@ -159,10 +163,10 @@ func addexp(s string) { } var ( - framepointer_enabled int = 1 Fieldtrack_enabled int Preemptibleloops_enabled int Staticlockranking_enabled int + Regabi_enabled int ) // Toolchain experiments. @@ -174,9 +178,9 @@ var exper = []struct { val *int }{ {"fieldtrack", &Fieldtrack_enabled}, - {"framepointer", &framepointer_enabled}, {"preemptibleloops", &Preemptibleloops_enabled}, {"staticlockranking", &Staticlockranking_enabled}, + {"regabi", &Regabi_enabled}, } var defaultExpstring = Expstring() diff --git a/src/cmd/internal/objfile/macho.go b/src/cmd/internal/objfile/macho.go index fdb7e76dfc..1d6963f7c4 100644 --- a/src/cmd/internal/objfile/macho.go +++ b/src/cmd/internal/objfile/macho.go @@ -60,7 +60,7 @@ func (f *machoFile) symbols() ([]Sym, error) { } else if int(s.Sect) <= len(f.macho.Sections) { sect := f.macho.Sections[s.Sect-1] switch sect.Seg { - case "__TEXT": + case "__TEXT", "__DATA_CONST": sym.Code = 'R' case "__DATA": sym.Code = 'D' diff --git a/src/cmd/link/internal/arm64/obj.go b/src/cmd/link/internal/arm64/obj.go index 37b72b6c37..a980cfee52 100644 --- a/src/cmd/link/internal/arm64/obj.go +++ b/src/cmd/link/internal/arm64/obj.go @@ -105,7 +105,7 @@ func archinit(ctxt *ld.Link) { *ld.FlagTextAddr = 4096 + int64(ld.HEADR) } if *ld.FlagRound == -1 { - *ld.FlagRound = 4096 + *ld.FlagRound = 16384 // 16K page alignment } } } diff --git a/src/cmd/link/internal/ld/data.go b/src/cmd/link/internal/ld/data.go index dc7096ea8c..a730125cf2 100644 --- a/src/cmd/link/internal/ld/data.go +++ b/src/cmd/link/internal/ld/data.go @@ -930,7 +930,7 @@ func writeBlock(ctxt *Link, out *OutBuf, ldr *loader.Loader, syms []loader.Sym, break } if val < addr { - ldr.Errorf(s, "phase error: addr=%#x but sym=%#x type=%d", addr, val, ldr.SymType(s)) + ldr.Errorf(s, "phase error: addr=%#x but sym=%#x type=%v sect=%v", addr, val, ldr.SymType(s), ldr.SymSect(s).Name) errorexit() } if addr < val { @@ -1308,9 +1308,9 @@ func (state *dodataState) makeRelroForSharedLib(target *Link) { // relro Type before it reaches here. isRelro = true case sym.SFUNCTAB: - if target.IsAIX() && ldr.SymName(s) == "runtime.etypes" { + if ldr.SymName(s) == "runtime.etypes" { // runtime.etypes must be at the end of - // the relro datas. + // the relro data. isRelro = true } } @@ -1706,7 +1706,7 @@ func (state *dodataState) allocateDataSections(ctxt *Link) { ldr.SetSymSect(ldr.LookupOrCreateSym("runtime.ebss", 0), sect) bssGcEnd := state.datsize - int64(sect.Vaddr) - // Emit gcdata for bcc symbols now that symbol values have been assigned. + // Emit gcdata for bss symbols now that symbol values have been assigned. gcsToEmit := []struct { symName string symKind sym.SymKind @@ -1786,7 +1786,8 @@ func (state *dodataState) allocateDataSections(ctxt *Link) { culprit := ldr.SymName(state.data[sym.STEXT][0]) Errorf(nil, "dodata found an sym.STEXT symbol: %s", culprit) } - state.allocateSingleSymSections(&Segtext, sym.SELFRXSECT, sym.SRODATA, 04) + state.allocateSingleSymSections(&Segtext, sym.SELFRXSECT, sym.SRODATA, 05) + state.allocateSingleSymSections(&Segtext, sym.SMACHOPLT, sym.SRODATA, 05) /* read-only data */ sect = state.allocateNamedDataSection(segro, ".rodata", sym.ReadOnly, 04) @@ -1810,7 +1811,6 @@ func (state *dodataState) allocateDataSections(ctxt *Link) { /* read-only ELF, Mach-O sections */ state.allocateSingleSymSections(segro, sym.SELFROSECT, sym.SRODATA, 04) - state.allocateSingleSymSections(segro, sym.SMACHOPLT, sym.SRODATA, 04) // There is some data that are conceptually read-only but are written to by // relocations. On GNU systems, we can arrange for the dynamic linker to @@ -1826,13 +1826,16 @@ func (state *dodataState) allocateDataSections(ctxt *Link) { const fallbackPerm = 04 relroSecPerm := fallbackPerm genrelrosecname := func(suffix string) string { + if suffix == "" { + return ".rodata" + } return suffix } seg := segro if ctxt.UseRelro() { segrelro := &Segrelrodata - if ctxt.LinkMode == LinkExternal && ctxt.HeadType != objabi.Haix { + if ctxt.LinkMode == LinkExternal && !ctxt.IsAIX() && !ctxt.IsDarwin() { // Using a separate segment with an external // linker results in some programs moving // their data sections unexpectedly, which @@ -1845,9 +1848,12 @@ func (state *dodataState) allocateDataSections(ctxt *Link) { state.datsize = 0 } - genrelrosecname = func(suffix string) string { - return ".data.rel.ro" + suffix + if !ctxt.IsDarwin() { // We don't need the special names on darwin. + genrelrosecname = func(suffix string) string { + return ".data.rel.ro" + suffix + } } + relroReadOnly := []sym.SymKind{} for _, symnro := range sym.ReadOnly { symn := sym.RelROMap[symnro] diff --git a/src/cmd/link/internal/ld/deadcode.go b/src/cmd/link/internal/ld/deadcode.go index 0269429723..35545f950e 100644 --- a/src/cmd/link/internal/ld/deadcode.go +++ b/src/cmd/link/internal/ld/deadcode.go @@ -209,7 +209,7 @@ func (d *deadcodePass) mark(symIdx, parent loader.Sym) { if symIdx != 0 && !d.ldr.AttrReachable(symIdx) { d.wq.push(symIdx) d.ldr.SetAttrReachable(symIdx, true) - if objabi.Fieldtrack_enabled != 0 { + if objabi.Fieldtrack_enabled != 0 && d.ldr.Reachparent[symIdx] == 0 { d.ldr.Reachparent[symIdx] = parent } if *flagDumpDep { diff --git a/src/cmd/link/internal/ld/lib.go b/src/cmd/link/internal/ld/lib.go index 09c7bbfb53..4295b2a660 100644 --- a/src/cmd/link/internal/ld/lib.go +++ b/src/cmd/link/internal/ld/lib.go @@ -775,14 +775,6 @@ func (ctxt *Link) linksetup() { sb.SetSize(0) sb.AddUint8(uint8(objabi.GOARM)) } - - if objabi.Framepointer_enabled(objabi.GOOS, objabi.GOARCH) { - fpe := ctxt.loader.LookupOrCreateSym("runtime.framepointer_enabled", 0) - sb := ctxt.loader.MakeSymbolUpdater(fpe) - sb.SetType(sym.SNOPTRDATA) - sb.SetSize(0) - sb.AddUint8(1) - } } else { // If OTOH the module does not contain the runtime package, // create a local symbol for the moduledata. @@ -1246,15 +1238,23 @@ func (ctxt *Link) hostlink() { } } + // On darwin, whether to combine DWARF into executable. + // Only macOS supports unmapped segments such as our __DWARF segment. + combineDwarf := ctxt.IsDarwin() && !*FlagS && !*FlagW && !debug_s && machoPlatform == PLATFORM_MACOS + switch ctxt.HeadType { case objabi.Hdarwin: - if machoPlatform == PLATFORM_MACOS { + if combineDwarf { + // Leave room for DWARF combining. // -headerpad is incompatible with -fembed-bitcode. argv = append(argv, "-Wl,-headerpad,1144") } if ctxt.DynlinkingGo() && !ctxt.Arch.InFamily(sys.ARM, sys.ARM64) { argv = append(argv, "-Wl,-flat_namespace") } + if !combineDwarf { + argv = append(argv, "-Wl,-S") // suppress STAB (symbolic debugging) symbols + } case objabi.Hopenbsd: argv = append(argv, "-Wl,-nopie") case objabi.Hwindows: @@ -1288,7 +1288,7 @@ func (ctxt *Link) hostlink() { switch ctxt.BuildMode { case BuildModeExe: if ctxt.HeadType == objabi.Hdarwin { - if machoPlatform == PLATFORM_MACOS { + if machoPlatform == PLATFORM_MACOS && ctxt.IsAMD64() { argv = append(argv, "-Wl,-no_pie") argv = append(argv, "-Wl,-pagezero_size,4000000") } @@ -1525,7 +1525,7 @@ func (ctxt *Link) hostlink() { // does not work, the resulting programs will not run. See // issue #17847. To avoid this problem pass -no-pie to the // toolchain if it is supported. - if ctxt.BuildMode == BuildModeExe && !ctxt.linkShared { + if ctxt.BuildMode == BuildModeExe && !ctxt.linkShared && !(ctxt.IsDarwin() && ctxt.IsARM64()) { // GCC uses -no-pie, clang uses -nopie. for _, nopie := range []string{"-no-pie", "-nopie"} { if linkerFlagSupported(argv[0], altLinker, nopie) { @@ -1594,11 +1594,16 @@ func (ctxt *Link) hostlink() { ctxt.Logf("%s", out) } - if !*FlagS && !*FlagW && !debug_s && ctxt.HeadType == objabi.Hdarwin { + if combineDwarf { dsym := filepath.Join(*flagTmpdir, "go.dwarf") if out, err := exec.Command("dsymutil", "-f", *flagOutfile, "-o", dsym).CombinedOutput(); err != nil { Exitf("%s: running dsymutil failed: %v\n%s", os.Args[0], err, out) } + // Remove STAB (symbolic debugging) symbols after we are done with them (by dsymutil). + // They contain temporary file paths and make the build not reproducible. + if out, err := exec.Command("strip", "-S", *flagOutfile).CombinedOutput(); err != nil { + Exitf("%s: running strip failed: %v\n%s", os.Args[0], err, out) + } // Skip combining if `dsymutil` didn't generate a file. See #11994. if _, err := os.Stat(dsym); os.IsNotExist(err) { return @@ -1614,15 +1619,12 @@ func (ctxt *Link) hostlink() { if err != nil { Exitf("%s: parsing Mach-O header failed: %v", os.Args[0], err) } - // Only macOS supports unmapped segments such as our __DWARF segment. - if machoPlatform == PLATFORM_MACOS { - if err := machoCombineDwarf(ctxt, exef, exem, dsym, combinedOutput); err != nil { - Exitf("%s: combining dwarf failed: %v", os.Args[0], err) - } - os.Remove(*flagOutfile) - if err := os.Rename(combinedOutput, *flagOutfile); err != nil { - Exitf("%s: %v", os.Args[0], err) - } + if err := machoCombineDwarf(ctxt, exef, exem, dsym, combinedOutput); err != nil { + Exitf("%s: combining dwarf failed: %v", os.Args[0], err) + } + os.Remove(*flagOutfile) + if err := os.Rename(combinedOutput, *flagOutfile); err != nil { + Exitf("%s: %v", os.Args[0], err) } } } diff --git a/src/cmd/link/internal/ld/macho.go b/src/cmd/link/internal/ld/macho.go index f6356729a6..9765ce18d3 100644 --- a/src/cmd/link/internal/ld/macho.go +++ b/src/cmd/link/internal/ld/macho.go @@ -499,16 +499,7 @@ func machoadddynlib(lib string, linkmode LinkMode) { func machoshbits(ctxt *Link, mseg *MachoSeg, sect *sym.Section, segname string) { buf := "__" + strings.Replace(sect.Name[1:], ".", "_", -1) - var msect *MachoSect - if sect.Rwx&1 == 0 && segname != "__DWARF" && (ctxt.Arch.Family == sys.ARM64 || - (ctxt.Arch.Family == sys.AMD64 && ctxt.BuildMode != BuildModeExe)) { - // Darwin external linker on arm64, and on amd64 in c-shared/c-archive buildmode - // complains about absolute relocs in __TEXT, so if the section is not - // executable, put it in __DATA segment. - msect = newMachoSect(mseg, buf, "__DATA") - } else { - msect = newMachoSect(mseg, buf, segname) - } + msect := newMachoSect(mseg, buf, segname) if sect.Rellen > 0 { msect.reloc = uint32(sect.Reloff) @@ -633,13 +624,28 @@ func asmbMacho(ctxt *Link) { machoshbits(ctxt, ms, sect, "__TEXT") } + /* rodata */ + if ctxt.LinkMode != LinkExternal && Segrelrodata.Length > 0 { + ms = newMachoSeg("__DATA_CONST", 20) + ms.vaddr = Segrelrodata.Vaddr + ms.vsize = Segrelrodata.Length + ms.fileoffset = Segrelrodata.Fileoff + ms.filesize = Segrelrodata.Filelen + ms.prot1 = 3 + ms.prot2 = 3 + ms.flag = 0x10 // SG_READ_ONLY + } + + for _, sect := range Segrelrodata.Sections { + machoshbits(ctxt, ms, sect, "__DATA_CONST") + } + /* data */ if ctxt.LinkMode != LinkExternal { - w := int64(Segdata.Length) ms = newMachoSeg("__DATA", 20) - ms.vaddr = uint64(va) + uint64(v) - ms.vsize = uint64(w) - ms.fileoffset = uint64(v) + ms.vaddr = Segdata.Vaddr + ms.vsize = Segdata.Length + ms.fileoffset = Segdata.Fileoff ms.filesize = Segdata.Filelen ms.prot1 = 3 ms.prot2 = 3 @@ -695,7 +701,7 @@ func asmbMacho(ctxt *Link) { if ctxt.LinkMode != LinkExternal { ms := newMachoSeg("__LINKEDIT", 0) - ms.vaddr = uint64(va) + uint64(v) + uint64(Rnd(int64(Segdata.Length), int64(*FlagRound))) + ms.vaddr = uint64(Rnd(int64(Segdata.Vaddr+Segdata.Length), int64(*FlagRound))) ms.vsize = uint64(s1) + uint64(s2) + uint64(s3) + uint64(s4) ms.fileoffset = uint64(linkoff) ms.filesize = ms.vsize @@ -1008,7 +1014,7 @@ func doMachoLink(ctxt *Link) int64 { size := int(ldr.SymSize(s1) + ldr.SymSize(s2) + ldr.SymSize(s3) + ldr.SymSize(s4)) if size > 0 { - linkoff = Rnd(int64(uint64(HEADR)+Segtext.Length), int64(*FlagRound)) + Rnd(int64(Segdata.Filelen), int64(*FlagRound)) + Rnd(int64(Segdwarf.Filelen), int64(*FlagRound)) + linkoff = Rnd(int64(uint64(HEADR)+Segtext.Length), int64(*FlagRound)) + Rnd(int64(Segrelrodata.Filelen), int64(*FlagRound)) + Rnd(int64(Segdata.Filelen), int64(*FlagRound)) + Rnd(int64(Segdwarf.Filelen), int64(*FlagRound)) ctxt.Out.SeekSet(linkoff) ctxt.Out.Write(ldr.Data(s1)) @@ -1086,6 +1092,9 @@ func machoEmitReloc(ctxt *Link) { for _, sect := range Segtext.Sections[1:] { relocSect(ctxt, sect, ctxt.datap) } + for _, sect := range Segrelrodata.Sections { + relocSect(ctxt, sect, ctxt.datap) + } for _, sect := range Segdata.Sections { relocSect(ctxt, sect, ctxt.datap) } diff --git a/src/cmd/link/internal/ld/macho_combine_dwarf.go b/src/cmd/link/internal/ld/macho_combine_dwarf.go index 9d9f916b8e..77ee8a4d62 100644 --- a/src/cmd/link/internal/ld/macho_combine_dwarf.go +++ b/src/cmd/link/internal/ld/macho_combine_dwarf.go @@ -16,10 +16,6 @@ import ( "unsafe" ) -const ( - pageAlign = 12 // 4096 = 1 << 12 -) - type loadCmd struct { Cmd macho.LoadCmd Len uint32 @@ -138,7 +134,7 @@ func machoCombineDwarf(ctxt *Link, exef *os.File, exem *macho.File, dsym, outexe // Now copy the dwarf data into the output. // Kernel requires all loaded segments to be page-aligned in the file, // even though we mark this one as being 0 bytes of virtual address space. - dwarfstart := machoCalcStart(realdwarf.Offset, linkseg.Offset, pageAlign) + dwarfstart := Rnd(int64(linkseg.Offset), int64(*FlagRound)) if _, err := outf.Seek(dwarfstart, 0); err != nil { return err } @@ -166,7 +162,7 @@ func machoCombineDwarf(ctxt *Link, exef *os.File, exem *macho.File, dsym, outexe if _, err := exef.Seek(int64(linkseg.Offset), 0); err != nil { return err } - linkstart := machoCalcStart(linkseg.Offset, uint64(dwarfstart)+dwarfsize, pageAlign) + linkstart := Rnd(dwarfstart+int64(dwarfsize), int64(*FlagRound)) if _, err := outf.Seek(linkstart, 0); err != nil { return err } @@ -217,9 +213,9 @@ func machoCombineDwarf(ctxt *Link, exef *os.File, exem *macho.File, dsym, outexe linkoffset := uint64(linkstart) - linkseg.Offset switch cmd.Cmd { case macho.LoadCmdSegment64: - err = machoUpdateSegment(reader, linkseg, linkoffset, &macho.Segment64{}, &macho.Section64{}) + err = machoUpdateSegment(reader, linkseg, linkoffset) case macho.LoadCmdSegment: - err = machoUpdateSegment(reader, linkseg, linkoffset, &macho.Segment32{}, &macho.Section32{}) + panic("unexpected 32-bit segment") case LC_DYLD_INFO, LC_DYLD_INFO_ONLY: err = machoUpdateLoadCommand(reader, linkseg, linkoffset, &dyldInfoCmd{}, "RebaseOff", "BindOff", "WeakBindOff", "LazyBindOff", "ExportOff") case macho.LoadCmdSymtab: @@ -313,70 +309,56 @@ func machoCompressSection(sectBytes []byte) (compressed bool, contents []byte, e // machoUpdateSegment updates the load command for a moved segment. // Only the linkedit segment should move, and it should have 0 sections. -// seg should be a macho.Segment32 or macho.Segment64 as appropriate. -// sect should be a macho.Section32 or macho.Section64 as appropriate. -func machoUpdateSegment(r loadCmdReader, linkseg *macho.Segment, linkoffset uint64, seg, sect interface{}) error { - if err := r.ReadAt(0, seg); err != nil { +func machoUpdateSegment(r loadCmdReader, linkseg *macho.Segment, linkoffset uint64) error { + var seg macho.Segment64 + if err := r.ReadAt(0, &seg); err != nil { return err } - segValue := reflect.ValueOf(seg) - offset := reflect.Indirect(segValue).FieldByName("Offset") // Only the linkedit segment moved, anything before that is fine. - if offset.Uint() < linkseg.Offset { + if seg.Offset < linkseg.Offset { return nil } - offset.SetUint(offset.Uint() + linkoffset) - if err := r.WriteAt(0, seg); err != nil { + seg.Offset += linkoffset + if err := r.WriteAt(0, &seg); err != nil { return err } // There shouldn't be any sections, but just to make sure... - return machoUpdateSections(r, segValue, reflect.ValueOf(sect), linkoffset, nil) + return machoUpdateSections(r, &seg, linkoffset, nil) } -func machoUpdateSections(r loadCmdReader, seg, sect reflect.Value, deltaOffset uint64, compressedSects []*macho.Section) error { - iseg := reflect.Indirect(seg) - nsect := iseg.FieldByName("Nsect").Uint() +func machoUpdateSections(r loadCmdReader, seg *macho.Segment64, deltaOffset uint64, compressedSects []*macho.Section) error { + nsect := seg.Nsect if nsect == 0 { return nil } - sectOffset := int64(iseg.Type().Size()) - - isect := reflect.Indirect(sect) - offsetField := isect.FieldByName("Offset") - reloffField := isect.FieldByName("Reloff") - addrField := isect.FieldByName("Addr") - nameField := isect.FieldByName("Name") - sizeField := isect.FieldByName("Size") - sectSize := int64(isect.Type().Size()) - for i := uint64(0); i < nsect; i++ { - if err := r.ReadAt(sectOffset, sect.Interface()); err != nil { + sectOffset := int64(unsafe.Sizeof(*seg)) + + var sect macho.Section64 + sectSize := int64(unsafe.Sizeof(sect)) + for i := uint32(0); i < nsect; i++ { + if err := r.ReadAt(sectOffset, §); err != nil { return err } if compressedSects != nil { cSect := compressedSects[i] - var name [16]byte - copy(name[:], []byte(cSect.Name)) - nameField.Set(reflect.ValueOf(name)) - sizeField.SetUint(cSect.Size) + copy(sect.Name[:], cSect.Name) + sect.Size = cSect.Size if cSect.Offset != 0 { - offsetField.SetUint(uint64(cSect.Offset) + deltaOffset) + sect.Offset = cSect.Offset + uint32(deltaOffset) } if cSect.Addr != 0 { - addrField.SetUint(cSect.Addr) + sect.Addr = cSect.Addr } } else { - if offsetField.Uint() != 0 { - offsetField.SetUint(offsetField.Uint() + deltaOffset) - } - if reloffField.Uint() != 0 { - reloffField.SetUint(reloffField.Uint() + deltaOffset) + if sect.Offset != 0 { + sect.Offset += uint32(deltaOffset) } - if addrField.Uint() != 0 { - addrField.SetUint(addrField.Uint()) + if sect.Reloff != 0 { + sect.Reloff += uint32(deltaOffset) } } - if err := r.WriteAt(sectOffset, sect.Interface()); err != nil { + if err := r.WriteAt(sectOffset, §); err != nil { return err } sectOffset += sectSize @@ -386,32 +368,27 @@ func machoUpdateSections(r loadCmdReader, seg, sect reflect.Value, deltaOffset u // machoUpdateDwarfHeader updates the DWARF segment load command. func machoUpdateDwarfHeader(r *loadCmdReader, compressedSects []*macho.Section, dwarfsize uint64, dwarfstart int64, realdwarf *macho.Segment) error { - var seg, sect interface{} cmd, err := r.Next() if err != nil { return err } - if cmd.Cmd == macho.LoadCmdSegment64 { - seg = new(macho.Segment64) - sect = new(macho.Section64) - } else { - seg = new(macho.Segment32) - sect = new(macho.Section32) + if cmd.Cmd != macho.LoadCmdSegment64 { + panic("not a Segment64") } - if err := r.ReadAt(0, seg); err != nil { + var seg macho.Segment64 + if err := r.ReadAt(0, &seg); err != nil { return err } - segv := reflect.ValueOf(seg).Elem() - segv.FieldByName("Offset").SetUint(uint64(dwarfstart)) + seg.Offset = uint64(dwarfstart) if compressedSects != nil { var segSize uint64 for _, newSect := range compressedSects { segSize += newSect.Size } - segv.FieldByName("Filesz").SetUint(segSize) + seg.Filesz = segSize } else { - segv.FieldByName("Filesz").SetUint(dwarfsize) + seg.Filesz = dwarfsize } // We want the DWARF segment to be considered non-loadable, so @@ -424,14 +401,14 @@ func machoUpdateDwarfHeader(r *loadCmdReader, compressedSects []*macho.Section, // in ImageLoaderMachO.cpp (various versions can be found online, see // https://opensource.apple.com/source/dyld/dyld-519.2.2/src/ImageLoaderMachO.cpp.auto.html // as one example). - segv.FieldByName("Addr").SetUint(0) - segv.FieldByName("Memsz").SetUint(0) - segv.FieldByName("Prot").SetUint(0) + seg.Addr = 0 + seg.Memsz = 0 + seg.Prot = 0 - if err := r.WriteAt(0, seg); err != nil { + if err := r.WriteAt(0, &seg); err != nil { return err } - return machoUpdateSections(*r, segv, reflect.ValueOf(sect), uint64(dwarfstart)-realdwarf.Offset, compressedSects) + return machoUpdateSections(*r, &seg, uint64(dwarfstart)-realdwarf.Offset, compressedSects) } func machoUpdateLoadCommand(r loadCmdReader, linkseg *macho.Segment, linkoffset uint64, cmd interface{}, fields ...string) error { @@ -451,12 +428,3 @@ func machoUpdateLoadCommand(r loadCmdReader, linkseg *macho.Segment, linkoffset } return nil } - -func machoCalcStart(origAddr, newAddr uint64, alignExp uint32) int64 { - align := uint64(1 << alignExp) - origMod, newMod := origAddr%align, newAddr%align - if origMod == newMod { - return int64(newAddr) - } - return int64(newAddr + align + origMod - newMod) -} diff --git a/src/cmd/link/internal/ld/symtab.go b/src/cmd/link/internal/ld/symtab.go index bc880955b8..56363cdaae 100644 --- a/src/cmd/link/internal/ld/symtab.go +++ b/src/cmd/link/internal/ld/symtab.go @@ -681,8 +681,8 @@ func (ctxt *Link) symtab(pcln *pclntab) []sym.SymKind { itablinkSym := ldr.Lookup("runtime.itablink", 0) nitablinks := uint64(ldr.SymSize(itablinkSym)) / uint64(ctxt.Arch.PtrSize) moduledata.AddAddr(ctxt.Arch, itablinkSym) - moduledata.AddUint(ctxt.Arch, uint64(nitablinks)) - moduledata.AddUint(ctxt.Arch, uint64(nitablinks)) + moduledata.AddUint(ctxt.Arch, nitablinks) + moduledata.AddUint(ctxt.Arch, nitablinks) // The ptab slice if ptab := ldr.Lookup("go.plugin.tabs", 0); ptab != 0 && ldr.AttrReachable(ptab) { ldr.SetAttrLocal(ptab, true) diff --git a/src/cmd/link/internal/ld/target.go b/src/cmd/link/internal/ld/target.go index 102b6c5436..f68de8fff1 100644 --- a/src/cmd/link/internal/ld/target.go +++ b/src/cmd/link/internal/ld/target.go @@ -74,8 +74,12 @@ func (t *Target) IsDynlinkingGo() bool { func (t *Target) UseRelro() bool { switch t.BuildMode { case BuildModeCArchive, BuildModeCShared, BuildModeShared, BuildModePIE, BuildModePlugin: - return t.IsELF || t.HeadType == objabi.Haix + return t.IsELF || t.HeadType == objabi.Haix || t.HeadType == objabi.Hdarwin default: + if t.HeadType == objabi.Hdarwin && t.IsARM64() { + // On darwin/ARM64, everything is PIE. + return true + } return t.linkShared || (t.HeadType == objabi.Haix && t.LinkMode == LinkExternal) } } diff --git a/src/cmd/link/internal/loader/loader.go b/src/cmd/link/internal/loader/loader.go index 8fd10b0848..43a0352e0b 100644 --- a/src/cmd/link/internal/loader/loader.go +++ b/src/cmd/link/internal/loader/loader.go @@ -93,11 +93,12 @@ type oReader struct { version int // version of static symbol flags uint32 // read from object file pkgprefix string - syms []Sym // Sym's global index, indexed by local index - ndef int // cache goobj.Reader.NSym() - nhashed64def int // cache goobj.Reader.NHashed64Def() - nhasheddef int // cache goobj.Reader.NHashedDef() - objidx uint32 // index of this reader in the objs slice + syms []Sym // Sym's global index, indexed by local index + pkg []uint32 // indices of referenced package by PkgIdx (index into loader.objs array) + ndef int // cache goobj.Reader.NSym() + nhashed64def int // cache goobj.Reader.NHashed64Def() + nhasheddef int // cache goobj.Reader.NHashedDef() + objidx uint32 // index of this reader in the objs slice } // Total number of defined symbols (package symbols, hashed symbols, and @@ -219,7 +220,7 @@ type Loader struct { deferReturnTramp map[Sym]bool // whether the symbol is a trampoline of a deferreturn call - objByPkg map[string]*oReader // map package path to its Go object reader + objByPkg map[string]uint32 // map package path to the index of its Go object reader anonVersion int // most recently assigned ext static sym pseudo-version @@ -331,7 +332,7 @@ func NewLoader(flags uint32, elfsetstring elfsetstringFunc, reporter *ErrorRepor objSyms: make([]objSym, 1, 100000), // reserve index 0 for nil symbol extReader: extReader, symsByName: [2]map[string]Sym{make(map[string]Sym, 80000), make(map[string]Sym, 50000)}, // preallocate ~2MB for ABI0 and ~1MB for ABI1 symbols - objByPkg: make(map[string]*oReader), + objByPkg: make(map[string]uint32), outer: make(map[Sym]Sym), sub: make(map[Sym]Sym), dynimplib: make(map[Sym]string), @@ -370,7 +371,7 @@ func (l *Loader) addObj(pkg string, r *oReader) Sym { } pkg = objabi.PathToPrefix(pkg) // the object file contains escaped package path if _, ok := l.objByPkg[pkg]; !ok { - l.objByPkg[pkg] = r + l.objByPkg[pkg] = r.objidx } i := Sym(len(l.objSyms)) l.start[r] = i @@ -635,12 +636,7 @@ func (l *Loader) resolve(r *oReader, s goobj.SymRef) Sym { case goobj.PkgIdxSelf: rr = r default: - pkg := r.Pkg(int(p)) - var ok bool - rr, ok = l.objByPkg[pkg] - if !ok { - log.Fatalf("reference of nonexisted package %s, from %v", pkg, r.unit.Lib) - } + rr = l.objs[r.pkg[p]].r } return l.toGlobal(rr, s.SymIdx) } @@ -2195,6 +2191,18 @@ func loadObjRefs(l *Loader, r *oReader, arch *sys.Arch) { } } + // referenced packages + npkg := r.NPkg() + r.pkg = make([]uint32, npkg) + for i := 1; i < npkg; i++ { // PkgIdx 0 is a dummy invalid package + pkg := r.Pkg(i) + objidx, ok := l.objByPkg[pkg] + if !ok { + log.Fatalf("reference of nonexisted package %s, from %v", pkg, r.unit.Lib) + } + r.pkg[i] = objidx + } + // load flags of package refs for i, n := 0, r.NRefFlags(); i < n; i++ { rf := r.RefFlags(i) diff --git a/src/cmd/link/internal/sym/symkind.go b/src/cmd/link/internal/sym/symkind.go index 3e47d9a8e4..c176d5e208 100644 --- a/src/cmd/link/internal/sym/symkind.go +++ b/src/cmd/link/internal/sym/symkind.go @@ -41,6 +41,7 @@ const ( Sxxx SymKind = iota STEXT SELFRXSECT + SMACHOPLT // Read-only sections. STYPE @@ -52,7 +53,6 @@ const ( SFUNCTAB SELFROSECT - SMACHOPLT // Read-only sections with relocations. // diff --git a/src/cmd/link/internal/sym/symkind_string.go b/src/cmd/link/internal/sym/symkind_string.go index 47b2406e28..34cb314bd5 100644 --- a/src/cmd/link/internal/sym/symkind_string.go +++ b/src/cmd/link/internal/sym/symkind_string.go @@ -1,4 +1,4 @@ -// Code generated by "stringer -type=SymKindstringer -type=SymKind"; DO NOT EDIT. +// Code generated by "stringer -type=SymKind"; DO NOT EDIT. package sym @@ -11,15 +11,15 @@ func _() { _ = x[Sxxx-0] _ = x[STEXT-1] _ = x[SELFRXSECT-2] - _ = x[STYPE-3] - _ = x[SSTRING-4] - _ = x[SGOSTRING-5] - _ = x[SGOFUNC-6] - _ = x[SGCBITS-7] - _ = x[SRODATA-8] - _ = x[SFUNCTAB-9] - _ = x[SELFROSECT-10] - _ = x[SMACHOPLT-11] + _ = x[SMACHOPLT-3] + _ = x[STYPE-4] + _ = x[SSTRING-5] + _ = x[SGOSTRING-6] + _ = x[SGOFUNC-7] + _ = x[SGCBITS-8] + _ = x[SRODATA-9] + _ = x[SFUNCTAB-10] + _ = x[SELFROSECT-11] _ = x[STYPERELRO-12] _ = x[SSTRINGRELRO-13] _ = x[SGOSTRINGRELRO-14] @@ -68,9 +68,9 @@ func _() { _ = x[SABIALIAS-57] } -const _SymKind_name = "SxxxSTEXTSELFRXSECTSTYPESSTRINGSGOSTRINGSGOFUNCSGCBITSSRODATASFUNCTABSELFROSECTSMACHOPLTSTYPERELROSSTRINGRELROSGOSTRINGRELROSGOFUNCRELROSGCBITSRELROSRODATARELROSFUNCTABRELROSTYPELINKSITABLINKSSYMTABSPCLNTABSFirstWritableSBUILDINFOSELFSECTSMACHOSMACHOGOTSWINDOWSSELFGOTSNOPTRDATASINITARRSDATASXCOFFTOCSBSSSNOPTRBSSSLIBFUZZER_EXTRA_COUNTERSTLSBSSSXREFSMACHOSYMSTRSMACHOSYMTABSMACHOINDIRECTPLTSMACHOINDIRECTGOTSFILEPATHSDYNIMPORTSHOSTOBJSUNDEFEXTSDWARFSECTSDWARFCUINFOSDWARFCONSTSDWARFFCNSDWARFABSFCNSDWARFTYPESDWARFVARSDWARFRANGESDWARFLOCSDWARFLINESSABIALIAS" +const _SymKind_name = "SxxxSTEXTSELFRXSECTSMACHOPLTSTYPESSTRINGSGOSTRINGSGOFUNCSGCBITSSRODATASFUNCTABSELFROSECTSTYPERELROSSTRINGRELROSGOSTRINGRELROSGOFUNCRELROSGCBITSRELROSRODATARELROSFUNCTABRELROSTYPELINKSITABLINKSSYMTABSPCLNTABSFirstWritableSBUILDINFOSELFSECTSMACHOSMACHOGOTSWINDOWSSELFGOTSNOPTRDATASINITARRSDATASXCOFFTOCSBSSSNOPTRBSSSLIBFUZZER_EXTRA_COUNTERSTLSBSSSXREFSMACHOSYMSTRSMACHOSYMTABSMACHOINDIRECTPLTSMACHOINDIRECTGOTSFILEPATHSDYNIMPORTSHOSTOBJSUNDEFEXTSDWARFSECTSDWARFCUINFOSDWARFCONSTSDWARFFCNSDWARFABSFCNSDWARFTYPESDWARFVARSDWARFRANGESDWARFLOCSDWARFLINESSABIALIAS" -var _SymKind_index = [...]uint16{0, 4, 9, 19, 24, 31, 40, 47, 54, 61, 69, 79, 88, 98, 110, 124, 136, 148, 160, 173, 182, 191, 198, 206, 220, 230, 238, 244, 253, 261, 268, 278, 286, 291, 300, 304, 313, 337, 344, 349, 361, 373, 390, 407, 416, 426, 434, 443, 453, 465, 476, 485, 497, 507, 516, 527, 536, 547, 556} +var _SymKind_index = [...]uint16{0, 4, 9, 19, 28, 33, 40, 49, 56, 63, 70, 78, 88, 98, 110, 124, 136, 148, 160, 173, 182, 191, 198, 206, 220, 230, 238, 244, 253, 261, 268, 278, 286, 291, 300, 304, 313, 337, 344, 349, 361, 373, 390, 407, 416, 426, 434, 443, 453, 465, 476, 485, 497, 507, 516, 527, 536, 547, 556} func (i SymKind) String() string { if i >= SymKind(len(_SymKind_index)-1) { diff --git a/src/cmd/link/link_test.go b/src/cmd/link/link_test.go index 3b5efdf7a3..4e60996d8e 100644 --- a/src/cmd/link/link_test.go +++ b/src/cmd/link/link_test.go @@ -1,3 +1,7 @@ +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + package main import ( @@ -455,9 +459,7 @@ func TestIssue34788Android386TLSSequence(t *testing.T) { cmd := exec.Command(testenv.GoToolPath(t), "tool", "compile", "-o", obj, src) cmd.Env = append(os.Environ(), "GOARCH=386", "GOOS=android") if out, err := cmd.CombinedOutput(); err != nil { - if err != nil { - t.Fatalf("failed to compile blah.go: %v, output: %s\n", err, out) - } + t.Fatalf("failed to compile blah.go: %v, output: %s\n", err, out) } // Run objdump on the resulting object. @@ -798,3 +800,17 @@ func TestContentAddressableSymbols(t *testing.T) { t.Errorf("command %s failed: %v\n%s", cmd, err, out) } } + +func TestReadOnly(t *testing.T) { + // Test that read-only data is indeed read-only. + testenv.MustHaveGoBuild(t) + + t.Parallel() + + src := filepath.Join("testdata", "testRO", "x.go") + cmd := exec.Command(testenv.GoToolPath(t), "run", src) + out, err := cmd.CombinedOutput() + if err == nil { + t.Errorf("running test program did not fail. output:\n%s", out) + } +} diff --git a/src/cmd/link/testdata/testRO/x.go b/src/cmd/link/testdata/testRO/x.go new file mode 100644 index 0000000000..d77db6d563 --- /dev/null +++ b/src/cmd/link/testdata/testRO/x.go @@ -0,0 +1,22 @@ +// Copyright 2020 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Test that read-only data is indeed read-only. This +// program attempts to modify read-only data, and it +// should fail. + +package main + +import "unsafe" + +var s = "hello" + +func main() { + println(s) + *(*struct { + p *byte + l int + })(unsafe.Pointer(&s)).p = 'H' + println(s) +} diff --git a/src/cmd/vendor/golang.org/x/mod/modfile/read.go b/src/cmd/vendor/golang.org/x/mod/modfile/read.go index c1f2008ee4..2a961ca81c 100644 --- a/src/cmd/vendor/golang.org/x/mod/modfile/read.go +++ b/src/cmd/vendor/golang.org/x/mod/modfile/read.go @@ -477,9 +477,17 @@ func (in *input) startToken() { // endToken marks the end of an input token. // It records the actual token string in tok.text. +// A single trailing newline (LF or CRLF) will be removed from comment tokens. func (in *input) endToken(kind tokenKind) { in.token.kind = kind text := string(in.tokenStart[:len(in.tokenStart)-len(in.remaining)]) + if kind.isComment() { + if strings.HasSuffix(text, "\r\n") { + text = text[:len(text)-2] + } else { + text = strings.TrimSuffix(text, "\n") + } + } in.token.text = text in.token.endPos = in.pos } diff --git a/src/cmd/vendor/golang.org/x/mod/modfile/rule.go b/src/cmd/vendor/golang.org/x/mod/modfile/rule.go index 91ca6828df..83398dda5d 100644 --- a/src/cmd/vendor/golang.org/x/mod/modfile/rule.go +++ b/src/cmd/vendor/golang.org/x/mod/modfile/rule.go @@ -30,6 +30,7 @@ import ( "golang.org/x/mod/internal/lazyregexp" "golang.org/x/mod/module" + "golang.org/x/mod/semver" ) // A File is the parsed, interpreted form of a go.mod file. @@ -39,6 +40,7 @@ type File struct { Require []*Require Exclude []*Exclude Replace []*Replace + Retract []*Retract Syntax *FileSyntax } @@ -75,6 +77,21 @@ type Replace struct { Syntax *Line } +// A Retract is a single retract statement. +type Retract struct { + VersionInterval + Rationale string + Syntax *Line +} + +// A VersionInterval represents a range of versions with upper and lower bounds. +// Intervals are closed: both bounds are included. When Low is equal to High, +// the interval may refer to a single version ('v1.2.3') or an interval +// ('[v1.2.3, v1.2.3]'); both have the same representation. +type VersionInterval struct { + Low, High string +} + func (f *File) AddModuleStmt(path string) error { if f.Syntax == nil { f.Syntax = new(FileSyntax) @@ -138,7 +155,7 @@ func parseToFile(file string, data []byte, fix VersionFixer, strict bool) (*File for _, x := range fs.Stmt { switch x := x.(type) { case *Line: - f.add(&errs, x, x.Token[0], x.Token[1:], fix, strict) + f.add(&errs, nil, x, x.Token[0], x.Token[1:], fix, strict) case *LineBlock: if len(x.Token) > 1 { @@ -161,9 +178,9 @@ func parseToFile(file string, data []byte, fix VersionFixer, strict bool) (*File }) } continue - case "module", "require", "exclude", "replace": + case "module", "require", "exclude", "replace", "retract": for _, l := range x.Line { - f.add(&errs, l, x.Token[0], l.Token, fix, strict) + f.add(&errs, x, l, x.Token[0], l.Token, fix, strict) } } } @@ -177,7 +194,7 @@ func parseToFile(file string, data []byte, fix VersionFixer, strict bool) (*File var GoVersionRE = lazyregexp.New(`^([1-9][0-9]*)\.(0|[1-9][0-9]*)$`) -func (f *File) add(errs *ErrorList, line *Line, verb string, args []string, fix VersionFixer, strict bool) { +func (f *File) add(errs *ErrorList, block *LineBlock, line *Line, verb string, args []string, fix VersionFixer, strict bool) { // If strict is false, this module is a dependency. // We ignore all unknown directives as well as main-module-only // directives like replace and exclude. It will work better for @@ -186,7 +203,7 @@ func (f *File) add(errs *ErrorList, line *Line, verb string, args []string, fix // and simply ignore those statements. if !strict { switch verb { - case "module", "require", "go": + case "go", "module", "retract", "require": // want these even for dependency go.mods default: return @@ -232,6 +249,7 @@ func (f *File) add(errs *ErrorList, line *Line, verb string, args []string, fix f.Go = &Go{Syntax: line} f.Go.Version = args[0] + case "module": if f.Module != nil { errorf("repeated module statement") @@ -248,6 +266,7 @@ func (f *File) add(errs *ErrorList, line *Line, verb string, args []string, fix return } f.Module.Mod = module.Version{Path: s} + case "require", "exclude": if len(args) != 2 { errorf("usage: %s module/path v1.2.3", verb) @@ -284,6 +303,7 @@ func (f *File) add(errs *ErrorList, line *Line, verb string, args []string, fix Syntax: line, }) } + case "replace": arrow := 2 if len(args) >= 2 && args[1] == "=>" { @@ -347,6 +367,33 @@ func (f *File) add(errs *ErrorList, line *Line, verb string, args []string, fix New: module.Version{Path: ns, Version: nv}, Syntax: line, }) + + case "retract": + rationale := parseRetractRationale(block, line) + vi, err := parseVersionInterval(verb, &args, fix) + if err != nil { + if strict { + wrapError(err) + return + } else { + // Only report errors parsing intervals in the main module. We may + // support additional syntax in the future, such as open and half-open + // intervals. Those can't be supported now, because they break the + // go.mod parser, even in lax mode. + return + } + } + if len(args) > 0 && strict { + // In the future, there may be additional information after the version. + errorf("unexpected token after version: %q", args[0]) + return + } + retract := &Retract{ + VersionInterval: vi, + Rationale: rationale, + Syntax: line, + } + f.Retract = append(f.Retract, retract) } } @@ -444,6 +491,53 @@ func AutoQuote(s string) string { return s } +func parseVersionInterval(verb string, args *[]string, fix VersionFixer) (VersionInterval, error) { + toks := *args + if len(toks) == 0 || toks[0] == "(" { + return VersionInterval{}, fmt.Errorf("expected '[' or version") + } + if toks[0] != "[" { + v, err := parseVersion(verb, "", &toks[0], fix) + if err != nil { + return VersionInterval{}, err + } + *args = toks[1:] + return VersionInterval{Low: v, High: v}, nil + } + toks = toks[1:] + + if len(toks) == 0 { + return VersionInterval{}, fmt.Errorf("expected version after '['") + } + low, err := parseVersion(verb, "", &toks[0], fix) + if err != nil { + return VersionInterval{}, err + } + toks = toks[1:] + + if len(toks) == 0 || toks[0] != "," { + return VersionInterval{}, fmt.Errorf("expected ',' after version") + } + toks = toks[1:] + + if len(toks) == 0 { + return VersionInterval{}, fmt.Errorf("expected version after ','") + } + high, err := parseVersion(verb, "", &toks[0], fix) + if err != nil { + return VersionInterval{}, err + } + toks = toks[1:] + + if len(toks) == 0 || toks[0] != "]" { + return VersionInterval{}, fmt.Errorf("expected ']' after version") + } + toks = toks[1:] + + *args = toks + return VersionInterval{Low: low, High: high}, nil +} + func parseString(s *string) (string, error) { t := *s if strings.HasPrefix(t, `"`) { @@ -461,6 +555,27 @@ func parseString(s *string) (string, error) { return t, nil } +// parseRetractRationale extracts the rationale for a retract directive from the +// surrounding comments. If the line does not have comments and is part of a +// block that does have comments, the block's comments are used. +func parseRetractRationale(block *LineBlock, line *Line) string { + comments := line.Comment() + if block != nil && len(comments.Before) == 0 && len(comments.Suffix) == 