diff options
| author | tromey <tromey@138bc75d-0d04-0410-961f-82ee72b054a4> | 2002-05-09 23:41:42 +0000 |
|---|---|---|
| committer | tromey <tromey@138bc75d-0d04-0410-961f-82ee72b054a4> | 2002-05-09 23:41:42 +0000 |
| commit | d214dfcf5f0744c1818e57ddae3ec4ec5a28cec2 (patch) | |
| tree | 57618dcad965b4ccce97c99b06078c302ae09a1c /libjava/java | |
| parent | 9a9992003a3ddcfe37503cfa62ba985341bc1bfb (diff) | |
| download | gcc-d214dfcf5f0744c1818e57ddae3ec4ec5a28cec2.tar.gz | |
* java/util/ResourceBundle.java: New version from Classpath.
* java/util/Locale.java: Likewise.
git-svn-id: svn+ssh://gcc.gnu.org/svn/gcc/trunk@53351 138bc75d-0d04-0410-961f-82ee72b054a4
Diffstat (limited to 'libjava/java')
| -rw-r--r-- | libjava/java/util/Locale.java | 728 | ||||
| -rw-r--r-- | libjava/java/util/ResourceBundle.java | 681 |
2 files changed, 765 insertions, 644 deletions
diff --git a/libjava/java/util/Locale.java b/libjava/java/util/Locale.java index 9f501727b95..df5dac15b37 100644 --- a/libjava/java/util/Locale.java +++ b/libjava/java/util/Locale.java @@ -1,23 +1,23 @@ -/* java.util.Locale - Copyright (C) 1998, 1999, 2001 Free Software Foundation, Inc. - +/* Locale.java -- i18n locales + Copyright (C) 1998, 1999, 2001, 2002 Free Software Foundation, Inc. + This file is part of GNU Classpath. - + GNU Classpath is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2, or (at your option) any later version. - + GNU Classpath is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. - + You should have received a copy of the GNU General Public License along with GNU Classpath; see the file COPYING. If not, write to the Free Software Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA. - + Linking this library statically or dynamically with other modules is making a combined work based on this library. Thus, the terms and conditions of the GNU General Public License cover the whole @@ -37,207 +37,241 @@ exception statement from your version. */ package java.util; +import java.io.IOException; +import java.io.ObjectInputStream; +import java.io.ObjectOutputStream; +import java.io.Serializable; + /** - * Locales represent a specific country and culture. - * <br><br> - * Classes which can be passed a Locale object tailor their information - * for a given locale. For instance, currency number formatting is - * handled differently for the USA and France. - * <br><br> - * Locales are made up of a language code, a country code, and an optional - * set of variant strings. - * <br><br> - * Language codes are represented by - * <a href="http://www.indigo.ie/egt/standards/iso639/iso639-1-en.html">ISO 639:1988</a> - * w/ additions from ISO 639/RA Newsletter No. 1/1989 - * and a decision of the Advisory Committee of ISO/TC39 on - * August 8, 1997. - * <br><br> - * Country codes are represented by - * <a href="ftp://ftp.ripe.net/iso3166-countrycodes">ISO 3166</a>. - * <br><br> - * Variant strings are vendor and browser specific. Standard variant - * strings include "POSIX" for POSIX, "WIN" for MS-Windows, and "MAC" for - * Macintosh. When there is more than one variant string, they must + * Locales represent a specific country and culture. Classes which can be + * passed a Locale object tailor their information for a given locale. For + * instance, currency number formatting is handled differently for the USA + * and France. + * + * <p>Locales are made up of a language code, a country code, and an optional + * set of variant strings. Language codes are represented by + * <a href="http://www.ics.uci.edu/pub/ietf/http/related/iso639.txt"> + * ISO 639:1988</a> w/ additions from ISO 639/RA Newsletter No. 1/1989 + * and a decision of the Advisory Committee of ISO/TC39 on August 8, 1997. + * + * <p>Country codes are represented by + * <a href="http://www.chemie.fu-berlin.de/diverse/doc/ISO_3166.html"> + * ISO 3166</a>. Variant strings are vendor and browser specific. Standard + * variant strings include "POSIX" for POSIX, "WIN" for MS-Windows, and + * "MAC" for Macintosh. When there is more than one variant string, they must * be separated by an underscore (U+005F). - * <br><br> - * The default locale is determined by the values of the system properties - * user.language, user.region, and user.variant. + * + * <p>The default locale is determined by the values of the system properties + * user.language, user.region, and user.variant, defaulting to "en". Note that + * the locale does NOT contain the conversion and formatting capabilities (for + * that, use ResourceBundle and java.text). Rather, it is an immutable tag + * object for identifying a given locale, which is referenced by these other + * classes when they must make locale-dependent decisions. + * * @see ResourceBundle * @see java.text.Format * @see java.text.NumberFormat * @see java.text.Collator * @author Jochen Hoenicke * @author Paul Fisher + * @author Eric Blake <ebb9@email.byu.edu> + * @since 1.1 + * @status updated to 1.4 */ -public final class Locale implements java.io.Serializable, Cloneable +public final class Locale implements Serializable, Cloneable { - /** - * Locale which represents the English language. - */ - public static final Locale ENGLISH = new Locale("en", ""); - /** - * Locale which represents the English language. - */ - public static final Locale FRENCH = new Locale("fr", ""); - /** - * Locale which represents the German language. - */ - public static final Locale GERMAN = new Locale("de", ""); - /** - * Locale which represents the Italian language. - */ - public static final Locale ITALIAN = new Locale("it", ""); - /** - * Locale which represents the Japanese language. - */ - public static final Locale JAPANESE = new Locale("ja", ""); - /** - * Locale which represents the Korean language. - */ - public static final Locale KOREAN = new Locale("ko", ""); - /** - * Locale which represents the Chinese language. - */ - public static final Locale CHINESE = new Locale("zh", ""); - /** - * Locale which represents the Chinese language as used in China. - */ + /** Locale which represents the English language. */ + public static final Locale ENGLISH = new Locale("en"); + + /** Locale which represents the French language. */ + public static final Locale FRENCH = new Locale("fr"); + + /** Locale which represents the German language. */ + public static final Locale GERMAN = new Locale("de"); + + /** Locale which represents the Italian language. */ + public static final Locale ITALIAN = new Locale("it"); + + /** Locale which represents the Japanese language. */ + public static final Locale JAPANESE = new Locale("ja"); + + /** Locale which represents the Korean language. */ + public static final Locale KOREAN = new Locale("ko"); + + /** Locale which represents the Chinese language. */ + public static final Locale CHINESE = new Locale("zh"); + + /** Locale which represents the Chinese language as used in China. */ public static final Locale SIMPLIFIED_CHINESE = new Locale("zh", "CN"); + /** * Locale which represents the Chinese language as used in Taiwan. * Same as TAIWAN Locale. */ public static final Locale TRADITIONAL_CHINESE = new Locale("zh", "TW"); - /** - * Locale which represents France. - */ + + /** Locale which represents France. */ public static final Locale FRANCE = new Locale("fr", "FR"); - /** - * Locale which represents Germany. - */ + + /** Locale which represents Germany. */ public static final Locale GERMANY = new Locale("de", "DE"); - /** - * Locale which represents Italy. - */ + + /** Locale which represents Italy. */ public static final Locale ITALY = new Locale("it", "IT"); - /** - * Locale which represents Japan. - */ + + /** Locale which represents Japan. */ public static final Locale JAPAN = new Locale("ja", "JP"); - /** - * Locale which represents Korea. - */ + + /** Locale which represents Korea. */ public static final Locale KOREA = new Locale("ko", "KR"); + /** * Locale which represents China. * Same as SIMPLIFIED_CHINESE Locale. */ public static final Locale CHINA = SIMPLIFIED_CHINESE; + /** * Locale which represents the People's Republic of China. * Same as CHINA Locale. */ public static final Locale PRC = CHINA; + /** * Locale which represents Taiwan. * Same as TRADITIONAL_CHINESE Locale. */ public static final Locale TAIWAN = TRADITIONAL_CHINESE; - /** - * Locale which represents the United Kingdom. - */ + + /** Locale which represents the United Kingdom. */ public static final Locale UK = new Locale("en", "GB"); - /** - * Locale which represents the United States. - */ + + /** Locale which represents the United States. */ public static final Locale US = new Locale("en", "US"); - /** - * Locale which represents the English speaking portion of Canada. - */ + + /** Locale which represents the English speaking portion of Canada. */ public static final Locale CANADA = new Locale("en", "CA"); - /** - * Locale which represents the French speaking portion of Canada. - */ + + /** Locale which represents the French speaking portion of Canada. */ public static final Locale CANADA_FRENCH = new Locale("fr", "CA"); /** - * We are compatible to sun's Locale. + * Compatible with JDK 1.1+. */ - static final long serialVersionUID = 9149081749638150636L; + private static final long serialVersionUID = 9149081749638150636L; /** * The language code, as returned by getLanguage(). - * @serial + * + * @serial the languange, possibly "" */ private String language; + /** * The country code, as returned by getCountry(). - * @serial + * + * @serial the country, possibly "" */ private String country; + /** * The variant code, as returned by getVariant(). - * @serial + * + * @serial the variant, possibly "" */ private String variant; + /** - * This is the cached hashcode. When writing to stream, we write -1. - * @serial + * This is the cached hashcode. When writing to stream, we write -1. + * + * @serial should be -1 in serial streams */ private int hashcode; /** - * Convert old iso639 codes to the new ones. + * The default locale. Except for during bootstrapping, this should never be + * null. Note the logic in the main constructor, to detect when + * bootstrapping has completed. + */ + private static Locale defaultLocale = + new Locale(System.getProperty("user.language", "en"), + System.getProperty("user.region", ""), + System.getProperty("user.variant", "")); + + /** + * Convert new iso639 codes to the old ones. + * + * @param language the language to check + * @return the appropriate code */ private String convertLanguage(String language) { if (language.equals("")) return language; - language = language.toLowerCase(); - int index = "iw,in,ji".indexOf(language); + int index = "he,id,yi".indexOf(language); if (index != -1) - return "he,id,yi".substring(index, index + 2); + return "iw,in,ji".substring(index, index + 2); return language; } /** * Creates a new locale for the given language and country. - * @param language lowercase two-letter ISO-639 A2 language code. - * @param country uppercase two-letter ISO-3166 A2 contry code. - * @param variant vendor and browser specific. + * + * @param language lowercase two-letter ISO-639 A2 language code + * @param country uppercase two-letter ISO-3166 A2 contry code + * @param variant vendor and browser specific + * @throws NullPointerException if any argument is null */ public Locale(String language, String country, String variant) { - this.language = convertLanguage(language); - this.country = country.toUpperCase(); - this.variant = variant.toUpperCase(); - this.hashcode = (this.language.hashCode() ^ this.country.hashCode() - ^ this.variant.hashCode()); + // During bootstrap, we already know the strings being passed in are + // the correct capitalization, and not null. We can't call + // String.toUpperCase during this time, since that depends on the + // default locale. + if (defaultLocale != null) + { + language = convertLanguage(language); + country = country.toUpperCase(); + variant = variant.toUpperCase(); + } + this.language = language; + this.country = country; + this.variant = variant; + hashcode = language.hashCode() ^ country.hashCode() ^ variant.hashCode(); } /** * Creates a new locale for the given language and country. - * @param language lowercase two-letter ISO-639 A2 language code. - * @param country uppercase two-letter ISO-3166 A2 country code. + * + * @param language lowercase two-letter ISO-639 A2 language code + * @param country uppercase two-letter ISO-3166 A2 country code + * @throws NullPointerException if either argument is null */ public Locale(String language, String country) { this(language, country, ""); } - private static Locale defaultLocale = - new Locale(System.getProperty("user.language", ""), - System.getProperty("user.region", ""), - System.getProperty("user.variant", "")); + /** + * Creates a new locale for a language. + * + * @param language lowercase two-letter ISO-639 A2 language code + * @throws NullPointerException if either argument is null + * @since 1.4 + */ + public Locale(String language) + { + this(language, "", ""); + } /** - * Returns the default Locale. The default locale is generally - * once set on start up and then never changed. Normally you - * should use this locale for everywhere you need a locale. - * The initial setting matches the default locale, the user has - * chosen. + * Returns the default Locale. The default locale is generally once set + * on start up and then never changed. Normally you should use this locale + * for everywhere you need a locale. The initial setting matches the + * default locale, the user has chosen. + * + * @return the default locale for this virtual machine */ public static Locale getDefault() { @@ -245,23 +279,37 @@ public final class Locale implements java.io.Serializable, Cloneable } /** - * Changes the default locale. Normally only called on program - * start up. Note that this doesn't change the locale for other - * programs. + * Changes the default locale. Normally only called on program start up. + * Note that this doesn't change the locale for other programs. This has + * a security check, + * <code>PropertyPermission("user.language", "write")</code>, because of + * its potential impact to running code. + * + * @param newLocale the new default locale + * @throws NullPointerException if newLocale is null + * @throws SecurityException if permission is denied */ public static void setDefault(Locale newLocale) { + if (newLocale == null) + throw new NullPointerException(); + SecurityManager sm = System.getSecurityManager(); + if (sm != null) + sm.checkPermission(new PropertyPermission("user.language", "write")); defaultLocale = newLocale; } /** * Returns the list of available locales. + * + * @return the installed locales */ public static Locale[] getAvailableLocales() { /* I only return those for which localized language * or country information exists. - * XXX - remove hard coded list. + * XXX - remove hard coded list, and implement more locales (Sun's JDK 1.4 + * has 148 installed locales!). */ return new Locale[] { @@ -271,71 +319,68 @@ public final class Locale implements java.io.Serializable, Cloneable /** * Returns a list of all 2-letter uppercase country codes as defined - * in ISO 3166 + * in ISO 3166. + * + * @return a list of acceptible country codes */ public static String[] getISOCountries() { return new String[] { - "AF", "AL", "DZ", "AS", "AD", "AO", "AI", "AQ", "AG", - "AR", "AM", "AW", "AU", "AT", "AZ", "BS", "BH", "BD", - "BB", "BY", "BE", "BZ", "BJ", "BM", "BT", "BO", "BA", - "BW", "BV", "BR", "IO", "BN", "BG", "BF", "BI", "KH", - "CM", "CA", "CV", "KY", "CF", "TD", "CL", "CN", "CX", - "CC", "CO", "KM", "CG", "CK", "CR", "CI", "HR", "CU", - "CY", "CZ", "DK", "DJ", "DM", "DO", "TP", "EC", "EG", - "SV", "GQ", "ER", "EE", "ET", "FK", "FO", "FJ", "FI", - "FR", "FX", "GF", "PF", "TF", "GA", "GM", "GE", "DE", - "GH", "GI", "GR", "GL", "GD", "GP", "GU", "GT", "GN", - "GW", "GY", "HT", "HM", "HN", "HK", "HU", "IS", "IN", - "ID", "IR", "IQ", "IE", "IL", "IT", "JM", "JP", "JO", - "KZ", "KE", "KI", "KP", "KR", "KW", "KG", "LA", "LV", - "LB", "LS", "LR", "LY", "LI", "LT", "LU", "MO", "MK", - "MG", "MW", "MY", "MV", "ML", "MT", "MH", "MQ", "MR", - "MU", "YT", "MX", "FM", "MD", "MC", "MN", "MS", "MA", - "MZ", "MM", "NA", "NR", "NP", "NL", "AN", "NC", "NZ", - "NI", "NE", "NG", "NU", "NF", "MP", "NO", "OM", "PK", - "PW", "PA", "PG", "PY", "PE", "PH", "PN", "PL", "PT", - "PR", "QA", "RE", "RO", "RU", "RW", "KN", "LC", "VC", - "WS", "SM", "ST", "SA", "SN", "SC", "SL", "SG", "SK", - "SI", "SB", "SO", "ZA", "GS", "ES", "LK", "SH", "PM", - "SD", "SR", "SJ", "SZ", "SE", "CH", "SY", "TW", "TJ", - "TZ", "TH", "TG", "TK", "TO", "TT", "TN", "TR", "TM", - "TC", "TV", "UG", "UA", "AE", "GB", "US", "UM", "UY", - "UZ", "VU", "VA", "VE", "VN", "VG", "VI", "WF", "EH", - "YE", "YU", "ZR", "ZM", "ZW"}; + "AD", "AE", "AF", "AG", "AI", "AL", "AM", "AN", "AO", "AQ", "AR", "AS", + "AT", "AU", "AW", "AZ", "BA", "BB", "BD", "BE", "BF", "BG", "BH", "BI", + "BJ", "BM", "BN", "BO", "BR", "BS", "BT", "BV", "BW", "BY", "BZ", "CA", + "CC", "CF", "CG", "CH", "CI", "CK", "CL", "CM", "CN", "CO", "CR", "CU", + "CV", "CX", "CY", "CZ", "DE", "DJ", "DK", "DM", "DO", "DZ", "EC", "EE", + "EG", "EH", "ER", "ES", "ET", "FI", "FJ", "FK", "FM", "FO", "FR", "FX", + "GA", "GB", "GD", "GE", "GF", "GH", "GI", "GL", "GM", "GN", "GP", "GQ", + "GR", "GS", "GT", "GU", "GW", "GY", "HK", "HM", "HN", "HR", "HT", "HU", + "ID", "IE", "IL", "IN", "IO", "IQ", "IR", "IS", "IT", "JM", "JO", "JP", + "KE", "KG", "KH", "KI", "KM", "KN", "KP", "KR", "KW", "KY", "KZ", "LA", + "LB", "LC", "LI", "LK", "LR", "LS", "LT", "LU", "LV", "LY", "MA", "MC", + "MD", "MG", "MH", "MK", "ML", "MM", "MN", "MO", "MP", "MQ", "MR", "MS", + "MT", "MU", "MV", "MW", "MX", "MY", "MZ", "NA", "NC", "NE", "NF", "NG", + "NI", "NL", "NO", "NP", "NR", "NU", "NZ", "OM", "PA", "PE", "PF", "PG", + "PH", "PK", "PL", "PM", "PN", "PR", "PT", "PW", "PY", "QA", "RE", "RO", + "RU", "RW", "SA", "SB", "SC", "SD", "SE", "SG", "SH", "SI", "SJ", "SK", + "SL", "SM", "SN", "SO", "SR", "ST", "SV", "SY", "SZ", "TC", "TD", "TF", + "TG", "TH", "TJ", "TK", "TM", "TN", "TO", "TP", "TR", "TT", "TV", "TW", + "TZ", "UA", "UG", "UM", "US", "UY", "UZ", "VA", "VC", "VE", "VG", "VI", + "VN", "VU", "WF", "WS", "YE", "YT", "YU", "ZA", "ZM", "ZR", "ZW" + }; } /** * Returns a list of all 2-letter lowercase language codes as defined * in ISO 639 (both old and new variant). + * + * @return a list of acceptable language codes */ public static String[] getISOLanguages() { return new String[] { - "aa", "ab", "af", "am", "ar", "as", "ay", "az", "ba", - "be", "bg", "bh", "bi", "bn", "bo", "br", "ca", "co", - "cs", "cy", "da", "de", "dz", "el", "en", "eo", "es", - "et", "eu", "fa", "fi", "fj", "fo", "fr", "fy", "ga", - "gd", "gl", "gn", "gu", "ha", "iw", "he", "hi", "hr", - "hu", "hy", "ia", "in", "id", "ie", "ik", "is", "it", - "iu", "ja", "jw", "ka", "kk", "kl", "km", "kn", "ko", - "ks", "ku", "ky", "la", "ln", "lo", "lt", "lv", "mg", - "mi", "mk", "ml", "mn", "mo", "mr", "ms", "mt", "my", - "na", "ne", "nl", "no", "oc", "om", "or", "pa", "pl", - "ps", "pt", "qu", "rm", "rn", "ro", "ru", "rw", "sa", - "sd", "sg", "sh", "si", "sk", "sl", "sm", "sn", "so", - "sq", "sr", "ss", "st", "su", "sv", "sw", "ta", "te", - "tg", "th", "ti", "tk", "tl", "tn", "to", "tr", "ts", - "tt", "tw", "ug", "uk", "ur", "uz", "vi", "vo", "wo", - "xh", "ji", "yi", "yo", "za", "zh", "zu"}; + "aa", "ab", "af", "am", "ar", "as", "ay", "az", "ba", "be", "bg", "bh", + "bi", "bn", "bo", "br", "ca", "co", "cs", "cy", "da", "de", "dz", "el", + "en", "eo", "es", "et", "eu", "fa", "fi", "fj", "fo", "fr", "fy", "ga", + "gd", "gl", "gn", "gu", "ha", "he", "hi", "hr", "hu", "hy", "ia", "id", + "ie", "ik", "in", "is", "it", "iu", "iw", "ja", "ji", "jw", "ka", "kk", + "kl", "km", "kn", "ko", "ks", "ku", "ky", "la", "ln", "lo", "lt", "lv", + "mg", "mi", "mk", "ml", "mn", "mo", "mr", "ms", "mt", "my", "na", "ne", + "nl", "no", "oc", "om", "or", "pa", "pl", "ps", "pt", "qu", "rm", "rn", + "ro", "ru", "rw", "sa", "sd", "sg", "sh", "si", "sk", "sl", "sm", "sn", + "so", "sq", "sr", "ss", "st", "su", "sv", "sw", "ta", "te", "tg", "th", + "ti", "tk", "tl", "tn", "to", "tr", "ts", "tt", "tw", "ug", "uk", "ur", + "uz", "vi", "vo", "wo", "xh", "yi", "yo", "za", "zh", "zu" + }; } /** - * Returns the language code of this locale. - * @return language code portion of this locale, or an empty String if - * none exists + * Returns the language code of this locale. Some language codes have changed + * as ISO 639 has evolved; this returns the old name, even if you built + * the locale with the new one. + * + * @return language code portion of this locale, or an empty String */ public String getLanguage() { @@ -344,8 +389,8 @@ public final class Locale implements java.io.Serializable, Cloneable /** * Returns the country code of this locale. - * @return country code portion of this locale, or an empty String if - * none exists + * + * @return country code portion of this locale, or an empty String */ public String getCountry() { @@ -354,6 +399,8 @@ public final class Locale implements java.io.Serializable, Cloneable /** * Returns the variant code of this locale. + * + * @return the variant code portion of this locale, or an empty String */ public String getVariant() { @@ -361,214 +408,219 @@ public final class Locale implements java.io.Serializable, Cloneable } /** - * Gets the string representation of the current locale. This - * consists of the language, the country, and the variant, - * separated by an underscore. If one of this three component is - * missing the underscore will also disappear. - * @return the string representation of this Locale. + * Gets the string representation of the current locale. This consists of + * the language, the country, and the variant, separated by an underscore. + * The variant is listed only if there is a language or country. Examples: + * "en", "de_DE", "_GB", "en_US_WIN", "de__POSIX", "fr__MAC". + * + * @return the string representation of this Locale + * @see #getDisplayName() */ public final String toString() { + if (language.length() == 0 && country.length() == 0) + return ""; StringBuffer result = new StringBuffer(language); - String underscore = ""; - if (language.length() != 0) - underscore = "_"; - if (country.length() != 0) - { - result.append(underscore); - result.append(country); - underscore = "_"; - } + result.append('_').append(country); if (variant.length() != 0) - { - result.append(underscore); - result.append(variant); - } + result.append('_').append(variant); return result.toString(); } /** * Returns the three-letter ISO language abbrevation of this locale. - * @exception MissingResourceException if the three-letter code is not - * known. + * + * @throws MissingResourceException if the three-letter code is not known */ - public String getISO3Language() throws MissingResourceException + public String getISO3Language() { - int index = - ("aa,ab,af,am,ar,as,ay,az,ba,be,bg,bh,bi,bn,bo,br,ca,co,cs,cy," + - "da,de,dz,el,en,eo,es,et,eu,fa,fi,fj,fo,fr,fy,ga,gd,gl,gn,gu," + - "gv,ha,hi,hr,hu,hy,ia,ie,ik,id,is,it,iu,he,ja,yi,jw,ka,kk,kl," + - "km,kn,ko,ks,ku,kw,ky,la,lb,ln,lo,lt,lv,mg,mi,mk,ml,mn,mo,mr," + - "ms,mt,my,na,ne,nl,no,oc,om,or,pa,pl,ps,pt,qu,rm,rn,ro,ru,rw," + - "sa,sd,se,sg,sh,si,sk,sl,sm,sn,so,sq,sr,ss,st,su,sv,sw,ta,te," + - "tg,th,ti,tk,tl,tn,to,tr,ts,tt,tw,ug,uk,ur,uz,vi,vo,wo,xh,yo," + - "za,zh,zu,").indexOf(language + ","); - - if (index == -1 || language.length() != 2) + if ("".equals(language)) + return ""; + int index + = ("aa,ab,af,am,ar,as,ay,az,ba,be,bg,bh,bi,bn,bo,br,ca,co,cs,cy,da," + + "de,dz,el,en,eo,es,et,eu,fa,fi,fj,fo,fr,fy,ga,gd,gl,gn,gu,ha,iw," + + "hi,hr,hu,hy,ia,in,ie,ik,in,is,it,iu,iw,ja,ji,jw,ka,kk,kl,km,kn," + + "ko,ks,ku,ky,la,ln,lo,lt,lv,mg,mi,mk,ml,mn,mo,mr,ms,mt,my,na,ne," + + "nl,no,oc,om,or,pa,pl,ps,pt,qu,rm,rn,ro,ru,rw,sa,sd,sg,sh,si,sk," + + "sl,sm,sn,so,sq,sr,ss,st,su,sv,sw,ta,te,tg,th,ti,tk,tl,tn,to,tr," + + "ts,tt,tw,ug,uk,ur,uz,vi,vo,wo,xh,ji,yo,za,zh,zu") + .indexOf(language); + + if (index % 3 != 0 || language.length() != 2) throw new MissingResourceException - ("Can't find ISO3 language for " + language, - "java.util.Locale", language); + ("Can't find ISO3 language for " + language, + "java.util.Locale", language); - /* Don't read this aloud. This are the three letter language codes - */ + // Don't read this aloud. These are the three letter language codes. return - ("aarabkaframharaasmaymazebakbelbulbihbisbenbodbrecatcoscescym" + - "dandeudzoellengepospaesteusfasfinfijfaofrafrygaigdhglggrnguj" + - "maxhauhinhrvhunhyeinaileipkindislitaikuhebjpnyidjawkatkazkal" + - "khmkankorkaskurcorkirlatltzlinlaolitlavmlgmrimkdmalmonmolmar" + - "msamltmyanaunepnldnorociormoripanpolpusporquerohrunronruskin" + - "sansndsmisagsrpsinslkslvsmosnasomsqisrpsswsotsunsweswatamtel" + - "tgkthatirtuktgltsntonturtsotattwiuigukrurduzbvievolwolxhoyor" + - "zhazhozul").substring(index, index + 3); + ("aarabkaframharaasmaymazebakbelbulbihbisbenbodbrecatcoscescymdandeu" + + "dzoellengepospaesteusfasfinfijfaofrafrygaigdhglggrngujhauhebhinhrv" + + "hunhyeinaindileipkindislitaikuhebjpnyidjawkatkazkalkhmkankorkaskur" + + "kirlatlinlaolitlavmlgmrimkdmalmonmolmarmsamltmyanaunepnldnorociorm" + + "oripanpolpusporquerohrunronruskinsansndsagsrpsinslkslvsmosnasomsqi" + + "srpsswsotsunsweswatamteltgkthatirtuktgltsntonturtsotattwiuigukrurd" + + "uzbvievolwolxhoyidyorzhazhozul") + .substring(index, index + 3); } /** * Returns the three-letter ISO country abbrevation of the locale. - * @exception MissingResourceException if the three-letter code is not - * known. + * + * @throws MissingResourceException if the three-letter code is not known */ - public String getISO3Country() throws MissingResourceException + public String getISO3Country() { - int index = - ("AF,AL,DZ,AS,AD,AO,AI,AQ,AG,AR,AM,AW,AU,AT,AZ,BS,BH,BD,BB,BY,BE," + - "BZ,BJ,BM,BT,BO,BA,BW,BV,BR,IO,BN,BG,BF,BI,KH,CM,CA,CV,KY,CF,TD," + - "CL,CN,CX,CC,CO,KM,CG,CD,CK,CR,CI,HR,CU,CY,CZ,DK,DJ,DM,DO,TP,EC," + - "EG,SV,GQ,ER,EE,ET,FK,FO,FJ,FI,FR,FX,GF,PF,TF,GA,GM,GE,DE,GH,GI," + - "GR,GL,GD,GP,GU,GT,GN,GW,GY,HT,HM,VA,HN,HK,HU,IS,IN,ID,IR,IQ,IE," + - "IL,IT,JM,JP,JO,KZ,KE,KI,KP,KR,KW,KG,LA,LV,LB,LS,LR,LY,LI,LT,LU," + - "MO,MK,MG,MW,MY,MV,ML,MT,MH,MQ,MR,MU,YT,MX,FM,MD,MC,MN,MS,MA,MZ," + - "MM,NA,NR,NP,NL,AN,NC,NZ,NI,NE,NG,NU,NF,MP,NO,OM,PK,PW,PA,PG,PY," + - "PE,PH,PN,PL,PT,PR,QA,RE,RO,RU,RW,KN,LC,VC,WS,SM,ST,SA,SN,SC,SL," + - "SG,SK,SI,SB,SO,ZA,GS,ES,LK,SH,PM,SD,SR,SJ,SZ,SE,CH,SY,TW,TJ,TZ," + - "TH,TG,TK,TO,TT,TN,TR,TM,TC,TV,UG,UA,AE,GB,US,UM,UY,UZ,VU,VE,VN," + - "VG,VI,WF,EH,YE,YU,ZM,ZW,").indexOf(country + ","); - - if (index == -1 || language.length() != 2) + if ("".equals(country)) + return ""; + int index + = ("AD,AE,AF,AG,AI,AL,AM,AN,AO,AQ,AR,AS,AT,AU,AW,AZ,BA,BB,BD,BE,BF," + + "BG,BH,BI,BJ,BM,BN,BO,BR,BS,BT,BV,BW,BY,BZ,CA,CC,CF,CG,CH,CI,CK," + + "CL,CM,CN,CO,CR,CU,CV,CX,CY,CZ,DE,DJ,DK,DM,DO,DZ,EC,EE,EG,EH,ER," + + "ES,ET,FI,FJ,FK,FM,FO,FR,FX,GA,GB,GD,GE,GF,GH,GI,GL,GM,GN,GP,GQ," + + "GR,GS,GT,GU,GW,GY,HK,HM,HN,HR,HT,HU,ID,IE,IL,IN,IO,IQ,IR,IS,IT," + + "JM,JO,JP,KE,KG,KH,KI,KM,KN,KP,KR,KW,KY,KZ,LA,LB,LC,LI,LK,LR,LS," + + "LT,LU,LV,LY,MA,MC,MD,MG,MH,MK,ML,MM,MN,MO,MP,MQ,MR,MS,MT,MU,MV," + + "MW,MX,MY,MZ,NA,NC,NE,NF,NG,NI,NL,NO,NP,NR,NU,NZ,OM,PA,PE,PF,PG," + + "PH,PK,PL,PM,PN,PR,PT,PW,PY,QA,RE,RO,RU,RW,SA,SB,SC,SD,SE,SG,SH," + + "SI,SJ,SK,SL,SM,SN,SO,SR,ST,SV,SY,SZ,TC,TD,TF,TG,TH,TJ,TK,TM,TN," + + "TO,TP,TR,TT,TV,TW,TZ,UA,UG,UM,US,UY,UZ,VA,VC,VE,VG,VI,VN,VU,WF," + + "WS,YE,YT,YU,ZA,ZM,ZR,ZW") + .indexOf(country); + + if (index % 3 != 0 || language.length() != 2) throw new MissingResourceException - ("Can't find ISO3 country for " + country, - "java.util.Locale", country); + ("Can't find ISO3 country for " + country, + "java.util.Locale", country); - /* Don't read this aloud. This are the three letter country codes - */ + // Don't read this aloud. These are the three letter country codes. return - ("AFGALBDZAASMANDAGOAIAATAATGARGARMABWAUSAUTAZEBHSBHRBGDBRBBLRBEL" + - "BLZBENBMUBTNBOLBIHBWABVTBRAIOTBRNBGRBFABDIKHMCMRCANCPVCYMCAFTCD" + - "CHLCHNCXRCCKCOLCOMCOGCODCOKCRICIVHRVCUBCYPCZEDNKDJIDMADOMTMPECU" + - "EGYSLVGNQERIESTETHFLKFROFJIFINFRAFXXGUFPYFATFGABGMBGEODEUGHAGIB" + - "GRCGRLGRDGLPGUMGTMGINGNBGUYHTIHMDVATHNDHKGHUNISLINDIDNIRNIRQIRL" + - "ISRITAJAMJPNJORKAZKENKIRPRKKORKWTKGZLAOLVALBNLSOLBRLBYLIELTULUX" + - "MACMKDMDGMWIMYSMDVMLIMLTMHLMTQMRTMUSMYTMEXFSMMDAMCOMNGMSRMARMOZ" + - "MMRNAMNRUNPLNLDANTNCLNZLNICNERNGANIUNFKMNPNOROMNPAKPLWPANPNGPRY" + - "PERPHLPCNPOLPRTPRIQATREUROMRUSRWAKNALCAVCTWSMSMRSTPSAUSENSYCSLE" + - "SGPSVKSVNSLBSOMZAFSGSESPLKASHNSPMSDNSURSJMSWZSWECHESYRTWNTJKTZA" + - "THATGOTKLTONTTOTUNTURTKMTCATUVUGAUKRAREGBRUSAUMIURYUZBVUTVENVNM" + - "VGBVIRWLFESHYEMYUGZMBZWE").substring(index, index + 3); + ("ANDAREAFGATGAIAALBARMANTAGOATAARGASMAUTAUSABWAZEBIHBRBBGDBELBFABGR" + + "BHRBDIBENBMUBRNBOLBRABHSBTNBVTBWABLRBLZCANCCKCAFCOGCHECIVCOKCHLCMR" + + "CHNCOLCRICUBCPVCXRCYPCZEDEUDJIDNKDMADOMDZAECUESTEGYESHERIESPETHFIN" + + "FJIFLKFSMFROFRAFXXGABGBRGRDGEOGUFGHAGIBGRLGMBGINGLPGNQGRCSGSGTMGUM" + + "GNBGUYHKGHMDHNDHRVHTIHUNIDNIRLISRINDIOTIRQIRNISLITAJAMJORJPNKENKGZ" + + "KHMKIRCOMKNAPRKKORKWTCYMKAZLAOLBNLCALIELKALBRLSOLTULUXLVALBYMARMCO" + + "MDAMDGMHLMKDMLIMMRMNGMACMNPMTQMRTMSRMLTMUSMDVMWIMEXMYSMOZNAMNCLNER" + + "NFKNGANICNLDNORNPLNRUNIUNZLOMNPANPERPYFPNGPHLPAKPOLSPMPCNPRIPRTPLW" + + "PRYQATREUROMRUSRWASAUSLBSYCSDNSWESGPSHNSVNSJMSVKSLESMRSENSOMSURSTP" + + "SLVSYRSWZTCATCDATFTGOTHATJKTKLTKMTUNTONTMPTURTTOTUVTWNTZAUKRUGAUMI" + + "USAURYUZBVATVCTVENVGBVIRVNMVUTWLFWSMYEMMYTYUGZAFZMBZARZWE") + .substring(index, index + 3); } - /** + /** * Gets the country name suitable for display to the user, formatted * for the default locale. This has the same effect as * <pre> * getDisplayLanguage(Locale.getDefault()); * </pre> * - * @return the language name of this locale localized to the - * default locale. If the localized is not found, the ISO code - * is returned. + * @return the language name of this locale localized to the default locale, + * with the ISO code as backup */ public String getDisplayLanguage() { - return getDisplayLanguage(getDefault()); + return getDisplayLanguage(defaultLocale); } - /** + /** * Gets the language name suitable for display to the user, formatted * for a specified locale. + * * @param locale locale to use for formatting - * @return the language name of this locale localized to the - * given locale. If the localized is not found, the ISO code - * is returned. + * @return the language name of this locale localized to the given locale, + * with the ISO code as backup */ public String getDisplayLanguage(Locale locale) { try { - ResourceBundle bundle - = ResourceBundle.getBundle("gnu.java.locale.iso639", locale); - return bundle.getString(language); + ResourceBundle bundle + = ResourceBundle.getBundle("gnu.java.locale.iso639", locale); + return bundle.getString(language); } catch (MissingResourceException ex) { - return language; + return language; } } - /** + /** * Returns the country name of this locale localized to the - * default locale. If the localized is not found, the ISO code - * is returned. This has the same effect as + * default locale. If the localized is not found, the ISO code + * is returned. This has the same effect as * <pre> * getDisplayCountry(Locale.getDefault()); * </pre> + * + * @return the country name of this locale localized to the given locale, + * with the ISO code as backup */ public String getDisplayCountry() { - return getDisplayCountry(getDefault()); + return getDisplayCountry(defaultLocale); } - /** + /** * Gets the country name suitable for display to the user, formatted * for a specified locale. * * @param locale locale to use for formatting - * @return the country name of this locale localized to the given - * locale. If the localized is not found, the ISO country code is - * returned. */ + * @return the country name of this locale localized to the given locale, + * with the ISO code as backup + */ public String getDisplayCountry(Locale locale) { try { - ResourceBundle bundle = - ResourceBundle.getBundle("gnu.java.locale.iso3166", locale); - return bundle.getString(country); + ResourceBundle bundle = + ResourceBundle.getBundle("gnu.java.locale.iso3166", locale); + return bundle.getString(country); } catch (MissingResourceException ex) { - return country; + return country; } } - /** + /** * Returns the variant name of this locale localized to the - * default locale. If the localized is not found, the variant code - * itself is returned. This has the same effect as + * default locale. If the localized is not found, the variant code + * itself is returned. This has the same effect as * <pre> * getDisplayVariant(Locale.getDefault()); * </pre> + * + * @return the variant code of this locale localized to the given locale, + * with the ISO code as backup */ public String getDisplayVariant() { - return getDisplayVariant(getDefault()); + return getDisplayVariant(defaultLocale); } - /** + /** * Returns the variant name of this locale localized to the - * given locale. If the localized is not found, the variant code + * given locale. If the localized is not found, the variant code * itself is returned. + * + * @param locale locale to use for formatting + * @return the variant code of this locale localized to the given locale, + * with the ISO code as backup */ public String getDisplayVariant(Locale locale) { - /*XXX - load a bundle? */ + // XXX - load a bundle? return variant; } /** * Gets all local components suitable for display to the user, formatted - * for the default locale. For the language component, getDisplayLanguage - * is called. For the country component, getDisplayCountry is called. + * for the default locale. For the language component, getDisplayLanguage + * is called. For the country