0 { + comments = block.Comment() + } + groups := [][]Comment{comments.Before, comments.Suffix} + var lines []string + for _, g := range groups { + for _, c := range g { + if !strings.HasPrefix(c.Token, "//") { + continue // blank line + } + lines = append(lines, strings.TrimSpace(strings.TrimPrefix(c.Token, "//"))) + } + } + return strings.Join(lines, "\n") +} + type ErrorList []Error func (e ErrorList) Error() string { @@ -494,6 +609,8 @@ func (e *Error) Error() string { var directive string if e.ModPath != "" { directive = fmt.Sprintf("%s %s: ", e.Verb, e.ModPath) + } else if e.Verb != "" { + directive = fmt.Sprintf("%s: ", e.Verb) } return pos + directive + e.Err.Error() @@ -585,6 +702,15 @@ func (f *File) Cleanup() { } f.Replace = f.Replace[:w] + w = 0 + for _, r := range f.Retract { + if r.Low != "" || r.High != "" { + f.Retract[w] = r + w++ + } + } + f.Retract = f.Retract[:w] + f.Syntax.Cleanup() } @@ -778,6 +904,34 @@ func (f *File) DropReplace(oldPath, oldVers string) error { return nil } +func (f *File) AddRetract(vi VersionInterval, rationale string) error { + r := &Retract{ + VersionInterval: vi, + } + if vi.Low == vi.High { + r.Syntax = f.Syntax.addLine(nil, "retract", AutoQuote(vi.Low)) + } else { + r.Syntax = f.Syntax.addLine(nil, "retract", "[", AutoQuote(vi.Low), ",", AutoQuote(vi.High), "]") + } + if rationale != "" { + for _, line := range strings.Split(rationale, "\n") { + com := Comment{Token: "// " + line} + r.Syntax.Comment().Before = append(r.Syntax.Comment().Before, com) + } + } + return nil +} + +func (f *File) DropRetract(vi VersionInterval) error { + for _, r := range f.Retract { + if r.VersionInterval == vi { + f.Syntax.removeLine(r.Syntax) + *r = Retract{} + } + } + return nil +} + func (f *File) SortBlocks() { f.removeDups() // otherwise sorting is unsafe @@ -786,28 +940,38 @@ func (f *File) SortBlocks() { if !ok { continue } - sort.Slice(block.Line, func(i, j int) bool { - li := block.Line[i] - lj := block.Line[j] - for k := 0; k < len(li.Token) && k < len(lj.Token); k++ { - if li.Token[k] != lj.Token[k] { - return li.Token[k] < lj.Token[k] - } - } - return len(li.Token) < len(lj.Token) + less := lineLess + if block.Token[0] == "retract" { + less = lineRetractLess + } + sort.SliceStable(block.Line, func(i, j int) bool { + return less(block.Line[i], block.Line[j]) }) } } +// removeDups removes duplicate exclude and replace directives. +// +// Earlier exclude directives take priority. +// +// Later replace directives take priority. +// +// require directives are not de-duplicated. That's left up to higher-level +// logic (MVS). +// +// retract directives are not de-duplicated since comments are +// meaningful, and versions may be retracted multiple times. func (f *File) removeDups() { - have := make(map[module.Version]bool) kill := make(map[*Line]bool) + + // Remove duplicate excludes. + haveExclude := make(map[module.Version]bool) for _, x := range f.Exclude { - if have[x.Mod] { + if haveExclude[x.Mod] { kill[x.Syntax] = true continue } - have[x.Mod] = true + haveExclude[x.Mod] = true } var excl []*Exclude for _, x := range f.Exclude { @@ -817,15 +981,16 @@ func (f *File) removeDups() { } f.Exclude = excl - have = make(map[module.Version]bool) + // Remove duplicate replacements. // Later replacements take priority over earlier ones. + haveReplace := make(map[module.Version]bool) for i := len(f.Replace) - 1; i >= 0; i-- { x := f.Replace[i] - if have[x.Old] { + if haveReplace[x.Old] { kill[x.Syntax] = true continue } - have[x.Old] = true + haveReplace[x.Old] = true } var repl []*Replace for _, x := range f.Replace { @@ -835,6 +1000,9 @@ func (f *File) removeDups() { } f.Replace = repl + // Duplicate require and retract directives are not removed. + + // Drop killed statements from the syntax tree. var stmts []Expr for _, stmt := range f.Syntax.Stmt { switch stmt := stmt.(type) { @@ -858,3 +1026,38 @@ func (f *File) removeDups() { } f.Syntax.Stmt = stmts } + +// lineLess returns whether li should be sorted before lj. It sorts +// lexicographically without assigning any special meaning to tokens. +func lineLess(li, lj *Line) bool { + for k := 0; k < len(li.Token) && k < len(lj.Token); k++ { + if li.Token[k] != lj.Token[k] { + return li.Token[k] < lj.Token[k] + } + } + return len(li.Token) < len(lj.Token) +} + +// lineRetractLess returns whether li should be sorted before lj for lines in +// a "retract" block. It treats each line as a version interval. Single versions +// are compared as if they were intervals with the same low and high version. +// Intervals are sorted in descending order, first by low version, then by +// high version, using semver.Compare. +func lineRetractLess(li, lj *Line) bool { + interval := func(l *Line) VersionInterval { + if len(l.Token) == 1 { + return VersionInterval{Low: l.Token[0], High: l.Token[0]} + } else if len(l.Token) == 5 && l.Token[0] == "[" && l.Token[2] == "," && l.Token[4] == "]" { + return VersionInterval{Low: l.Token[1], High: l.Token[3]} + } else { + // Line in unknown format. Treat as an invalid version. + return VersionInterval{} + } + } + vii := interval(li) + vij := interval(lj) + if cmp := semver.Compare(vii.Low, vij.Low); cmp != 0 { + return cmp > 0 + } + return semver.Compare(vii.High, vij.High) > 0 +} diff --git a/src/cmd/vendor/golang.org/x/mod/module/module.go b/src/cmd/vendor/golang.org/x/mod/module/module.go index 3a8b080c7b..c1c5263c42 100644 --- a/src/cmd/vendor/golang.org/x/mod/module/module.go +++ b/src/cmd/vendor/golang.org/x/mod/module/module.go @@ -225,13 +225,13 @@ func firstPathOK(r rune) bool { } // pathOK reports whether r can appear in an import path element. -// Paths can be ASCII letters, ASCII digits, and limited ASCII punctuation: + - . _ and ~. +// Paths can be ASCII letters, ASCII digits, and limited ASCII punctuation: - . _ and ~. // This matches what "go get" has historically recognized in import paths. // TODO(rsc): We would like to allow Unicode letters, but that requires additional // care in the safe encoding (see "escaped paths" above). func pathOK(r rune) bool { if r < utf8.RuneSelf { - return r == '+' || r == '-' || r == '.' || r == '_' || r == '~' || + return r == '-' || r == '.' || r == '_' || r == '~' || '0' <= r && r <= '9' || 'A' <= r && r <= 'Z' || 'a' <= r && r <= 'z' @@ -314,11 +314,13 @@ func CheckPath(path string) error { // separated by slashes (U+002F). (It must not begin with nor end in a slash.) // // A valid path element is a non-empty string made up of -// ASCII letters, ASCII digits, and limited ASCII punctuation: + - . _ and ~. +// ASCII letters, ASCII digits, and limited ASCII punctuation: - . _ and ~. // It must not begin or end with a dot (U+002E), nor contain two dots in a row. // // The element prefix up to the first dot must not be a reserved file name -// on Windows, regardless of case (CON, com1, NuL, and so on). +// on Windows, regardless of case (CON, com1, NuL, and so on). The element +// must not have a suffix of a tilde followed by one or more ASCII digits +// (to exclude paths elements that look like Windows short-names). // // CheckImportPath may be less restrictive in the future, but see the // top-level package documentation for additional information about @@ -403,6 +405,29 @@ func checkElem(elem string, fileName bool) error { return fmt.Errorf("%q disallowed as path element component on Windows", short) } } + + if fileName { + // don't check for Windows short-names in file names. They're + // only an issue for import paths. + return nil + } + + // Reject path components that look like Windows short-names. + // Those usually end in a tilde followed by one or more ASCII digits. + if tilde := strings.LastIndexByte(short, '~'); tilde >= 0 && tilde < len(short)-1 { + suffix := short[tilde+1:] + suffixIsDigits := true + for _, r := range suffix { + if r < '0' || r > '9' { + suffixIsDigits = false + break + } + } + if suffixIsDigits { + return fmt.Errorf("trailing tilde and digits in path element") + } + } + return nil } diff --git a/src/cmd/vendor/golang.org/x/mod/zip/zip.go b/src/cmd/vendor/golang.org/x/mod/zip/zip.go index 6865895b3d..5b401ad4d8 100644 --- a/src/cmd/vendor/golang.org/x/mod/zip/zip.go +++ b/src/cmd/vendor/golang.org/x/mod/zip/zip.go @@ -48,6 +48,7 @@ package zip import ( "archive/zip" "bytes" + "errors" "fmt" "io" "io/ioutil" @@ -92,40 +93,134 @@ type File interface { Open() (io.ReadCloser, error) } -// Create builds a zip archive for module m from an abstract list of files -// and writes it to w. +// CheckedFiles reports whether a set of files satisfy the name and size +// constraints required by module zip files. The constraints are listed in the +// package documentation. // -// Create verifies the restrictions described in the package documentation -// and should not produce an archive that Unzip cannot extract. Create does not -// include files in the output archive if they don't belong in the module zip. -// In particular, Create will not include files in modules found in -// subdirectories, most files in vendor directories, or irregular files (such -// as symbolic links) in the output archive. -func Create(w io.Writer, m module.Version, files []File) (err error) { - defer func() { - if err != nil { - err = &zipError{verb: "create zip", err: err} - } - }() +// Functions that produce this report may include slightly different sets of +// files. See documentation for CheckFiles, CheckDir, and CheckZip for details. +type CheckedFiles struct { + // Valid is a list of file paths that should be included in a zip file. + Valid []string + + // Omitted is a list of files that are ignored when creating a module zip + // file, along with the reason each file is ignored. + Omitted []FileError + + // Invalid is a list of files that should not be included in a module zip + // file, along with the reason each file is invalid. + Invalid []FileError + + // SizeError is non-nil if the total uncompressed size of the valid files + // exceeds the module zip size limit or if the zip file itself exceeds the + // limit. + SizeError error +} - // Check that the version is canonical, the module path is well-formed, and - // the major version suffix matches the major version. - if vers := module.CanonicalVersion(m.Version); vers != m.Version { - return fmt.Errorf("version %q is not canonical (should be %q)", m.Version, vers) +// Err returns an error if CheckedFiles does not describe a valid module zip +// file. SizeError is returned if that field is set. A FileErrorList is returned +// if there are one or more invalid files. Other errors may be returned in the +// future. +func (cf CheckedFiles) Err() error { + if cf.SizeError != nil { + return cf.SizeError } - if err := module.Check(m.Path, m.Version); err != nil { - return err + if len(cf.Invalid) > 0 { + return FileErrorList(cf.Invalid) + } + return nil +} + +type FileErrorList []FileError + +func (el FileErrorList) Error() string { + buf := &strings.Builder{} + sep := "" + for _, e := range el { + buf.WriteString(sep) + buf.WriteString(e.Error()) + sep = "\n" + } + return buf.String() +} + +type FileError struct { + Path string + Err error +} + +func (e FileError) Error() string { + return fmt.Sprintf("%s: %s", e.Path, e.Err) +} + +func (e FileError) Unwrap() error { + return e.Err +} + +var ( + // Predefined error messages for invalid files. Not exhaustive. + errPathNotClean = errors.New("file path is not clean") + errPathNotRelative = errors.New("file path is not relative") + errGoModCase = errors.New("go.mod files must have lowercase names") + errGoModSize = fmt.Errorf("go.mod file too large (max size is %d bytes)", MaxGoMod) + errLICENSESize = fmt.Errorf("LICENSE file too large (max size is %d bytes)", MaxLICENSE) + + // Predefined error messages for omitted files. Not exhaustive. + errVCS = errors.New("directory is a version control repository") + errVendored = errors.New("file is in vendor directory") + errSubmoduleFile = errors.New("file is in another module") + errSubmoduleDir = errors.New("directory is in another module") + errHgArchivalTxt = errors.New("file is inserted by 'hg archive' and is always omitted") + errSymlink = errors.New("file is a symbolic link") + errNotRegular = errors.New("not a regular