component, getDisplayCountry is called. * For the variant set component, getDisplayVariant is called. - * <br><br> - * The returned String will be one of the following forms:<br> + * + * <p>The returned String will be one of the following forms:<br> * <pre> * language (country, variant) * language (country) @@ -578,22 +630,22 @@ public final class Locale implements java.io.Serializable, Cloneable * country * variant * </pre> - * @return String version of this locale, suitable for display to the - * user. + * + * @return String version of this locale, suitable for display to the user */ public String getDisplayName() { - return getDisplayName(getDefault()); + return getDisplayName(defaultLocale); } /** * Gets all local components suitable for display to the user, formatted - * for a specified locale. For the language component, - * getDisplayLanguage(Locale) is called. For the country component, - * getDisplayCountry(Locale) is called. For the variant set component, + * for a specified locale. For the language component, + * getDisplayLanguage(Locale) is called. For the country component, + * getDisplayCountry(Locale) is called. For the variant set component, * getDisplayVariant(Locale) is called. - * <br><br> - * The returned String will be one of the following forms:<br> + * + * <p>The returned String will be one of the following forms:<br> * <pre> * language (country, variant) * language (country) @@ -605,63 +657,53 @@ public final class Locale implements java.io.Serializable, Cloneable * </pre> * * @param locale locale to use for formatting - * - * @return String version of this locale, suitable for display to the - * user. + * @return String version of this locale, suitable for display to the user */ public String getDisplayName(Locale locale) { StringBuffer result = new StringBuffer(); int count = 0; String[] delimiters = {"", " (", ","}; - if (language.length() != 0) { - result.append(delimiters[count++]); - result.append(getDisplayLanguage(locale)); + result.append(delimiters[count++]); + result.append(getDisplayLanguage(locale)); } - if (country.length() != 0) { - result.append(delimiters[count++]); - result.append(getDisplayCountry(locale)); + result.append(delimiters[count++]); + result.append(getDisplayCountry(locale)); } - if (variant.length() != 0) { - result.append(delimiters[count++]); - result.append(getDisplayVariant(locale)); + result.append(delimiters[count++]); + result.append(getDisplayVariant(locale)); } - if (count > 1) result.append(")"); - return result.toString(); } /** * Does the same as <code>Object.clone()</code> but does not throw - * an <code>CloneNotSupportedException</code>. Why anyone would - * use this method is a secret to me, since this class is - * immutable. + * a <code>CloneNotSupportedException</code>. Why anyone would + * use this method is a secret to me, since this class is immutable. + * + * @return the clone */ public Object clone() { - try - { - return super.clone(); - } - catch (CloneNotSupportedException ex) - { - return null; - } + // This class is final, so no need to use native super.clone(). + return new Locale(language, country, variant); } /** - * Return the hash code for this locale. The hashcode is the logical + * Return the hash code for this locale. The hashcode is the logical * xor of the hash codes of the language, the country and the variant. * The hash code is precomputed, since <code>Locale</code>s are often * used in hash tables. + * + * @return the hashcode */ public synchronized int hashCode() { @@ -671,30 +713,34 @@ public final class Locale implements java.io.Serializable, Cloneable } /** - * Compares two locales. - * @param obj the other locale. - * @return true, if obj is a Locale with the same language, country, and - * variant code as this locale, otherwise false. + * Compares two locales. To be equal, obj must be a Locale with the same + * language, country, and variant code. + * + * @param obj the other locale + * @return true if obj is equal to this */ public boolean equals(Object obj) { - if (this == obj) - return true; - if (!(obj instanceof Locale)) + if (! (obj instanceof Locale)) return false; Locale l = (Locale) obj; return (language.equals(l.language) - && country.equals(l.country) - && variant.equals(l.variant)); + && country.equals(l.country) + && variant.equals(l.variant)); } /** - * @serialdata According to jdk1.2 the hashcode should always be - * written as -1; + * Write the locale to an object stream. + * + * @param output the stream to write to + * @throws IOException if the write fails + * @serialData the hashcode should always be written as -1, and recomputed + * when reading it back */ - private synchronized void writeObject(java.io.ObjectOutputStream output) - throws java.io.IOException + private synchronized void writeObject(ObjectOutputStream output) + throws IOException { + // Synchronized so that hashCode() doesn't get wrong value. int tmpHashcode = hashcode; hashcode = -1; output.defaultWriteObject(); @@ -702,13 +748,17 @@ public final class Locale implements java.io.Serializable, Cloneable } /** - * @serialdata According to jdk1.2 the hashCode is always invalid - * and must be recomputed. + * Reads a locale from the input stream. + * + * @param input the stream to read from + * @throws IOException if reading fails + * @throws ClassNotFoundException if reading fails + * @serialData the hashCode is always invalid and must be recomputed */ - private void readObject(java.io.ObjectInputStream input) - throws java.io.IOException, ClassNotFoundException + private void readObject(ObjectInputStream input) + throws IOException, ClassNotFoundException { input.defaultReadObject(); hashcode = language.hashCode() ^ country.hashCode() ^ variant.hashCode(); } -} +} // class Locale diff --git a/libjava/java/util/ResourceBundle.java b/libjava/java/util/ResourceBundle.java index 895c8871137..150a01bf44f 100644 --- a/libjava/java/util/ResourceBundle.java +++ b/libjava/java/util/ResourceBundle.java @@ -1,5 +1,5 @@ -/* java.util.ResourceBundle - Copyright (C) 1998, 1999, 2001 Free Software Foundation, Inc. +/* ResourceBundle -- aids in loading resource bundles + Copyright (C) 1998, 1999, 2001, 2002 Free Software Foundation, Inc. This file is part of GNU Classpath. @@ -37,93 +37,106 @@ exception statement from your version. */ package java.util; + import java.lang.ref.Reference; import java.lang.ref.SoftReference; +import java.io.InputStream; +import java.io.IOException; import java.security.AccessController; import java.security.PrivilegedAction; import gnu.classpath.Configuration; /** - * A resource bundle contains locale-specific data. If you need - * localized data, you can load a resource bundle that matches the - * locale with <code>getBundle</code>. Now you can get your object by - * calling <code>getObject</code> or <code>getString</code> on that - * bundle. - * <br> - * When a bundle is demanded for a specific locale, the ResourceBundle - * is searched in following order (<i>def. language code<i> stands for - * the two letter ISO language code of the default locale (see + * A resource bundle contains locale-specific data. If you need localized + * data, you can load a resource bundle that matches the locale with + * <code>getBundle</code>. Now you can get your object by calling + * <code>getObject</code> or <code>getString</code> on that bundle. + * + * <p>When a bundle is demanded for a specific locale, the ResourceBundle + * is searched in following order (<i>def. language<i> stands for the + * two letter ISO language code of the default locale (see * <code>Locale.getDefault()</code>). - * <pre> - * baseName_<i>language code</i>_<i>country code</i>_<i>variant</i> - * baseName_<i>language code</i>_<i>country code</i> - * baseName_<i>language code</i> - * baseName_<i>def. language code</i>_<i>def. country code</i>_<i>def. variant</i> - * baseName_<i>def. language code</i>_<i>def. country code</i> - * baseName_<i>def. language code</i> - * baseName - * </pre> * - * A bundle is backed up, by less specific bundle (omiting variant, - * country or language). But it is not backed up by the default - * language locale. - * <br> - * If you provide a bundle for a given locale, say +<pre>baseName_<i>language code</i>_<i>country code</i>_<i>variant</i> +baseName_<i>language code</i>_<i>country code</i> +baseName_<i>language code</i> +baseName_<i>def. language</i>_<i>def. country</i>_<i>def. variant</i> +baseName_<i>def. language</i>_<i>def. country</i> +baseName_<i>def. language</i> +baseName</pre> + * + * <p>A bundle is backed up by less specific bundles (omiting variant, country + * or language). But it is not backed up by the default language locale. + * + * <p>If you provide a bundle for a given locale, say * <code>Bundle_en_UK_POSIX</code>, you must also provide a bundle for * all sub locales, ie. <code>Bundle_en_UK</code>, <code>Bundle_en</code>, and * <code>Bundle</code>. - * <br> - * When a bundle is searched, we look first for a class with - * the given name and if that is not found for a file with - * <code>.properties</code> extension in the classpath. The name - * must be a fully qualified classname (with dots as path separators). - * <br> - * (Note: This implementation always backs up the class with a - * properties file if that is existing, but you shouldn't rely on - * this, if you want to be compatible to the standard JDK.) * + * <p>When a bundle is searched, we look first for a class with the given + * name, then for a file with <code>.properties</code> extension in the + * classpath. The name must be a fully qualified classname (with dots as + * path separators). + * + * <p>(Note: This implementation always backs up the class with a properties + * file if that is existing, but you shouldn't rely on this, if you want to + * be compatible to the standard JDK.) + * + * @author Jochen Hoenicke + * @author Eric Blake (ebb9@email.byu.edu) * @see Locale + * @see ListResourceBundle * @see PropertyResourceBundle - * @author Jochen Hoenicke */ + * @since 1.1 + * @status updated to 1.4 + */ public abstract class ResourceBundle { /** - * The parent bundle. This is consulted when you call getObject - * and there is no such resource in the current bundle. This - * field may be null. + * The parent bundle. This is consulted when you call getObject and there + * is no such resource in the current bundle. This field may be null. */ protected ResourceBundle parent; /** - * The locale of this resource bundle. You can read this with + * The locale of this resource bundle. You can read this with * <code>getLocale</code> and it is automatically set in - * <code>getBundle</code>. + * <code>getBundle</code>. */ private Locale locale; /** - * We override SecurityManager in order to access getClassContext(). + * We override SecurityManager in order to access getClassContext(). */ - static class Security extends SecurityManager + private static final class Security extends SecurityManager { - /** Return the ClassLoader of the class which called into this - ResourceBundle, or null if it cannot be determined. */ + /** + * Avoid accessor method of private constructor. + */ + Security() + { + } + + /** + * Return the ClassLoader of the class which called into this + * ResourceBundle, or null if it cannot be determined. + */ ClassLoader getCallingClassLoader() { - Class[] stack = super.getClassContext(); + Class[] stack = getClassContext(); for (int i = 0; i < stack.length; i++) if (stack[i] != Security.class && stack[i] != ResourceBundle.class) - return stack[i].getClassLoader(); + return stack[i].getClassLoader(); return null; } } - - // This will always work since java.util classes have (all) system - // permissions. - static Security security = (Security) AccessController.doPrivileged - ( - new PrivilegedAction() + + /** A security context for grabbing the correct class loader. */ + private static final Security security + = (Security) AccessController.doPrivileged(new PrivilegedAction() { + // This will always work since java.util classes have (all) system + // permissions. public Object run() { return new Security(); @@ -132,343 +145,401 @@ public abstract class ResourceBundle ); /** - * The constructor. It does nothing special. + * The resource bundle cache. This is a two-level hash map: The key + * is the class loader, the value is a new HashMap. The key of this + * second hash map is the localized name, the value is a soft + * references to the resource bundle. + */ + private static final Map resourceBundleCache = new HashMap(); + + /** + * The `empty' locale is created once in order to optimize + * tryBundle(). + */ + private static final Locale emptyLocale = new Locale(""); + + /** + * The constructor. It does nothing special. */ public ResourceBundle() { } /** - * Get a String from this resource bundle. Since most localized - * Objects are Strings, this method provides a convenient way to get - * them without casting. - * @param key the name of the resource. - * @exception MissingResourceException - * if that particular object could not be found in this bundle nor - * the parent bundle. + * Get a String from this resource bundle. Since most localized Objects + * are Strings, this method provides a convenient way to get them without + * casting. + * + * @param key the name of the resource + * @throws MissingResourceException if the resource can't be found + * @throws NullPointerException if key is null + * @throws ClassCastException if resource is not a string */ - public final String getString(String key) throws MissingResourceException + public final String getString(String key) { return (String) getObject(key); } /** - * Get an array of Strings from this resource bundle. This method + * Get an array of Strings from this resource bundle. This method * provides a convenient way to get it without casting. - * @param key the name of the resource. - * @exception MissingResourceException - * if that particular object could not be found in this bundle nor - * the parent bundle. + * + * @param key the name of the resource + * @throws MissingResourceException if the resource can't be found + * @throws NullPointerException if key is null + * @throws ClassCastException if resource is not a string */ public final String[] getStringArray(String key) - throws MissingResourceException { return (String[]) getObject(key); } /** - * Get an object from this resource bundle. - * @param key the name of the resource. - * @exception MissingResourceException - * if that particular object could not be found in this bundle nor - * the parent bundle. + * Get an object from this resource bundle. This will call + * <code>handleGetObject</code> for this resource and all of its parents, + * until it finds a non-null resource. + * + * @param key the name of the resource + * @throws MissingResourceException if the resource can't be found + * @throws NullPointerException if key is null */ - public final Object getObject(String key) throws MissingResourceException + public final Object getObject(String key) { for (ResourceBundle bundle = this; bundle != null; bundle = bundle.parent) - { - try - { - Object o = bundle.handleGetObject(key); - if (o != null) - return o; - } - catch (MissingResourceException ex) - { - } - } - throw new MissingResourceException - ("Key not found", getClass().getName(), key); + try + { + Object o = bundle.handleGetObject(key); + if (o != null) + return o; + } + catch (MissingResourceException ex) + { + } + throw new MissingResourceException("Key not found", + getClass().getName(), key); } /** - * Get the appropriate ResourceBundle for the default locale. - * @param baseName the name of the ResourceBundle. This should be - * a name of a Class or a properties-File. See the class - * description for details. - * @return the desired resource bundle - * @exception MissingResourceException - * if the resource bundle couldn't be found. + * Return the actual locale of this bundle. You can use it after calling + * getBundle, to know if the bundle for the desired locale was loaded or + * if the fall back was used. + * + * @return the bundle's locale */ - public static final ResourceBundle getBundle(String baseName) - throws MissingResourceException + public Locale getLocale() { - return getBundle(baseName, Locale.getDefault(), - security.getCallingClassLoader()); + return locale; } /** - * Get the appropriate ResourceBundle for the given locale. - * @param baseName the name of the ResourceBundle. This should be - * a name of a Class or a properties-File. See the class - * description for details. - * @param locale A locale. - * @return the desired resource bundle - * @exception MissingResourceException - * if the resource bundle couldn't be found. + * Set the parent of this bundle. The parent is consulted when you call + * getObject and there is no such resource in the current bundle. + * + * @param parent the