file") +) + +// CheckFiles reports whether a list of files satisfy the name and size +// constraints listed in the package documentation. The returned CheckedFiles +// record contains lists of valid, invalid, and omitted files. Every file in +// the given list will be included in exactly one of those lists. +// +// CheckFiles returns an error if the returned CheckedFiles does not describe +// a valid module zip file (according to CheckedFiles.Err). The returned +// CheckedFiles is still populated when an error is returned. +// +// Note that CheckFiles will not open any files, so Create may still fail when +// CheckFiles is successful due to I/O errors and reported size differences. +func CheckFiles(files []File) (CheckedFiles, error) { + cf, _, _ := checkFiles(files) + return cf, cf.Err() +} + +// checkFiles implements CheckFiles and also returns lists of valid files and +// their sizes, corresponding to cf.Valid. These lists are used in Crewate to +// avoid repeated calls to File.Lstat. +func checkFiles(files []File) (cf CheckedFiles, validFiles []File, validSizes []int64) { + errPaths := make(map[string]struct{}) + addError := func(path string, omitted bool, err error) { + if _, ok := errPaths[path]; ok { + return + } + errPaths[path] = struct{}{} + fe := FileError{Path: path, Err: err} + if omitted { + cf.Omitted = append(cf.Omitted, fe) + } else { + cf.Invalid = append(cf.Invalid, fe) + } } // Find directories containing go.mod files (other than the root). + // Files in these directories will be omitted. // These directories will not be included in the output zip. haveGoMod := make(map[string]bool) for _, f := range files { - dir, base := path.Split(f.Path()) + p := f.Path() + dir, base := path.Split(p) if strings.EqualFold(base, "go.mod") { info, err := f.Lstat() if err != nil { - return err + addError(p, false, err) + continue } if info.Mode().IsRegular() { haveGoMod[dir] = true @@ -146,77 +241,292 @@ func Create(w io.Writer, m module.Version, files []File) (err error) { } } - // Create the module zip file. - zw := zip.NewWriter(w) - prefix := fmt.Sprintf("%s@%s/", m.Path, m.Version) - - addFile := func(f File, path string, size int64) error { - rc, err := f.Open() - if err != nil { - return err - } - defer rc.Close() - w, err := zw.Create(prefix + path) - if err != nil { - return err - } - lr := &io.LimitedReader{R: rc, N: size + 1} - if _, err := io.Copy(w, lr); err != nil { - return err - } - if lr.N <= 0 { - return fmt.Errorf("file %q is larger than declared size", path) - } - return nil - } - collisions := make(collisionChecker) maxSize := int64(MaxZipFile) for _, f := range files { p := f.Path() if p != path.Clean(p) { - return fmt.Errorf("file path %s is not clean", p) + addError(p, false, errPathNotClean) + continue } if path.IsAbs(p) { - return fmt.Errorf("file path %s is not relative", p) + addError(p, false, errPathNotRelative) + continue + } + if isVendoredPackage(p) { + addError(p, true, errVendored) + continue } - if isVendoredPackage(p) || inSubmodule(p) { + if inSubmodule(p) { + addError(p, true, errSubmoduleFile) continue } if p == ".hg_archival.txt" { // Inserted by hg archive. // The go command drops this regardless of the VCS being used. + addError(p, true, errHgArchivalTxt) continue } if err := module.CheckFilePath(p); err != nil { - return err + addError(p, false, err) + continue } if strings.ToLower(p) == "go.mod" && p != "go.mod" { - return fmt.Errorf("found file named %s, want all lower-case go.mod", p) + addError(p, false, errGoModCase) + continue } info, err := f.Lstat() if err != nil { - return err + addError(p, false, err) + continue } if err := collisions.check(p, info.IsDir()); err != nil { - return err + addError(p, false, err) + continue } - if !info.Mode().IsRegular() { + if info.Mode()&os.ModeType == os.ModeSymlink { // Skip symbolic links (golang.org/issue/27093). + addError(p, true, errSymlink) + continue + } + if !info.Mode().IsRegular() { + addError(p, true, errNotRegular) continue } size := info.Size() - if size < 0 || maxSize < size { - return fmt.Errorf("module source tree too large (max size is %d bytes)", MaxZipFile) + if size >= 0 && size <= maxSize { + maxSize -= size + } else if cf.SizeError == nil { + cf.SizeError = fmt.Errorf("module source tree too large (max size is %d bytes)", MaxZipFile) } - maxSize -= size if p == "go.mod" && size > MaxGoMod { - return fmt.Errorf("go.mod file too large (max size is %d bytes)", MaxGoMod) + addError(p, false, errGoModSize) + continue } if p == "LICENSE" && size > MaxLICENSE { - return fmt.Errorf("LICENSE file too large (max size is %d bytes)", MaxLICENSE) + addError(p, false, errLICENSESize) + continue + } + + cf.Valid = append(cf.Valid, p) + validFiles = append(validFiles, f) + validSizes = append(validSizes, info.Size()) + } + + return cf, validFiles, validSizes +} + +// CheckDir reports whether the files in dir satisfy the name and size +// constraints listed in the package documentation. The returned CheckedFiles +// record contains lists of valid, invalid, and omitted files. If a directory is +// omitted (for example, a nested module or vendor directory), it will appear in +// the omitted list, but its files won't be listed. +// +// CheckDir returns an error if it encounters an I/O error or if the returned +// CheckedFiles does not describe a valid module zip file (according to +// CheckedFiles.Err). The returned CheckedFiles is still populated when such +// an error is returned. +// +// Note that CheckDir will not open any files, so CreateFromDir may still fail +// when CheckDir is successful due to I/O errors. +func CheckDir(dir string) (CheckedFiles, error) { + // List files (as CreateFromDir would) and check which ones are omitted + // or invalid. + files, omitted, err := listFilesInDir(dir) + if err != nil { + return CheckedFiles{}, err + } + cf, cfErr := CheckFiles(files) + _ = cfErr // ignore this error; we'll generate our own after rewriting paths. + + // Replace all paths with file system paths. + // Paths returned by CheckFiles will be slash-separated paths relative to dir. + // That's probably not appropriate for error messages. + for i := range cf.Valid { + cf.Valid[i] = filepath.Join(dir, cf.Valid[i]) + } + cf.Omitted = append(cf.Omitted, omitted...) + for i := range cf.Omitted { + cf.Omitted[i].Path = filepath.Join(dir, cf.Omitted[i].Path) + } + for i := range cf.Invalid { + cf.Invalid[i].Path = filepath.Join(dir, cf.Invalid[i].Path) + } + return cf, cf.Err() +} + +// CheckZip reports whether the files contained in a zip file satisfy the name +// and size constraints listed in the package documentation. +// +// CheckZip returns an error if the returned CheckedFiles does not describe +// a valid module zip file (according to CheckedFiles.Err). The returned +// CheckedFiles is still populated when an error is returned. CheckZip will +// also return an error if the module path or version is malformed or if it +// encounters an error reading the zip file. +// +// Note that CheckZip does not read individual files, so Unzip may still fail +// when CheckZip is successful due to I/O errors. +func CheckZip(m module.Version, zipFile string) (CheckedFiles, error) { + f, err := os.Open(zipFile) + if err != nil { + return CheckedFiles{}, err + } + defer f.Close() + _, cf, err := checkZip(m, f) + return cf, err +} + +// checkZip implements checkZip and also returns the *zip.Reader. This is +// used in Unzip to avoid redundant I/O. +func checkZip(m module.Version, f *os.File) (*zip.Reader, CheckedFiles, error) { + // Make sure the module path and version are valid. + if vers := module.CanonicalVersion(m.Version); vers != m.Version { + return nil, CheckedFiles{}, fmt.Errorf("version %q is not canonical (should be %q)", m.Version, vers) + } + if err := module.Check(m.Path, m.Version); err != nil { + return nil, CheckedFiles{}, err + } + + // Check the total file size. + info, err := f.Stat() + if err != nil { + return nil, CheckedFiles{}, err + } + zipSize := info.Size() + if zipSize > MaxZipFile { + cf := CheckedFiles{SizeError: fmt.Errorf("module zip file is too large (%d bytes; limit is %d bytes)", zipSize, MaxZipFile)} + return nil, cf, cf.Err() + } + + // Check for valid file names, collisions. + var cf CheckedFiles + addError := func(zf *zip.File, err error) { + cf.Invalid = append(cf.Invalid, FileError{Path: zf.Name, Err: err}) + } + z, err := zip.NewReader(f, zipSize) + if err != nil { + return nil, CheckedFiles{}, err + } + prefix := fmt.Sprintf("%s@%s/", m.Path, m.Version) + collisions := make(collisionChecker) + var size int64 + for _, zf := range z.File { + if !strings.HasPrefix(zf.Name, prefix) { + addError(zf, fmt.Errorf("path does not have prefix %q", prefix)) + continue } + name := zf.Name[len(prefix):] + if name == "" { + continue + } + isDir := strings.HasSuffix(name, "/") + if isDir { + name = name[:len(name)-1] + } + if path.Clean(name) != name { + addError(zf, errPathNotClean) + continue + } + if err := module.CheckFilePath(name); err != nil { + addError(zf, err) + continue + } + if err := collisions.check(name, isDir); err != nil { + addError(zf, err) + continue + } + if isDir { + continue + } + if base := path.Base(name); strings.EqualFold(base, "go.mod") { + if base != name { + addError(zf, fmt.Errorf("go.mod file not in module root directory")) + continue + } + if name != "go.mod" { + addError(zf, errGoModCase) + continue + } + } + sz := int64(zf.UncompressedSize64) + if sz >= 0 && MaxZipFile-size >= sz { + size += sz + } else if cf.SizeError == nil { + cf.SizeError = fmt.Errorf("total uncompressed size of module contents too large (max size is %d bytes)", MaxZipFile) + } + if name == "go.mod" && sz > MaxGoMod { + addError(zf, fmt.Errorf("go.mod file too large (max size is %d bytes)", MaxGoMod)) + continue + } + if name == "LICENSE" && sz > MaxLICENSE { + addError(zf, fmt.Errorf("LICENSE file too large (max size is %d bytes)", MaxLICENSE)) + continue + } + cf.Valid = append(cf.Valid, zf.Name) + } + return z, cf, cf.Err() +} + +// Create builds a zip archive for module m from an abstract list of files +// and writes it to w. +// +// Create verifies the restrictions described in the package documentation +// and should not produce an archive that Unzip cannot extract. Create does not +// include files in the output archive if they don't belong in the module zip. +// In particular, Create will not include files in modules found in +// subdirectories, most files in vendor directories, or irregular files (such +// as symbolic links) in the output archive. +func Create(w io.Writer, m module.Version, files []File) (err error) { + defer func() { + if err != nil { + err = &zipError{verb: "create zip", err: err} + } + }() + + // Check that the version is canonical, the module path is well-formed, and + // the major version suffix matches the major version. + if vers := module.CanonicalVersion(m.Version); vers != m.Version { + return fmt.Errorf("version %q is not canonical (should be %q)", m.Version, vers) + } + if err := module.Check(m.Path, m.Version); err != nil { + return err + } + + // Check whether files are valid, not valid, or should be omitted. + // Also check that the valid files don't exceed the maximum size. + cf, validFiles, validSizes := checkFiles(files) + if err := cf.Err(); err != nil { + return err + } + + // Create the module zip file. + zw := zip.NewWriter(w) + prefix := fmt.Sprintf("%s@%s/", m.Path, m.Version) + + addFile := func(f File, path string, size int64) error { + rc, err := f.Open() + if err != nil { + return err + } + defer rc.Close() + w, err := zw.Create(prefix + path) + if err != nil { + return err + } + lr := &io.LimitedReader{R: rc, N: size + 1} + if _, err := io.Copy(w, lr); err != nil { + return err + } + if lr.N <= 0 { + return fmt.Errorf("file %q is larger than declared size", path) + } + return nil + } + + for i, f := range validFiles { + p := f.Path() + size := validSizes[i] if err := addFile(f, p, size); err != nil { return err } @@ -245,61 +555,7 @@ func CreateFromDir(w io.Writer, m module.Version, dir string) (err error) { } }() - var files []File - err = filepath.Walk(dir, func(filePath string, info os.FileInfo, err error) error { - if err != nil { - return err - } - relPath, err := filepath.Rel(dir, filePath) - if err != nil { - return err - } - slashPath := filepath.ToSlash(relPath) - - if info.IsDir() { - if filePath == dir { - // Don't skip the top-level directory. - return nil - } - - // Skip VCS directories. - // fossil repos are regular files with arbitrary names, so we don't try - // to exclude them. - switch filepath.Base(filePath) { - case ".bzr", ".git", ".hg", ".svn": - return filepath.SkipDir - } - - // Skip some subdirectories inside vendor, but maintain bug - // golang.org/issue/31562, described in isVendoredPackage. - // We would like Create and CreateFromDir to produce the same result - // for a set of files, whether expressed as a directory tree or zip. - if isVendoredPackage(slashPath) { - return filepath.SkipDir - } - - // Skip submodules (directories containing go.mod files). - if goModInfo, err := os.Lstat(filepath.Join(filePath, "go.mod")); err == nil && !goModInfo.IsDir() { - return filepath.SkipDir - } - return nil - } - - if info.Mode().IsRegular() { - if !isVendoredPackage(slashPath) { - files = append(files, dirFile{ - filePath: filePath, - slashPath: slashPath, - info: info, - }) - } - return nil - } - - // Not a regular file or a directory. Probably a symbolic link. - // Irregular files are ignored, so skip it. - return nil - }) + files, _, err := listFilesInDir(dir) if err != nil { return err } @@ -356,89 +612,28 @@ func Unzip(dir string, m module.Version, zipFile string) (err error) { } }() - if vers := module.CanonicalVersion(m.Version); vers != m.Version { - return fmt.Errorf("version %q is not canonical (should be %q)", m.Version, vers) - } - if err := module.Check(m.Path, m.Version); err != nil { - return err - } - // Check that the directory is empty. Don't create it yet in case there's // an error reading the zip. - files, _ := ioutil.ReadDir(dir) - if len(files) > 0 { + if files, _ := ioutil.ReadDir(dir); len(files) > 0 { return fmt.Errorf("target directory %v exists and is not empty", dir) } - // Open the zip file and ensure it's under the size limit. + // Open the zip and check that it satisfies all restrictions. f, err := os.Open(zipFile) if err != nil { return err } defer f.Close() - info, err := f.Stat() + z, cf, err := checkZip(m, f) if err != nil { return err } - zipSize := info.Size() - if zipSize > MaxZipFile { - return fmt.Errorf("module zip file is too large (%d bytes; limit is %d bytes)", zipSize, MaxZipFile) - } - - z, err := zip.NewReader(f, zipSize) - if err != nil { + if err := cf.Err(); err != nil { return err } - // Check total size, valid file names. - collisions := make(collisionChecker) + // Unzip, enforcing sizes declared in the zip file. prefix := fmt.Sprintf("%s@%s/", m.Path, m.Version) - var size int64 - for _, zf := range z.File { - if !strings.HasPrefix(zf.Name, prefix) { - return fmt.Errorf("unexpected file name %s", zf.Name) - } - name := zf.Name[len(prefix):] - if name == "" { - continue - } - isDir := strings.HasSuffix(name, "/") - if isDir { - name = name[:len(name)-1] - } - if path.Clean(name) != name { - return fmt.Errorf("invalid file name %s", zf.Name) - } - if err := module.CheckFilePath(name); err != nil { - return err - } - if err := collisions.check(name, isDir); err != nil { - return err - } - if isDir { - continue - } - if base := path.Base(name); strings.EqualFold(base, "go.mod") { - if base != name { - return fmt.Errorf("found go.mod file not in module root directory (%s)", zf.Name) - } else if name != "go.mod" { - return fmt.Errorf("found file named %s, want all lower-case go.mod", zf.Name) - } - } - s := int64(zf.UncompressedSize64) - if s < 0 || MaxZipFile-size < s { - return fmt.Errorf("total uncompressed size of module contents too large (max size is %d bytes)", MaxZipFile) - } - size += s - if name == "go.mod" && s > MaxGoMod { - return fmt.Errorf("go.mod file too large (max size is %d bytes)", MaxGoMod) - } - if name == "LICENSE" && s > MaxLICENSE { - return fmt.Errorf("LICENSE file too large (max size is %d bytes)", MaxLICENSE) - } - } - - // Unzip, enforcing sizes checked earlier. if err := os.MkdirAll(dir, 0777); err != nil { return err } @@ -515,6 +710,72 @@ func (cc collisionChecker) check(p string, isDir bool) error { return nil } +// listFilesInDir walks the directory tree rooted at dir and returns a list of +// files, as well as a list of directories and files that were skipped (for +// example, nested modules and symbolic links). +func listFilesInDir(dir string) (files []File, omitted []FileError, err error) { + err = filepath.Walk(dir, func(filePath string, info os.FileInfo, err error) error { + if err != nil { + return err + } + relPath, err := filepath.Rel(dir, filePath) + if err != nil { + return err + } + slashPath := filepath.ToSlash(relPath) + + // Skip some subdirectories inside vendor, but maintain bug + // golang.org/issue/31562, described in isVendoredPackage. + // We would like Create and CreateFromDir to produce the same result + // for a set of files, whether expressed as a directory tree or zip. + if isVendoredPackage(slashPath) { + omitted = append(omitted, FileError{Path: slashPath, Err: errVendored}) + return nil + } + + if info.IsDir() { + if filePath == dir { + // Don't skip the top-level directory. + return nil + } + + // Skip VCS directories. + // fossil repos are regular files with arbitrary names, so we don't try + // to exclude them. + switch filepath.Base(filePath) { + case ".bzr", ".git", ".hg", ".svn": + omitted = append(omitted, FileError{Path: slashPath, Err: errVCS}) + return filepath.SkipDir + } + + // Skip submodules (directories containing go.mod files). + if goModInfo, err := os.Lstat(filepath.Join(filePath, "go.mod")); err == nil && !goModInfo.IsDir() { + omitted = append(omitted, FileError{Path: slashPath, Err: errSubmoduleDir}) + return filepath.SkipDir + } + return nil + } + + // Skip irregular files and files in vendor directories. + // Irregular files are ignored. They're typically symbolic links. + if !info.Mode().IsRegular() { + omitted = append(omitted, FileError{Path: slashPath, Err: errNotRegular}) + return nil + } + + files = append(files, dirFile{ + filePath: filePath, + slashPath: slashPath, + info: info, + }) + return nil + }) + if err != nil { + return nil, nil, err + } + return files, omitted, nil +} + type zipError struct { verb, path string err error diff --git a/src/cmd/vendor/golang.org/x/tools/go/analysis/passes/structtag/structtag.go b/src/cmd/vendor/golang.org/x/tools/go/analysis/passes/structtag/structtag.go index e09160379f..f0b15051c5 100644 --- a/src/cmd/vendor/golang.org/x/tools/go/analysis/passes/structtag/structtag.go +++ b/src/cmd/vendor/golang.org/x/tools/go/analysis/passes/structtag/structtag.go @@ -116,7 +116,11 @@ func checkCanonicalFieldTag(pass *analysis.Pass, field *types.Var, tag string, s } for _, enc := range [...]string{"json", "xml"} { - if reflect.StructTag(tag).Get(enc) != "" { + switch reflect.StructTag(tag).Get(enc) { + // Ignore warning if the field not exported and the tag is marked as + // ignored. + case "", "-": + default: pass.Reportf(field.Pos(), "struct field %s has %s tag but is not exported", field.Name(), enc) return } diff --git a/src/cmd/vendor/golang.org/x/tools/go/analysis/passes/unmarshal/unmarshal.go b/src/cmd/vendor/golang.org/x/tools/go/analysis/passes/unmarshal/unmarshal.go index f9cc993cbb..92b37caff9 100644 --- a/src/cmd/vendor/golang.org/x/tools/go/analysis/passes/unmarshal/unmarshal.go +++ b/src/cmd/vendor/golang.org/x/tools/go/analysis/passes/unmarshal/unmarshal.go @@ -30,7 +30,7 @@ var Analyzer = &analysis.Analyzer{ func run(pass *analysis.Pass) (interface{}, error) { switch pass.Pkg.Path() { - case "encoding/gob", "encoding/json", "encoding/xml": + case "encoding/gob", "encoding/json", "encoding/xml", "encoding/asn1": // These packages know how to use their own APIs. // Sometimes they are testing what happens to incorrect programs. return nil, nil @@ -53,9 +53,10 @@ func run(pass *analysis.Pass) (interface{}, error) { recv := fn.Type().(*types.Signature).Recv() if fn.Name() == "Unmarshal" && recv == nil { // "encoding/json".Unmarshal - // "encoding/xml".Unmarshal + // "encoding/xml".Unmarshal + // "encoding/asn1".Unmarshal switch fn.Pkg().Path() { - case "encoding/json", "encoding/xml": + case "encoding/json", "encoding/xml", "encoding/asn1": argidx = 1 // func([]byte, interface{}) } } else if fn.Name() == "Decode" && recv != nil { diff --git a/src/cmd/vendor/golang.org/x/tools/go/analysis/passes/unusedresult/unusedresult.go b/src/cmd/vendor/golang.org/x/tools/go/analysis/passes/unusedresult/unusedresult.go index 76d4ab2382..bececee7e9 100644 --- a/src/cmd/vendor/golang.org/x/tools/go/analysis/passes/unusedresult/unusedresult.go +++ b/src/cmd/vendor/golang.org/x/tools/go/analysis/passes/unusedresult/unusedresult.go @@ -44,7 +44,7 @@ var funcs, stringMethods stringSetFlag func init() { // TODO(adonovan): provide a comment syntax to allow users to // add their functions to this set using facts. - funcs.Set("errors.New,fmt.Errorf,fmt.Sprintf,fmt.Sprint,sort.Reverse") + funcs.Set("errors.New,fmt.Errorf,fmt.Sprintf,fmt.Sprint,sort.Reverse,context.WithValue,context.WithCancel,context.WithDeadline,context.WithTimeout") Analyzer.Flags.Var(&funcs, "funcs", "comma-separated list of functions whose results must be used") diff --git a/src/cmd/vendor/golang.org/x/tools/internal/analysisinternal/analysis.go b/src/cmd/vendor/golang.org/x/tools/internal/analysisinternal/analysis.go index 26586810c7..01f6e829f7 100644 --- a/src/cmd/vendor/golang.org/x/tools/internal/analysisinternal/analysis.go +++ b/src/cmd/vendor/golang.org/x/tools/internal/analysisinternal/analysis.go @@ -14,6 +14,12 @@ import ( "strings" "golang.org/x/tools/go/ast/astutil" + "golang.org/x/tools/internal/lsp/fuzzy" +) + +var ( + GetTypeErrors func(p interface{}) []types.Error + SetTypeErrors func(p interface{}, errors []types.Error) ) func TypeErrorEndPos(fset *token.FileSet, src []byte, start token.Pos) token.Pos { @@ -45,32 +51,34 @@ func ZeroValue(fset *token.FileSet, f *ast.File, pkg *types.Package, typ types.T default: panic("unknown basic type") } - case *types.Chan, *types.Interface, *types.Map, *types.Pointer, *types.Signature, *types.Slice: + case *types.Chan, *types.Interface, *types.Map, *types.Pointer, *types.Signature, *types.Slice, *types.Array: return ast.NewIdent("nil") case *types.Struct: - texpr := typeExpr(fset, f, pkg, typ) // typ because we want the name here. + texpr := TypeExpr(fset, f, pkg, typ) // typ because we want the name here. if texpr == nil { return nil } return &ast.CompositeLit{ Type: texpr, } - case *types.Array: - texpr := typeExpr(fset, f, pkg, u.Elem()) - if texpr == nil { - return nil - } - return &ast.CompositeLit{ - Type: &ast.ArrayType{ - Elt: texpr, - Len: &ast.BasicLit{Kind: token.INT, Value: fmt.Sprintf("%v", u.Len())}, - }, - } } return nil } -func typeExpr(fset *token.FileSet, f *ast.File, pkg *types.Package, typ types.Type) ast.Expr { +// IsZeroValue checks whether the given expression is a 'zero value' (as determined by output of +// analysisinternal.ZeroValue) +func IsZeroValue(expr ast.Expr) bool { + switch e := expr.(type) { + case *ast.BasicLit: + return e.Value == "0" || e.Value == `""` + case *ast.Ident: + return e.Name == "nil" || e.Name == "false" + default: + return false + } +} + +func TypeExpr(fset *token.FileSet, f *ast.File, pkg *types.Package, typ types.Type) ast.Expr { switch t := typ.