parent of this bundle */ - public static final ResourceBundle getBundle(String baseName, - Locale locale) - throws MissingResourceException + protected void setParent(ResourceBundle parent) { - return getBundle(baseName, locale, security.getCallingClassLoader()); + // Shall we ignore the old parent? + this.parent = parent; } /** - * The resource bundle cache. This is a two-level hash map: The key - * is the class loader, the value is a new HashMap. The key of this - * second hash map is the localized name, the value is a soft - * references to the resource bundle. */ - private static Map resourceBundleCache = new HashMap(); - - /** - * The `empty' locale is created once in order to optimize - * tryBundle(). - */ - private static final Locale emptyLocale = new Locale ("", ""); - - /** - * Tries to load a class or a property file with the specified name. - * @param localizedName the name. - * @param locale the locale, that must be used exactly. - * @param classloader the classloader. - * @param bundle the back up (parent) bundle - * @return the resource bundle if that could be loaded, otherwise - * <code>bundle</code>. + * Get the appropriate ResourceBundle for the default locale. This is like + * calling <code>getBundle(baseName, Locale.getDefault(), + * getClass().getClassLoader()</code>, except that any security check of + * getClassLoader won't fail. + * + * @param baseName the name of the ResourceBundle + * @return the desired resource bundle + * @throws MissingResourceException if the resource bundle can't be found + * @throws NullPointerException if baseName is null */ - private static final ResourceBundle tryBundle(String localizedName, - Locale locale, - ClassLoader classloader, - ResourceBundle bundle, - HashMap cache) + public static final ResourceBundle getBundle(String baseName) { - { - // First look into the cache. - // XXX We should remove cleared references from the cache. - Reference ref = (Reference) cache.get(localizedName); - if (ref != null) - { - ResourceBundle rb = (ResourceBundle) ref.get(); - if (rb != null) - // rb should already have the right parent, except if - // something very strange happened. - return rb; - } - } - - // foundBundle holds exact matches for the localizedName resource - // bundle, which may later be cached. - ResourceBundle foundBundle = null; - - try - { - java.io.InputStream is; - final String resourceName = - localizedName.replace('.', '/') + ".properties"; - if (classloader == null) - is = ClassLoader.getSystemResourceAsStream (resourceName); - else - is = classloader.getResourceAsStream (resourceName); - if (is != null) - { - foundBundle = new PropertyResourceBundle(is); - foundBundle.parent = bundle; - foundBundle.locale = locale; - } - } - catch (java.io.IOException ex) - { - } - - try - { - Class rbClass; - if (classloader == null) - rbClass = Class.forName(localizedName); - else - rbClass = classloader.loadClass(localizedName); - foundBundle = (ResourceBundle) rbClass.newInstance(); - foundBundle.parent = bundle; - foundBundle.locale = locale; - } - catch (ClassNotFoundException ex) - { - } - catch (IllegalAccessException ex) - { - } - catch (InstantiationException ex) - { - // ignore them all - // XXX should we also ignore ClassCastException? - } - - if (foundBundle != null) - cache.put(localizedName, new SoftReference(foundBundle)); - - return foundBundle != null ? foundBundle : bundle; + return getBundle(baseName, Locale.getDefault(), + security.getCallingClassLoader()); } /** - * Tries to load a the bundle for a given locale, also loads the backup - * locales with the same language. + * Get the appropriate ResourceBundle for the given locale. This is like + * calling <code>getBundle(baseName, locale, + * getClass().getClassLoader()</code>, except that any security check of + * getClassLoader won't fail. * - * @param name the name. - * @param locale the locale, that must be used exactly. - * @param classloader the classloader. - * @param bundle the back up (parent) bundle - * @return the resource bundle if that could be loaded, otherwise - * <code>bundle</code>. + * @param baseName the name of the ResourceBundle + * @param locale A locale + * @return the desired resource bundle + * @throws MissingResourceException if the resource bundle can't be found + * @throws NullPointerException if baseName or locale is null */ - private static final ResourceBundle tryLocalBundle(String baseName, - Locale locale, - ClassLoader classloader, - ResourceBundle bundle, - HashMap cache) + public static final ResourceBundle getBundle(String baseName, + Locale locale) { - final String language = locale.getLanguage(); - - if (language.length() > 0) - { - final String country = locale.getCountry(); - String name = baseName + "_" + language; - - if (country.length() != 0) - { - bundle = tryBundle(name, - new Locale(language, ""), - classloader, bundle, cache); - - name += "_" + country; - - final String variant = locale.getVariant(); - - if (variant.length() != 0) - { - bundle = tryBundle(name, - new Locale(language, - country), - classloader, bundle, cache); - - name += "_" + variant; - } - } - bundle = tryBundle(name, locale, classloader, bundle, cache); - } - return bundle; + return getBundle(baseName, locale, security.getCallingClassLoader()); } /** - * Get the appropriate ResourceBundle for the given locale. - * @param baseName the name of the ResourceBundle. This should be - * a name of a Class or a properties file. See the class - * description for details. - * @param locale A locale. - * @param classloader a ClassLoader. + * Get the appropriate ResourceBundle for the given locale. The following + * strategy is used: + * + * <p>A sequence of candidate bundle names are generated, and tested in + * this order, where the suffix 1 means the string from the specified + * locale, and the suffix 2 means the string from the default locale:<ul> + * <li>baseName + "_" + language1 + "_" + country1 + "_" + variant1</li> + * <li>baseName + "_" + language1 + "_" + country1</li> + * <li>baseName + "_" + language1</li> + * <li>baseName + "_" + language2 + "_" + country2 + "_" + variant2</li> + * <li>baseName + "_" + language2 + "_" + country2</li> + * <li>baseName + "_" + language2<li> + * <li>baseName</li> + * </ul> + * + * <p>In the sequence, entries with an empty string are ignored. Next, + * <code>getBundle</code> tries to instantiate the resource bundle:<ul> + * <li>First, an attempt is made to load a class in the specified classloader + * which is a subclass of ResourceBundle, and which has a public constructor + * with no arguments, via reflection.</li> + * <li>Next, a search is made for a property resource file, by replacing + * '.' with '/' and appending ".properties", and using + * ClassLoader.getResource(). If a file is found, then a + * PropertyResourceBundle is created from the file's contents.</li> + * </ul> + * If no resource bundle was found, a MissingResourceException is thrown. + * + * <p>Next, the parent chain is implemented. The remaining candidate names + * in the above sequence are tested in a similar manner, and if any results + * in a resource bundle, it is assigned as the parent of the first bundle + * using the <code>setParent</code> method (unless the first bundle already + * has a parent). + * + * <p>For example, suppose the following class and property files are + * provided: MyResources.class, MyResources_fr_CH.properties, + * MyResources_fr_CH.class, MyResources_fr.properties, + * MyResources_en.properties, and MyResources_es_ES.class. The contents of + * all files are valid (that is, public non-abstract subclasses of + * ResourceBundle with public nullary constructors for the ".class" files, + * syntactically correct ".properties" files). The default locale is + * Locale("en", "UK"). + * + * <p>Calling getBundle with the shown locale argument values instantiates + * resource bundles from the following sources:<ul> + * <li>Locale("fr", "CH"): result MyResources_fr_CH.class, parent + * MyResources_fr.properties, parent MyResources.class</li> + * <li>Locale("fr", "FR"): result MyResources_fr.properties, parent + * MyResources.class</li> + * <li>Locale("de", "DE"): result MyResources_en.properties, parent + * MyResources.class</li> + * <li>Locale("en", "US"): result MyResources_en.properties, parent + * MyResources.class</li> + * <li>Locale("es", "ES"): result MyResources_es_ES.class, parent + * MyResources.class</li> + * </ul> + * The