(type) { case *types.Basic: switch t.Kind() { @@ -79,7 +87,96 @@ func typeExpr(fset *token.FileSet, f *ast.File, pkg *types.Package, typ types.Ty default: return ast.NewIdent(t.Name()) } + case *types.Pointer: + x := TypeExpr(fset, f, pkg, t.Elem()) + if x == nil { + return nil + } + return &ast.UnaryExpr{ + Op: token.MUL, + X: x, + } + case *types.Array: + elt := TypeExpr(fset, f, pkg, t.Elem()) + if elt == nil { + return nil + } + return &ast.ArrayType{ + Len: &ast.BasicLit{ + Kind: token.INT, + Value: fmt.Sprintf("%d", t.Len()), + }, + Elt: elt, + } + case *types.Slice: + elt := TypeExpr(fset, f, pkg, t.Elem()) + if elt == nil { + return nil + } + return &ast.ArrayType{ + Elt: elt, + } + case *types.Map: + key := TypeExpr(fset, f, pkg, t.Key()) + value := TypeExpr(fset, f, pkg, t.Elem()) + if key == nil || value == nil { + return nil + } + return &ast.MapType{ + Key: key, + Value: value, + } + case *types.Chan: + dir := ast.ChanDir(t.Dir()) + if t.Dir() == types.SendRecv { + dir = ast.SEND | ast.RECV + } + value := TypeExpr(fset, f, pkg, t.Elem()) + if value == nil { + return nil + } + return &ast.ChanType{ + Dir: dir, + Value: value, + } + case *types.Signature: + var params []*ast.Field + for i := 0; i < t.Params().Len(); i++ { + p := TypeExpr(fset, f, pkg, t.Params().At(i).Type()) + if p == nil { + return nil + } + params = append(params, &ast.Field{ + Type: p, + Names: []*ast.Ident{ + { + Name: t.Params().At(i).Name(), + }, + }, + }) + } + var returns []*ast.Field + for i := 0; i < t.Results().Len(); i++ { + r := TypeExpr(fset, f, pkg, t.Results().At(i).Type()) + if r == nil { + return nil + } + returns = append(returns, &ast.Field{ + Type: r, + }) + } + return &ast.FuncType{ + Params: &ast.FieldList{ + List: params, + }, + Results: &ast.FieldList{ + List: returns, + }, + } case *types.Named: + if t.Obj().Pkg() == nil { + return ast.NewIdent(t.Obj().Name()) + } if t.Obj().Pkg() == pkg { return ast.NewIdent(t.Obj().Name()) } @@ -101,14 +198,15 @@ func typeExpr(fset *token.FileSet, f *ast.File, pkg *types.Package, typ types.Ty X: ast.NewIdent(pkgName), Sel: ast.NewIdent(t.Obj().Name()), } + case *types.Struct: + return ast.NewIdent(t.String()) + case *types.Interface: + return ast.NewIdent(t.String()) default: - return nil // TODO: anonymous structs, but who does that + return nil } } -var GetTypeErrors = func(p interface{}) []types.Error { return nil } -var SetTypeErrors = func(p interface{}, errors []types.Error) {} - type TypeErrorPass string const ( @@ -116,3 +214,212 @@ const ( NoResultValues TypeErrorPass = "noresultvalues" UndeclaredName TypeErrorPass = "undeclaredname" ) + +// StmtToInsertVarBefore returns the ast.Stmt before which we can safely insert a new variable. +// Some examples: +// +// Basic Example: +// z := 1 +// y := z + x +// If x is undeclared, then this function would return `y := z + x`, so that we +// can insert `x := ` on the line before `y := z + x`. +// +// If stmt example: +// if z == 1 { +// } else if z == y {} +// If y is undeclared, then this function would return `if z == 1 {`, because we cannot +// insert a statement between an if and an else if statement. As a result, we need to find +// the top of the if chain to insert `y := ` before. +func StmtToInsertVarBefore(path []ast.Node) ast.Stmt { + enclosingIndex := -1 + for i, p := range path { + if _, ok := p.(ast.Stmt); ok { + enclosingIndex = i + break + } + } + if enclosingIndex == -1 { + return nil + } + enclosingStmt := path[enclosingIndex] + switch enclosingStmt.(type) { + case *ast.IfStmt: + // The enclosingStmt is inside of the if declaration, + // We need to check if we are in an else-if stmt and + // get the base if statement. + return baseIfStmt(path, enclosingIndex) + case *ast.CaseClause: + // Get the enclosing switch stmt if the enclosingStmt is + // inside of the case statement. + for i := enclosingIndex + 1; i < len(path); i++ { + if node, ok := path[i].(*ast.SwitchStmt); ok { + return node + } else if node, ok := path[i].(*ast.TypeSwitchStmt); ok { + return node + } + } + } + if len(path) <= enclosingIndex+1 { + return enclosingStmt.(ast.Stmt) + } + // Check if the enclosing statement is inside another node. + switch expr := path[enclosingIndex+1].(type) { + case *ast.IfStmt: + // Get the base if statement. + return baseIfStmt(path, enclosingIndex+1) + case *ast.ForStmt: + if expr.Init == enclosingStmt || expr.Post == enclosingStmt { + return expr + } + } + return enclosingStmt.(ast.Stmt) +} + +// baseIfStmt walks up the if/else-if chain until we get to +// the top of the current if chain. +func baseIfStmt(path []ast.Node, index int) ast.Stmt { + stmt := path[index] + for i := index + 1; i < len(path); i++ { + if node, ok := path[i].(*ast.IfStmt); ok && node.Else == stmt { + stmt = node + continue + } + break + } + return stmt.(ast.Stmt) +} + +// WalkASTWithParent walks the AST rooted at n. The semantics are +// similar to ast.Inspect except it does not call f(nil). +func WalkASTWithParent(n ast.Node, f func(n ast.Node, parent ast.Node) bool) { + var ancestors []ast.Node + ast.Inspect(n, func(n ast.Node) (recurse bool) { + if n == nil { + ancestors = ancestors[:len(ancestors)-1] + return false + } + + var parent ast.Node + if len(ancestors) > 0 { + parent = ancestors[len(ancestors)-1] + } + ancestors = append(ancestors, n) + return f(n, parent) + }) +} + +// FindMatchingIdents finds all identifiers in 'node' that match any of the given types. +// 'pos' represents the position at which the identifiers may be inserted. 'pos' must be within +// the scope of each of identifier we select. Otherwise, we will insert a variable at 'pos' that +// is unrecognized. +func FindMatchingIdents(typs []types.Type, node ast.Node, pos token.Pos, info *types.Info, pkg *types.Package) map[types.Type][]*ast.Ident { + matches := map[types.Type][]*ast.Ident{} + // Initialize matches to contain the variable types we are searching for. + for _, typ := range typs { + if typ == nil { + continue + } + matches[typ] = []*ast.Ident{} + } + seen := map[types.Object]struct{}{} + ast.Inspect(node, func(n ast.Node) bool { + if n == nil { + return false + } + // Prevent circular definitions. If 'pos' is within an assignment statement, do not + // allow any identifiers in that assignment statement to be selected. Otherwise, + // we could do the following, where 'x' satisfies the type of 'f0': + // + // x := fakeStruct{f0: x} + // + assignment, ok := n.(*ast.AssignStmt) + if ok && pos > assignment.Pos() && pos <= assignment.End() { + return false + } + if n.End() > pos { + return n.Pos() <= pos + } + ident, ok := n.(*ast.Ident) + if !ok || ident.Name == "_" { + return true + } + obj := info.Defs[ident] + if obj == nil || obj.Type() == nil { + return true + } + if _, ok := obj.(*types.TypeName); ok { + return true + } + // Prevent duplicates in matches' values. + if _, ok = seen[obj]; ok { + return true + } + seen[obj] = struct{}{} + // Find the scope for the given position. Then, check whether the object + // exists within the scope. + innerScope := pkg.Scope().Innermost(pos) + if innerScope == nil { + return true + } + _, foundObj := innerScope.LookupParent(ident.Name, pos) + if foundObj != obj { + return true + } + // The object must match one of the types that we are searching for. + if idents, ok := matches[obj.Type()]; ok { + matches[obj.Type()] = append(idents, ast.NewIdent(ident.Name)) + } + // If the object type does not exactly match any of the target types, greedily + // find the first target type that the object type can satisfy. + for typ := range matches { + if obj.Type() == typ { + continue + } + if equivalentTypes(obj.Type(), typ) { + matches[typ] = append(matches[typ], ast.NewIdent(ident.Name)) + } + } + return true + }) + return matches +} + +func equivalentTypes(want, got types.Type) bool { + if want == got || types.Identical(want, got) { + return true + } + // Code segment to help check for untyped equality from (golang/go#32146). + if rhs, ok := want.(*types.Basic); ok && rhs.Info()&types.IsUntyped > 0 { + if lhs, ok := got.Underlying().(*types.Basic); ok { + return rhs.Info()&types.IsConstType == lhs.Info()&types.IsConstType + } + } + return types.AssignableTo(want, got) +} + +// FindBestMatch employs fuzzy matching to evaluate the similarity of each given identifier to the +// given pattern. We return the identifier whose name is most similar to the pattern. +func FindBestMatch(pattern string, idents []*ast.Ident) ast.Expr { + fuzz := fuzzy.NewMatcher(pattern) + var bestFuzz ast.Expr + highScore := float32(0) // minimum score is 0 (no match) + for _, ident := range idents { + // TODO: Improve scoring algorithm. + score := fuzz.Score(ident.Name) + if score > highScore { + highScore = score + bestFuzz = ident + } else if score == 0 { + // Order matters in the fuzzy matching algorithm. If we find no match + // when matching the target to the identifier, try matching the identifier + // to the target. + revFuzz := fuzzy.NewMatcher(ident.Name) + revScore := revFuzz.Score(pattern) + if revScore > highScore { + highScore = revScore + bestFuzz = ident + } + } + } + return bestFuzz +} diff --git a/src/cmd/vendor/golang.org/x/tools/internal/lsp/fuzzy/input.go b/src/cmd/vendor/golang.org/x/tools/internal/lsp/fuzzy/input.go new file mode 100644 index 0000000000..ac377035ec --- /dev/null +++ b/src/cmd/vendor/golang.org/x/tools/internal/lsp/fuzzy/input.go @@ -0,0 +1,168 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package fuzzy + +import ( + "unicode" +) + +// RuneRole specifies the role of a rune in the context of an input. +type RuneRole byte + +const ( + // RNone specifies a rune without any role in the input (i.e., whitespace/non-ASCII). + RNone RuneRole = iota + // RSep specifies a rune with the role of segment separator. + RSep + // RTail specifies a rune which is a lower-case tail in a word in the input. + RTail + // RUCTail specifies a rune which is an upper-case tail in a word in the input. + RUCTail + // RHead specifies a rune which is the first character in a word in the input. + RHead +) + +// RuneRoles detects the roles of each byte rune in an input string and stores it in the output +// slice. The rune role depends on the input type. Stops when it parsed all the runes in the string +// or when it filled the output. If output is nil, then it gets created. +func RuneRoles(str string, reuse []RuneRole) []RuneRole { + var output []RuneRole + if cap(reuse) < len(str) { + output = make([]RuneRole, 0, len(str)) + } else { + output = reuse[:0] + } + + prev, prev2 := rtNone, rtNone + for i := 0; i < len(str); i++ { + r := rune(str[i]) + + role := RNone + + curr := rtLower + if str[i] <= unicode.MaxASCII { + curr = runeType(rt[str[i]] - '0') + } + + if curr == rtLower { + if prev == rtNone || prev == rtPunct { + role = RHead + } else { + role = RTail + } + } else if curr == rtUpper { + role = RHead + + if prev == rtUpper { + // This and previous characters are both upper case. + + if i+1 == len(str) { + // This is last character, previous was also uppercase -> this is UCTail + // i.e., (current char is C): aBC / BC / ABC + role = RUCTail + } + } + } else if curr == rtPunct { + switch r { + case '.', ':': + role = RSep + } + } + if curr != rtLower { + if i > 1 && output[i-1] == RHead && prev2 == rtUpper && (output[i-2] == RHead || output[i-2] == RUCTail) { + // The previous two characters were uppercase. The current one is not a lower case, so the + // previous one can't be a HEAD. Make it a UCTail. + // i.e., (last char is current char - B must be a UCTail): ABC / ZABC / AB. + output[i-1] = RUCTail + } + } + + output = append(output, role) + prev2 = prev + prev = curr + } + return output +} + +type runeType byte + +const ( + rtNone runeType = iota + rtPunct + rtLower + rtUpper +) + +const rt = "00000000000000000000000000000000000000000000001122222222221000000333333333333333333333333330000002222222222222222222222222200000" + +// LastSegment returns the substring representing the last segment from the input, where each +// byte has an associated RuneRole in the roles slice. This makes sense only for inputs of Symbol +// or Filename type. +func LastSegment(input string, roles []RuneRole) string { + // Exclude ending separators. + end := len(input) - 1 + for end >= 0 && roles[end] == RSep { + end-- + } + if end < 0 { + return "" + } + + start := end - 1 + for start >= 0 && roles[start] != RSep { + start-- + } + + return input[start+1 : end+1] +} + +// ToLower transforms the input string to lower case, which is stored in the output byte slice. +// The lower casing considers only ASCII values - non ASCII values are left unmodified. +// Stops when parsed all input or when it filled the output slice. If output is nil, then it gets +// created. +func ToLower(input string, reuse []byte) []byte { + output := reuse + if cap(reuse) < len(input) { + output = make([]byte, len(input)) + } + + for i := 0; i < len(input); i++ { + r := rune(input[i]) + if r <= unicode.MaxASCII { + if 'A' <= r && r <= 'Z' { + r += 'a' - 