file MyResources_fr_CH.properties is never used because it is hidden + * by MyResources_fr_CH.class. + * + * @param baseName the name of the ResourceBundle + * @param locale A locale + * @param classloader a ClassLoader * @return the desired resource bundle - * @exception MissingResourceException - * if the resource bundle couldn't be found. + * @throws MissingResourceException if the resource bundle can't be found + * @throws NullPointerException if any argument is null + * @since 1.2 */ // This method is synchronized so that the cache is properly // handled. - public static final synchronized ResourceBundle getBundle(String baseName, - Locale locale, - ClassLoader classLoader) - throws MissingResourceException + public static final synchronized ResourceBundle getBundle + (String baseName, Locale locale, ClassLoader classLoader) { // This implementation searches the bundle in the reverse direction // and builds the parent chain on the fly. - HashMap cache = (HashMap) resourceBundleCache.get(classLoader); + StringBuffer sb = new StringBuffer(60); + sb.append(baseName).append('_').append(locale); + String name = sb.toString(); + if (cache == null) { - cache = new HashMap(); - resourceBundleCache.put(classLoader, cache); + cache = new HashMap(); + resourceBundleCache.put(classLoader, cache); } else { - // Fast path: If baseName + "_" + locale is in cache use it. - String name = baseName + "_" + locale.toString(); - Reference ref = (Reference) cache.get(name); - if (ref != null) - { - ResourceBundle rb = (ResourceBundle) ref.get(); - if (rb != null) - // rb should already have the right parent, except if - // something very strange happened. - return rb; - } + Reference ref = (Reference) cache.get(name); + if (ref != null) + { + ResourceBundle rb = (ResourceBundle) ref.get(); + if (rb != null) + // rb should already have the right parent, except if + // something very strange happened. + return rb; + } } ResourceBundle baseBundle = tryBundle(baseName, emptyLocale, - classLoader, null, cache); + classLoader, null, cache); if (baseBundle == null) // JDK says, that if one provides a bundle base_en_UK, one // must also provide the bundles base_en and base. // This implies that if there is no bundle for base, there // is no bundle at all. - throw new MissingResourceException("Bundle " + baseName + " not found", baseName, ""); + throw new MissingResourceException("Bundle " + baseName + " not found", + baseName, ""); // Now use the default locale. ResourceBundle bundle = tryLocalBundle(baseName, locale, - classLoader, baseBundle, cache); + classLoader, baseBundle, cache); if (bundle == baseBundle && !locale.equals(Locale.getDefault())) - { - bundle = tryLocalBundle(baseName, Locale.getDefault(), - classLoader, baseBundle, cache); - } + bundle = tryLocalBundle(baseName, Locale.getDefault(), + classLoader, baseBundle, cache); + + // Check whether baseName_locale has been loaded; if not, map the + // "baseName" bundle to "baseName_locale" to avoid retrying to load + // baseName_locale. + Reference ref = (Reference) cache.get(name); + if (ref == null) + cache.put(name, new SoftReference(bundle)); + return bundle; } /** - * Return the actual locale of this bundle. You can use it after - * calling getBundle, to know if the bundle for the desired locale - * was loaded or if the fall back was used. + * Override this method to provide the resource for a keys. This gets + * called by <code>getObject</code>. If you don't have a resource + * for the given key, you should return null instead throwing a + * MissingResourceException. You don't have to ask the parent, getObject() + * already does this; nor should you throw a MissingResourceException. + * + * @param key the key of the resource + * @return the resource for the key, or null if not in bundle + * @throws NullPointerException if key is null */ - public Locale getLocale() - { - return locale; - } + protected abstract Object handleGetObject(String key); /** - * Set the parent of this bundle. This is consulted when you call - * getObject and there is no such resource in the current bundle. - * @param parent the parent of this bundle. + * This method should return all keys for which a resource exists; you + * should include the enumeration of any parent's keys, after filtering out + * duplicates. + * + * @return an enumeration of the keys */ - protected void setParent(ResourceBundle parent) - { - // Shall we ignore the old parent? - this.parent = parent; - } + public abstract Enumeration getKeys(); /** - * Override this method to provide the resource for a keys. This gets - * called by <code>getObject</code>. If you don't have a resource - * for the given key, you should return null instead throwing a - * MissingResourceException. You don't have to ask the parent, - * getObject() already does this. + * Tries to load a class or a property file with the specified name. * - * @param key The key of the resource. - * @return The resource for the key, or null if not in bundle. - * @exception MissingResourceException - * you shouldn't throw this. + * @param localizedName the name + * @param locale the locale, that must be used exactly + * @param classloader the classloader + * @param bundle the backup (parent) bundle + * @return the resource bundle if it was loaded, otherwise the backup */ - protected abstract Object handleGetObject(String key) - throws MissingResourceException; + private static final ResourceBundle tryBundle(String localizedName, + Locale locale, + ClassLoader classloader, + ResourceBundle bundle, + HashMap cache) + { + // First look into the cache. + // XXX We should remove cleared references from the cache. + Reference ref = (Reference) cache.get(localizedName); + if (ref != null) + { + ResourceBundle rb = (ResourceBundle) ref.get(); + if (rb != null) + // rb should already have the right parent, except if + // something very strange happened. + return rb; + } + + // foundBundle holds exact matches for the localizedName resource + // bundle, which may later be cached. + ResourceBundle foundBundle = null; + try + { + Class rbClass; + if (classloader == null) + rbClass = Class.forName(localizedName); + else + rbClass = classloader.loadClass(localizedName); + foundBundle = (ResourceBundle) rbClass.newInstance(); + foundBundle.parent = bundle; + foundBundle.locale = locale; + } + catch (Exception ex) + { + // ignore them all + } + if (foundBundle == null) + try + { + InputStream is; + final String resourceName + = localizedName.replace('.', '/') + ".properties"; + if (classloader == null) + is = ClassLoader.getSystemResourceAsStream(resourceName); + else + is = classloader.getResourceAsStream(resourceName); + if (is != null) + { + foundBundle = new PropertyResourceBundle(is); + foundBundle.parent = bundle; + foundBundle.locale = locale; + } + } + catch (IOException ex) + { + } + + if (foundBundle != null) + cache.put(localizedName, new SoftReference(foundBundle)); + + return foundBundle != null ? foundBundle : bundle; + } /** - * This method should return all keys for which a resource exists. - * @return An enumeration of the keys. + * Tries to load a the bundle for a given locale, also loads the backup + * locales with the same language. + * + * @param name the name + * @param locale the locale, that must be used exactly + * @param classloader the classloader + * @param bundle the backup (parent) bundle + * @return the resource bundle if it was loaded, otherwise the backup */ - public abstract Enumeration getKeys(); -} + private static final ResourceBundle tryLocalBundle(String baseName, + Locale locale, + ClassLoader classloader, + ResourceBundle bundle, + HashMap cache) + { + final String language = locale.getLanguage(); + StringBuffer sb = new StringBuffer(60); + + if (language.length() > 0) + { + final String country = locale.getCountry(); + sb.append(baseName).append('_').append(language); + String name = sb.toString(); + + if (country.length() != 0) + { + bundle = tryBundle(name, new Locale(language), + classloader, bundle, cache); + sb.append('_').append(country); + name = sb.toString(); + + final String variant = locale.getVariant(); + + if (variant.length() != 0) + { + bundle = tryBundle(name, new Locale(language, country), + classloader, bundle, cache); + sb.append('_').append(variant); + name = sb.toString(); + } + } + bundle = tryBundle(name, locale, classloader, bundle, cache); + } + return bundle; + } +} // class ResourceBundle |