'A' + } + } + output[i] = byte(r) + } + return output[:len(input)] +} + +// WordConsumer defines a consumer for a word delimited by the [start,end) byte offsets in an input +// (start is inclusive, end is exclusive). +type WordConsumer func(start, end int) + +// Words find word delimiters in an input based on its bytes' mappings to rune roles. The offset +// delimiters for each word are fed to the provided consumer function. +func Words(roles []RuneRole, consume WordConsumer) { + var wordStart int + for i, r := range roles { + switch r { + case RUCTail, RTail: + case RHead, RNone, RSep: + if i != wordStart { + consume(wordStart, i) + } + wordStart = i + if r != RHead { + // Skip this character. + wordStart = i + 1 + } + } + } + if wordStart != len(roles) { + consume(wordStart, len(roles)) + } +} diff --git a/src/cmd/vendor/golang.org/x/tools/internal/lsp/fuzzy/matcher.go b/src/cmd/vendor/golang.org/x/tools/internal/lsp/fuzzy/matcher.go new file mode 100644 index 0000000000..16a643097d --- /dev/null +++ b/src/cmd/vendor/golang.org/x/tools/internal/lsp/fuzzy/matcher.go @@ -0,0 +1,398 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package fuzzy implements a fuzzy matching algorithm. +package fuzzy + +import ( + "bytes" + "fmt" +) + +const ( + // MaxInputSize is the maximum size of the input scored against the fuzzy matcher. Longer inputs + // will be truncated to this size. + MaxInputSize = 127 + // MaxPatternSize is the maximum size of the pattern used to construct the fuzzy matcher. Longer + // inputs are truncated to this size. + MaxPatternSize = 63 +) + +type scoreVal int + +func (s scoreVal) val() int { + return int(s) >> 1 +} + +func (s scoreVal) prevK() int { + return int(s) & 1 +} + +func score(val int, prevK int /*0 or 1*/) scoreVal { + return scoreVal(val<<1 + prevK) +} + +// Matcher implements a fuzzy matching algorithm for scoring candidates against a pattern. +// The matcher does not support parallel usage. +type Matcher struct { + pattern string + patternLower []byte // lower-case version of the pattern + patternShort []byte // first characters of the pattern + caseSensitive bool // set if the pattern is mix-cased + + patternRoles []RuneRole // the role of each character in the pattern + roles []RuneRole // the role of each character in the tested string + + scores [MaxInputSize + 1][MaxPatternSize + 1][2]scoreVal + + scoreScale float32 + + lastCandidateLen int // in bytes + lastCandidateMatched bool + + // Here we save the last candidate in lower-case. This is basically a byte slice we reuse for + // performance reasons, so the slice is not reallocated for every candidate. + lowerBuf [MaxInputSize]byte + rolesBuf [MaxInputSize]RuneRole +} + +func (m *Matcher) bestK(i, j int) int { + if m.scores[i][j][0].val() < m.scores[i][j][1].val() { + return 1 + } + return 0 +} + +// NewMatcher returns a new fuzzy matcher for scoring candidates against the provided pattern. +func NewMatcher(pattern string) *Matcher { + if len(pattern) > MaxPatternSize { + pattern = pattern[:MaxPatternSize] + } + + m := &Matcher{ + pattern: pattern, + patternLower: ToLower(pattern, nil), + } + + for i, c := range m.patternLower { + if pattern[i] != c { + m.caseSensitive = true + break + } + } + + if len(pattern) > 3 { + m.patternShort = m.patternLower[:3] + } else { + m.patternShort = m.patternLower + } + + m.patternRoles = RuneRoles(pattern, nil) + + if len(pattern) > 0 { + maxCharScore := 4 + m.scoreScale = 1 / float32(maxCharScore*len(pattern)) + } + + return m +} + +// Score returns the score returned by matching the candidate to the pattern. +// This is not designed for parallel use. Multiple candidates must be scored sequentially. +// Returns a score between 0 and 1 (0 - no match, 1 - perfect match). +func (m *Matcher) Score(candidate string) float32 { + if len(candidate) > MaxInputSize { + candidate = candidate[:MaxInputSize] + } + lower := ToLower(candidate, m.lowerBuf[:]) + m.lastCandidateLen = len(candidate) + + if len(m.pattern) == 0 { + // Empty patterns perfectly match candidates. + return 1 + } + + if m.match(candidate, lower) { + sc := m.computeScore(candidate, lower) + if sc > minScore/2 && !m.poorMatch() { + m.lastCandidateMatched = true + if len(m.pattern) == len(candidate) { + // Perfect match. + return 1 + } + + if sc < 0 { + sc = 0 + } + normalizedScore := float32(sc) * m.scoreScale + if normalizedScore > 1 { + normalizedScore = 1 + } + + return normalizedScore + } + } + + m.lastCandidateMatched = false + return 0 +} + +const minScore = -10000 + +// MatchedRanges returns matches ranges for the last scored string as a flattened array of +// [begin, end) byte offset pairs. +func (m *Matcher) MatchedRanges() []int { + if len(m.pattern) == 0 || !m.lastCandidateMatched { + return nil + } + i, j := m.lastCandidateLen, len(m.pattern) + if m.scores[i][j][0].val() < minScore/2 && m.scores[i][j][1].val() < minScore/2 { + return nil + } + + var ret []int + k := m.bestK(i, j) + for i > 0 { + take := (k == 1) + k = m.scores[i][j][k].prevK() + if take { + if len(ret) == 0 || ret[len(ret)-1] != i { + ret = append(ret, i) + ret = append(ret, i-1) + } else { + ret[len(ret)-1] = i - 1 + } + j-- + } + i-- + } + // Reverse slice. + for i := 0; i < len(ret)/2; i++ { + ret[i], ret[len(ret)-1-i] = ret[len(ret)-1-i], ret[i] + } + return ret +} + +func (m *Matcher) match(candidate string, candidateLower []byte) bool { + i, j := 0, 0 + for ; i < len(candidateLower) && j < len(m.patternLower); i++ { + if candidateLower[i] == m.patternLower[j] { + j++ + } + } + if j != len(m.patternLower) { + return false + } + + // The input passes the simple test against pattern, so it is time to classify its characters. + // Character roles are used below to find the last segment. + m.roles = RuneRoles(candidate, m.rolesBuf[:]) + + return true +} + +func (m *Matcher) computeScore(candidate string, candidateLower []byte) int { + pattLen, candLen := len(m.pattern), len(candidate) + + for j := 0; j <= len(m.pattern); j++ { + m.scores[0][j][0] = minScore << 1 + m.scores[0][j][1] = minScore << 1 + } + m.scores[0][0][0] = score(0, 0) // Start with 0. + + segmentsLeft, lastSegStart := 1, 0 + for i := 0; i < candLen; i++ { + if m.roles[i] == RSep { + segmentsLeft++ + lastSegStart = i + 1 + } + } + + // A per-character bonus for a consecutive match. + consecutiveBonus := 2 + wordIdx := 0 // Word count within segment. + for i := 1; i <= candLen; i++ { + + role := m.roles[i-1] + isHead := role == RHead + + if isHead { + wordIdx++ + } else if role == RSep && segmentsLeft > 1 { + wordIdx = 0 + segmentsLeft-- + } + + var skipPenalty int + if i == 1 || (i-1) == lastSegStart { + // Skipping the start of first or last segment. + skipPenalty++ + } + + for j := 0; j <= pattLen; j++ { + // By default, we don't have a match. Fill in the skip data. + m.scores[i][j][1] = minScore << 1 + + // Compute the skip score. + k := 0 + if m.scores[i-1][j][0].val() < m.scores[i-1][j][1].val() { + k = 1 + } + + skipScore := m.scores[i-1][j][k].val() + // Do not penalize missing characters after the last matched segment. + if j != pattLen { + skipScore -= skipPenalty + } + m.scores[i][j][0] = score(skipScore, k) + + if j == 0 || candidateLower[i-1] != m.patternLower[j-1] { + // Not a match. + continue + } + pRole := m.patternRoles[j-1] + + if role == RTail && pRole == RHead { + if j > 1 { + // Not a match: a head in the pattern matches a tail character in the candidate. + continue + } + // Special treatment for the first character of the pattern. We allow + // matches in the middle of a word if they are long enough, at least + // min(3, pattern.length) characters. + if !bytes.HasPrefix(candidateLower[i-1:], m.patternShort) { + continue + } + } + + // Compute the char score. + var charScore int + // Bonus 1: the char is in the candidate's last segment. + if segmentsLeft <= 1 { + charScore++ + } + // Bonus 2: Case match or a Head in the pattern aligns with one in the word. + // Single-case patterns lack segmentation signals and we assume any character + // can be a head of a segment. + if candidate[i-1] == m.pattern[j-1] || role == RHead && (!m.caseSensitive || pRole == RHead) { + charScore++ + } + + // Penalty 1: pattern char is Head, candidate char is Tail. + if role == RTail && pRole == RHead { + charScore-- + } + // Penalty 2: first pattern character matched in the middle of a word. + if j == 1 && role == RTail { + charScore -= 4 + } + + // Third dimension encodes whether there is a gap between the previous match and the current + // one. + for k := 0; k < 2; k++ { + sc := m.scores[i-1][j-1][k].val() + charScore + + isConsecutive := k == 1 || i-1 == 0 || i-1 == lastSegStart + if isConsecutive { + // Bonus 3: a consecutive match. First character match also gets a bonus to + // ensure prefix final match score normalizes to 1.0. + // Logically, this is a part of charScore, but we have to compute it here because it + // only applies for consecutive matches (k == 1). + sc += consecutiveBonus + } + if k == 0 { + // Penalty 3: Matching inside a segment (and previous char wasn't matched). Penalize for the lack + // of alignment. + if role == RTail || role == RUCTail { + sc -= 3 + } + } + + if sc > m.scores[i][j][1].val() { + m.scores[i][j][1] = score(sc, k) + } + } + } + } + + result := m.scores[len(candidate)][len(m.pattern)][m.bestK(len(candidate), len(m.pattern))].val() + + return result +} + +// ScoreTable returns the score table computed for the provided candidate. Used only for debugging. +func (m *Matcher) ScoreTable(candidate string) string { + var buf bytes.Buffer + + var line1, line2, separator bytes.Buffer + line1.WriteString("\t") + line2.WriteString("\t") + for j := 0; j < len(m.pattern); j++ { + line1.WriteString(fmt.Sprintf("%c\t\t", m.pattern[j])) + separator.WriteString("----------------") + } + + buf.WriteString(line1.String()) + buf.WriteString("\n") + buf.WriteString(separator.String()) + buf.WriteString("\n") + + for i := 1; i <= len(candidate); i++ { + line1.Reset() + line2.Reset() + + line1.WriteString(fmt.Sprintf("%c\t", candidate[i-1])) + line2.WriteString("\t") + + for j := 1; j <= len(m.pattern); j++ { + line1.WriteString(fmt.Sprintf("M%6d(%c)\t", m.scores[i][j][0].val(), dir(m.scores[i][j][0].prevK()))) + line2.WriteString(fmt.Sprintf("H%6d(%c)\t", m.scores[i][j][1].val(), dir(m.scores[i][j][1].prevK()))) + } + buf.WriteString(line1.String()) + buf.WriteString("\n") + buf.WriteString(line2.String()) + buf.WriteString("\n") + buf.WriteString(separator.String()) + buf.WriteString("\n") + } + + return buf.String() +} + +func dir(prevK int) rune { + if prevK == 0 { + return 'M' + } + return 'H' +} + +func (m *Matcher) poorMatch() bool { + if len(m.pattern) < 2 { + return false + } + + i, j := m.lastCandidateLen, len(m.pattern) + k := m.bestK(i, j) + + var counter, len int + for i > 0 { + take := (k == 1) + k = m.scores[i][j][k].prevK() + if take { + len++ + if k == 0 && len < 3 && m.roles[i-1] == RTail { + // Short match in the middle of a word + counter++ + if counter > 1 { + return true + } + } + j-- + } else { + len = 0 + } + i-- + } + return false +} diff --git a/src/cmd/vendor/modules.txt b/src/cmd/vendor/modules.txt index 7272f04ff3..c827365400 100644 --- a/src/cmd/vendor/modules.txt +++ b/src/cmd/vendor/modules.txt @@ -29,7 +29,7 @@ golang.org/x/arch/x86/x86asm golang.org/x/crypto/ed25519 golang.org/x/crypto/ed25519/internal/edwards25519 golang.org/x/crypto/ssh/terminal -# golang.org/x/mod v0.3.1-0.20200625141748-0b26df4a2231 +# golang.org/x/mod v0.3.1-0.20200828183125-ce943fd02449 ## explicit golang.org/x/mod/internal/lazyregexp golang.org/x/mod/modfile @@ -45,7 +45,7 @@ golang.org/x/mod/zip golang.org/x/sys/internal/unsafeheader golang.org/x/sys/unix golang.org/x/sys/windows -# golang.org/x/tools v0.0.0-20200616133436-c1934b75d054 +# golang.org/x/tools v0.0.0-20200901153117-6e59e24738da ## explicit golang.org/x/tools/go/analysis golang.org/x/tools/go/analysis/internal/analysisflags @@ -84,6 +84,7 @@ golang.org/x/tools/go/cfg golang.org/x/tools/go/types/objectpath golang.org/x/tools/go/types/typeutil golang.org/x/tools/internal/analysisinternal +golang.org/x/tools/internal/lsp/fuzzy # golang.org/x/xerrors v0.0.0-20200806184451-1a77d5e9f316 ## explicit golang.org/x/xerrors |
